The URL can be used to link to this page

Home My WebLink About10-06-2025 AGENDA CITY COUNCIL MEETING October 6, 2025 - 6:00 PM City Hall Council Chambers Members of the public can participate in person at Lakeville City Hall, 20195 Holyoke Avenue. Members of the public may join the meeting via Teams Meeting,Meeting ID: 233 404 537 029 or by calling Toll Number 1-323-433-2142; Conference ID: 660 796 843#. The mayor will allow for public comments and questions at the appropriate time. The City Council is provided background information for agenda items in advance by staff and appointed commissions, committees, and boards. Decisions are based on this information, as well as City policy, practices, input from constituents, and a council member’s personal judgment. 1. Call to order, moment of silence and flag pledge 2. Roll Call 3. Citizen Comments 4. Additional agenda information 5. Presentations/Introductions a. Civic Pledge Proclamation b. Recognition of Police Department Promotions c. Public Works Department Quarterly Update 6. Consent Agenda a. Check Register Summary b. Minutes of the 09/15/2025 City Council Meeting c. Minutes of the 09/22/2025 City Council Work Session d. Resolution Awarding Construction Contract and Authorizing Funding for Launch Park Wetland Restoration e. Resolution Awarding Construction Contract to Sunram Construction for Stormwater Management Basin Maintenance f. Amendment to Contract with Summit Fire Protection Corporation g. Contract for City Hall Interior Painting h. Contract for Lakeville Area Art Center Boiler Replacement i. Authorize Funding and Approve Landscaping Services with Friedges Landscaping for Avonlea 4th Addition and Avonlea 5th Addition j. Professional Services Supplemental Agreement to Repaint the Water Tower in the Page 1 of 899 City Council Meeting Agenda October 6, 2025 Page 2 Dakota Heights Neighborhood k. Lease Agreement for Storage of Public Works Equipment l. Authorize Early Decertification of TIF 22 and Return Excess Tax Increment Funds to Dakota County m. Call Public Hearing Relating to Imposition of Service Charge for Special Services District No.1 n. Resolution Approving the Selection of the Brazos Citation Software Solution o. Kenyon Green Encroachment Agreement p. Rescue Truck Purchase q. Resolution Appointing Members to the Youth Advisory Commission r. Change Order for Highview Ave Trail Repair and Laigle Ave Cul-de-sac Installation s. DNR License for Utility to Cross Public Waters t. Amend the 2025 General Fund and Building Fund Budgets u. Resolution Authorizing Temporary Closing of City Streets for the Downtown Lakeville Boo (DLBoo) Event v. Master Agreement with Lakeville Lacrosse for Facility Use w. Contract with Action Target to Supply Tactical Wall System for the FiRST Center x. Amelia Meadows 2nd Addition Final Plat y. Master Agreement with Lakeville Baseball Association for Facility Use and Sponsorships z. Supplemental Agreement with Irrigation by Design, Inc. (IBD) for King Park Irrigation Filtration Installation aa. APPRO Development/NPL Expansion - Site Improvement Performance Agreement bb. Naming Rights Agreement Between the City of Lakeville, Lakeville Baseball Association and Jeff Belzer’s Todd Chevrolet, Incorporated for the Grand Prairie Park Grandstand cc. Resolution Awarding Agreement for Abatement and Demolition with Rachel Contracting at 17622 Dodd Boulevard dd. Supplemental Agreement with Bolton & Menk for Professional Services for Platting of 17622 Dodd Boulevard ee. Marketplace At Cedar Final Plat 7. Action Items a. Acknowledge Receipt of 2024 Annual Comprehensive Financial Report b. Public Hearing on the application for LFT Club Operations Company, Inc. dba "Life Time" for an On-Sale Intoxicating Liquor License c. Public Hearing for the Proposed 2026-2030 Capital Improvement Plan and Street Reconstruction Plan and the Intent to Issue General Obligation Street Reconstruction Bonds and General Obligation Capital Improvement Bonds d. Public Hearing and Resolution Adopting Assessment For Unpaid Special Charges Page 2 of 899 City Council Meeting Agenda October 6, 2025 Page 3 e. Chart House Conditional Use Permit Amendment and Variance f. Launch Park Fourth Addition Preliminary and Final Plat g. Spirit of Brandtjen Farm Commercial 7th Addition Preliminary and Final Plat 8. Unfinished Business 9. New Business 10. Announcements a. Next City Council Meeting October 20, 2025 b. Next City Council Work Session October 27, 2025 11. Adjourn Page 3 of 899 Date: 10/6/2025 Recognition of Police Department Promotions Proposed Action Staff recommends adoption of the following motion: Overview Supporting Information None Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Report Completed by: Page 4 of 899 Date: 10/6/2025 Check Register Summary Proposed Action Staff recommends adoption of the following motion: Move to approve the Check Register Summary. Overview Checks 327305- 327413 $1,695,231.77 ACH/EFT 22710- 22865 $2,968,636.15 Total $4,663,867.92 The City Council receives a list of expenditures paid (claims detail), which is available to the public upon request. The City serves as the fiscal agent for Lakeville Arenas and Dakota 911 and processes their accounts payable and payments – these amounts are not included in the total above. Supporting Information 1. 09.23.25 CKSUM-Checks 2. 09.23.25 CKSUM-ACH-EFT 3. Check Register 09.23.25 for October 6, 2025 Council Mtg - Checks 4. Check Register 09.23.25 for October 6, 2025 Council Mtg - ACH-EFT Financial Impact: $4,663,867.92 Budgeted: Yes Source: Various Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Cheri Donovan, Assistant Finance Director Page 5 of 899 Page 6 of 899 Page 7 of 899 MINUTES CITY COUNCIL MEETING September 15, 2025 - 6:00 PM City Hall Council Chambers 1. Call to order, moment of silence and flag pledge Mayor Hellier called the meeting to order at 6:00 P.M. 2. Roll Call Members Present: Mayor Hellier, Council Members Bermel, Lee, Volk, Wolter Staff Present: Justin Miller, City Administrator; Dave Kendal, City Attorney; Allyn Kuennen, Assistant City Administrator; Ann Orlofsky, City Clerk; Brad Paulson, Police Chief 3. Citizen Comments Jessica Saxton and Tanawah Downing, Chief Legal Strategist, addressed the City Council on the We Shall be Free Tour. Howard Schneider, Jersey Avenue, invited the City Council to participate in the Tour of Lakeville an 8-mile bike ride, on Saturday, September 20, at 9:00 a.m. 4. Additional agenda information None 5. Presentations/Introductions a. Proclamation for Manufacturing Month Mayor Hellier proclaimed the Month of October Manufacturing Month. 6. Consent Agenda Motion was made by Wolter, seconded by Lee, to approve the following: Voice vote was taken on the motion. Ayes - Hellier, Bermel, Lee, Volk, Wolter a. Check Register Summary b. Minutes of the 09/02/2025 City Council Meeting c. Kenyon Green Final Plat d. Resolution accepting a donation from Lakeville Public Safety Foundation e. Supplemental Agreement with WSB for Professional Services for Citywide Trail Gaps Improvement Project (Phase II) f. Temporary on-sale liquor license to Pawsitive Perspectives Assistance Dogs (PawPADs) Page 8 of 899 City Council Meeting Minutes September 15, 2025 Page 2 7. Action Items None 8. Unfinished Business None 9. New Business None 10. Announcements a. Next City Council Work Session September 22, 2025 b. Next City Council Meeting October 6, 2025 11. Adjourn to a closed session a. The City Council will meet in a closed session to discuss legal strategy related to the Minnesota Center for Environmental Advocacy vs. City of Lakeville and Olam Holdings 1, LLC Lawsuit, pursuant to Minn. Stat. 13D.05 Subd.3(b). Motion to Close the Meeting Motion was made by Bermel, seconded by Lee, to adjourn to closed session at 6:15 p.m. to discuss legal strategy related to the Minnesota Center for Environmental Advocacy vs. City of Lakeville and Olam Holdings 1, LLC Lawsuit, pursuant to Minn. Stat. 13D.05 Subd. 3(b). Voice vote was taken on the motion. Ayes - Hellier, Bermel, Lee, Volk, Wolter Motion to Open the Meeting Motion was made by Wolter, seconded by Volk, to open the meeting at 6:32 p.m. Voice vote was taken on the motion. Ayes - Hellier, Bermel, Lee, Volk, Wolter Adjourn Motion was made by Bermel, seconded by Lee to adjourn the regular City Council meeting at 6:32 p.m. Voice vote was taken on the motion. Ayes - Hellier, Bermel, Lee, Volk, Wolter Respectfully Submitted, __________________________________ Ann Orlofsky, City Clerk ____________________________ Luke M. Heller, Mayor Page 9 of 899 MINUTES CITY COUNCIL WORK SESSION September 22, 2025 - 6:00 PM Lakeville City Hall, Marion Conference Room 1.Call to order, moment of silence and flag pledge Mayor Hellier called the meeting to order at 6:00 p.m. Members Present: Mayor Hellier, Council Members Bermel, Lee, Volk, Wolter Staff Present: Justin Miller, City Administrator; Joe Masiarchin, Parks & Recreation Director; Allyn Kuennen, Assistant City Administrator; Taylor Snider, Assistant to the City Administrator; Tina Goodroad, Community Development Director; Mike Meyer, Fire Chief; Britt Nelson, Fire Inspector 2.Citizen Comments None 3.Discussion Items a.Sketch Plan Review for Warweg Property Community Development Director Tina Goodroad and Jeff Koch of Norsq Companies presented a sketch plan for the Warweg property. The property sketch was created based on the feedback received from Council and the community at the February work session. The City Council asked questions regarding the sketch plan and provided opinions on the appropriate land use for this parcel. The plan will continue to be reworked as the process continues. The following citizens addressed the City Council: Scott Newman, South Side of Lake Marion, Lakeville, MN Jill Lawrence, 9715 201st St W, Lakeville, MN Kim Newby, four-way stop by Antlers, Lakeville, MN Patty McDonald, Lake Marion, Lakeville, MN Rick Ringeisen, 20085 Italy Ave, Lakeville, MN Peter Thelen, 12119 Lucerne Trl, Lakeville, MN Jim Steffen, 10310 204th St W, Lakeville, MN Bob Erickson, 19081 Inndale Dr, Lakeville, MN Jeff Vandenbusch, 19371 Jersey Ave, Lakeville, MN Scott Nelson, 24347 Indio Path, Lakeville, MN b.East Community Park Survey Results & Preferred Master Plan Concept Parks and Recreation Director Joe Masiarchin presented the Preferred Master Plan Page 10 of 899 City Council Work Session Minutes September 22, 2025 Page 2 Concept for East Community Park. This concept was developed using the East Community Park survey results and other community feedback. City Council supported the proposed concept and was excited about the new amenities that this plan would bring to the park. c. Fire Department ITM (Inspect, Test, Maintain) Solution Fire Chief Mike Meyer and Fire Inspector Britt Nelson outlined requirements and best practices for fire protection system inspection, testing, and maintenance (ITM) in accordance with the 2024 International Fire Code and NFPA 1 standards. They emphasized that property owners were responsible for ensuring all fire and safety systems are properly maintained, tested, and documented, with records kept for at least three years and made available to the fire code official. Chief Meyer highlighted a cloud-based ITM (Inspect, Test, Maintain) platform as a modern solution that would help digitize reporting, automate notifications, centralize data, and improve communication. This would reduce the administrative burden and enhance compliance and safety. Staff also provided a draft ordinance that would require property owners to use a third- party electronic reporting system for ITM records, setting qualifications for inspectors, establishing timelines for reporting and repairs, and ensuring proper record retention, enforcement, and penalties for noncompliance. The City Council directed staff to move forward with the ordinance. d.New Fire Station Design Update Allyn Kuennen, Assistant City Administrator; Mike Meyer, Fire Chief; Brooke Jacobson and Quinn Hudson, with CNH Architects, presented a new fire station design update. City Council asked questions regarding the difference in this plan versus the original plan that was presented in 2023. Council then discussed the need for further cost reductions and directed staff to present revisions at the October work session. 4.Items for Future Discussion None 5.Committee/ City Administrator Updates None 6.Adjourn Motion was made by Volk, seconded by Lee, to adjourn. Voice vote was taken on the motion. Ayes — All in favor. Mayor Hellier adjourned the meeting at 8:14 p.m. Respectfully Submitted, Taylor Snider, Assistant to the City Administrator Luke M. Heller, Mayor Page 11 of 899 Date: 10/6/2025 Resolution Awarding Construction Contract and Authorizing Funding for Launch Park Wetland Restoration Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution awarding construction contract to Sunram Construction and funding for Kimley-Horn supplemental agreement for professional services for Launch Park Wetland Restoration, City Project 24-60. Overview The City, Dakota County and Vermillion River Watershed Joint Powers Organization (VRWJPO) are partnering to restore an existing wetland, City Project 24-60. The wetland is located within Outlot D, Airlake 70 First Addition (adjacent to a waterway tributary to South Creek) and was historically used for agricultural production. Improvements include best management strategies designed to improve wetland habitat and water quality, and reduce pollutant loading to South Creek (a designated trout stream). The project advances City water and natural resources initiatives and contributes toward meeting MPCA required mandates relating to pollution reduction. The City received three quotes for City Project 24-60, ranging from a low quote of $105,152.00 submitted by Sunram Construction to a high quote of $157,263.80. The engineer's estimate of the construction cost was $107,845.00. Kimley-Horn’s supplemental agreement includes the scope of services and estimated costs to provide professional services, including contract administration and construction services, and is subject to the Master Services Agreement dated September 20, 2021. The City, County and VRWJPO will share project responsibilities and costs consistent with terms and conditions established in a future Joint Powers Agreement. The City is the lead agency; therefore, the total project cost of $134,652 is reflected in this memo. The City's estimated cost is $30,000. Supporting Information 1. 2025.10.06 Resolution Awarding Construction Contract 2. 2025.10.06 Agreement for Construction 3. 2025.09.23 Summary of Quotes 4. 2025.08.22 Kimley-Horn Supplemental Agreement (Construction Services) Page 12 of 899 Financial Impact: $134,652 Budgeted: Yes Source: Utility Fund - Env. Res. Envision Lakeville Community Values: Access to a Multitude of Natural Amenities and Recreational Opportunities Report Completed by: Ann Messerschmidt, Environmental Resources Specialist II Page 13 of 899 CITY OF LAKEVILLE RESOLUTION NO. 25- Resolution Awarding Construction Contract to Sunram Construction, Inc. for Launch Park Wetland Restoration WHEREAS, the City of Lakeville received quotes on Friday, September 19, 2025, for Launch Park Wetland Restoration, City Project 24-60; and WHEREAS, the lowest responsible quote was from Sunram Construction, Inc. NOW, THEREFORE, BE IT RESOLVED, that the City Council of the City of Lakeville, Minnesota: Hereby awards the contract to the lowest responsible quoter that meets all the quote requirements, Sunram Construction, Inc., with a quote in the amount of $105,152.00. The construction is proposed to be completed as specified in the contract documents. ADOPTED by the Lakeville City Council this 6th day of October 2025. ______________________________ Luke M. Hellier, Mayor _________________________________ Ann Orlofsky, City Clerk Page 14 of 899 *$/:$</$1(:(7/$1'5(6725$7,213/$1 $*5((0(17 3$*( $*5((0(17%(7:((12:1(5$1'&2175$&725 )25&216758&7,21&2175$&7 7+,6$*5((0(17LVE\DQGEHWZHHQ&LW\RI/DNHYLOOH³2ZQHU´DQG ³&RQWUDFWRU´ 2ZQHUDQG&RQWUDFWRUKHUHE\DJUHHDVIROORZV $57,&/(±:25. &RQWUDFWRUVKDOOFRPSOHWHDOO:RUNDVVSHFLILHGRULQGLFDWHGLQWKH&RQWUDFW'RFXPHQWV7KH:RUN LVJHQHUDOO\GHVFULEHGDVIROORZV*DOZD\/DQH:HWODQG5HVWRUDWLRQ3ODQ $57,&/(±7+(352-(&7 7KH3URMHFWRIZKLFKWKH:RUNXQGHUWKH&RQWUDFW'RFXPHQWVLVDSDUWLVJHQHUDOO\GHVFULEHGDV IROORZV dŚĞ ƉƌŽũĞĐƚ ǁŝůů ŝŶĐůƵĚĞ ŐƌĂĚŝŶŐ͕ ƐĞĞĚŝŶŐ͕ ŚǇĚƌĂƵůŝĐ ĚĞƐŝŐŶ ŝŵƉƌŽǀĞŵĞŶƚƐ͕ ĂŶĚ ǁĞƚůĂŶĚ ƌĞƐƚŽƌĂƚŝŽŶĂƉƉůŝĐĂƚŝŽŶƐ͘ $57,&/(±(1*,1((5 7KH3URMHFWKDVEHHQGHVLJQHGE\.LPOH\+RUQDQG$VVRFLDWHV $57,&/(±&2175$&77,0(6 7LPHRIWKH(VVHQFH $ $OOWLPHOLPLWVIRU0LOHVWRQHVLIDQ\6XEVWDQWLDO&RPSOHWLRQDQGFRPSOHWLRQDQGUHDGLQHVVIRU ILQDOSD\PHQWDVVWDWHGLQWKH&RQWUDFW'RFXPHQWVDUHRIWKHHVVHQFHRIWKH&RQWUDFW &RQWUDFW7LPHV'DWHV $ 7KH:RUNZLOOEHVXEVWDQWLDOO\FRPSOHWHGRQRUEHIRUH'HFHPEHUDQGFRPSOHWHG DQGUHDG\IRUILQDOSD\PHQWLQDFFRUGDQFHZLWK3DUDJUDSKRIWKH*HQHUDO&RQGLWLRQV 6XEVWDQWLDO&RPSOHWLRQVKDOOLQFOXGHSODFHPHQWRIVHHGPRZLQJZHHGVSUD\LQJDQGDOORWKHU LWHPVIRUWKHZHWODQGWRUHDFKIXOOIXQFWLRQDOLW\ % 7KH:RUNZLOOEHILQDOFRPSOHWHGRQRUEHIRUH-XQHWK /LTXLGDWHG'DPDJHV $ &RQWUDFWRUDQG2ZQHUUHFRJQL]HWKDWWLPHLVRIWKHHVVHQFHDVVWDWHGLQ3DUDJUDSKDERYH DQG WKDW 2ZQHU ZLOO VXIIHU ILQDQFLDO DQG RWKHU ORVVHV LI WKH :RUN LV QRW FRPSOHWHG DQG 0LOHVWRQHV QRW DFKLHYHG ZLWKLQ WKH WLPHV VSHFLILHG LQ 3DUDJUDSK DERYH SOXV DQ\ H[WHQVLRQVWKHUHRIDOORZHGLQDFFRUGDQFHZLWKWKH&RQWUDFW7KHSDUWLHVDOVRUHFRJQL]HWKH GHOD\VH[SHQVHDQGGLIILFXOWLHVLQYROYHGLQSURYLQJLQDOHJDORUDUELWUDWLRQSURFHHGLQJWKH DFWXDOORVVVXIIHUHGE\2ZQHULIWKH:RUNLVQRWFRPSOHWHGRQWLPH$FFRUGLQJO\LQVWHDGRI UHTXLULQJDQ\VXFKSURRI2ZQHUDQG&RQWUDFWRUDJUHHWKDWDVOLTXLGDWHGGDPDJHVIRUGHOD\ EXWQRWDVDSHQDOW\ 7KHOLTXLGDWHGGDPDJHVVKDOOEHLQDFFRUGDQFHZLWK7DEOH6FKHGXOHRI/LTXLGDWHG 'DPDJHVIRUDOOVWDWHGFRPSOHWLRQGDWHVDVZHOODVDQ\LQWHUPHGLDWHFRPSOHWLRQGDWHV )DLOXUHWRSURYLGHWHPSRUDU\VWDELOL]DWLRQDQGDSSURSULDWHHURVLRQVHGLPHQWFRQWURO /LTXLGDWHGGDPDJHVZLOOEHFXPXODWLYHDQGVKDOOEHFROOHFWHGIRUHDFKSRUWLRQRIWKH SURMHFWXQGHUFRQVWUXFWLRQLQZKLFKWKHVSHFLILHGSDUDPHWHUVKDYHQRWEHHQPHW Page 15 of 899 *$/:$</$1(:(7/$1'5(6725$7,213/$1 $*5((0(17 3$*( $57,&/(±&2175$&735,&( 2ZQHUVKDOOSD\&RQWUDFWRUIRUFRPSOHWLRQRIWKH:RUNLQDFFRUGDQFHZLWKWKH&RQWUDFW'RFXPHQWV WKHDPRXQWVWKDWIROORZVXEMHFWWRDGMXVWPHQWXQGHUWKH&RQWUDFW $ )RUDOO8QLW3ULFH:RUNDQDPRXQWHTXDOWRWKHVXPRIWKHH[WHQGHGSULFHVHVWDEOLVKHGIRU HDFKVHSDUDWHO\LGHQWLILHGLWHPRI8QLW3ULFH:RUNE\PXOWLSO\LQJWKHXQLWSULFHWLPHVWKHDFWXDO TXDQWLW\RIWKDWLWHP7KH&RQWUDFWRU¶V4XRWHDWWDFKHGKHUHWRDVDQH[KLELWSURYLGHVWKH EDVLVIRUWKHH[WHQGHGSULFHVIRUWKH8QLW3ULFH:RUN7KHH[WHQGHGSULFHVIRU8QLW3ULFH:RUN VHWIRUWK DVRIWKH (IIHFWLYH'DWHRIWKH&RQWUDFWDUHEDVHGRQHVWLPDWHGTXDQWLWLHV$V SURYLGHG LQ 3DUDJUDSK RI WKH *HQHUDO &RQGLWLRQV HVWLPDWHG TXDQWLWLHV DUH QRW JXDUDQWHHGDQGGHWHUPLQDWLRQVRIDFWXDOTXDQWLWLHVDQGFODVVLILFDWLRQVDUHWREHPDGHE\ (QJLQHHU 7RWDORIDOO([WHQGHG3ULFHVIRU8QLW3ULFH:RUNVXEMHFWWRILQDODGMXVWPHQWEDVHGRQDFWXDO TXDQWLWLHV $57,&/(±3$<0(17352&('85(6 6XEPLWWDODQG3URFHVVLQJRI3D\PHQWV $ &RQWUDFWRUVKDOOVXEPLW$SSOLFDWLRQVIRU3D\PHQWLQDFFRUGDQFHZLWK$UWLFOHRIWKH*HQHUDO &RQGLWLRQV$SSOLFDWLRQVIRU3D\PHQWZLOOEHSURFHVVHGE\(QJLQHHUDVSURYLGHGLQWKH*HQHUDO &RQGLWLRQV 3URJUHVV3D\PHQWV5HWDLQDJH $ 2ZQHU VKDOO PDNH SURJUHVV SD\PHQWV RQ DFFRXQW RI WKH &RQWUDFW 3ULFH RQ WKH EDVLV RI &RQWUDFWRU¶V$SSOLFDWLRQVIRU3D\PHQWRQRUDERXWWKHWKLUG0RQGD\RIHDFKPRQWKGXULQJ SHUIRUPDQFH RI WKH :RUN DV SURYLGHG LQ 3DUDJUDSK $ EHORZ SURYLGHG WKDW VXFK $SSOLFDWLRQVIRU3D\PHQWKDYHEHHQVXEPLWWHGLQDWLPHO\PDQQHUDQGRWKHUZLVHPHHWWKH UHTXLUHPHQWVRIWKH&RQWUDFW$OOVXFKSD\PHQWVZLOOEHPHDVXUHGE\WKH6FKHGXOHRI9DOXHV HVWDEOLVKHGDVSURYLGHGLQWKH*HQHUDO&RQGLWLRQVDQGLQWKHFDVHRI8QLW3ULFH:RUNEDVHG RQWKHQXPEHURIXQLWVFRPSOHWHGRULQWKHHYHQWWKHUHLVQR6FKHGXOHRI9DOXHVDVSURYLGHG HOVHZKHUHLQWKH&RQWUDFW 3ULRUWR6XEVWDQWLDO&RPSOHWLRQSURJUHVVSD\PHQWVZLOOEHPDGHLQDQDPRXQWHTXDOWR WKH SHUFHQWDJH LQGLFDWHG EHORZ EXW LQ HDFK FDVH OHVV WKH DJJUHJDWH RI SD\PHQWV SUHYLRXVO\PDGHDQGOHVVVXFKDPRXQWVDV2ZQHUPD\ZLWKKROGLQFOXGLQJEXWQRWOLPLWHG WROLTXLGDWHGGDPDJHVLQDFFRUGDQFHZLWKWKH&RQWUDFW D SHUFHQWRI:RUNFRPSOHWHGZLWKWKHEDODQFHEHLQJUHWDLQDJH,IWKH:RUNKDV EHHQSHUFHQWFRPSOHWHGDVGHWHUPLQHGE\(QJLQHHUDQGLIWKHFKDUDFWHUDQG SURJUHVVRIWKH:RUNKDYHEHHQVDWLVIDFWRU\WR2ZQHUDQG(QJLQHHUWKHQDVORQJ DV WKH FKDUDFWHU DQG SURJUHVV RI WKH :RUN UHPDLQ VDWLVIDFWRU\ WR 2ZQHU DQG (QJLQHHUWKHUHZLOOEHQRDGGLWLRQDOUHWDLQDJHDQG E SHUFHQWRIFRVWRIPDWHULDOVDQGHTXLSPHQWQRWLQFRUSRUDWHGLQWKH:RUNZLWKWKH EDODQFHEHLQJUHWDLQDJH % 8SRQ6XEVWDQWLDO&RPSOHWLRQ2ZQHUVKDOOSD\DQDPRXQWVXIILFLHQWWRLQFUHDVHWRWDOSD\PHQWV WR&RQWUDFWRUWRSHUFHQWRIWKH:RUNFRPSOHWHGOHVVVXFKDPRXQWVVHWRIIE\2ZQHU SXUVXDQWWR3DUDJUDSK(RIWKH*HQHUDO&RQGLWLRQVDQGOHVVSHUFHQWRI(QJLQHHU¶V HVWLPDWHRIWKHYDOXHRI:RUNWREHFRPSOHWHGRUFRUUHFWHGDVVKRZQRQWKHSXQFKOLVWRILWHPV WREHFRPSOHWHGRUFRUUHFWHGSULRUWRILQDOSD\PHQW )LQDO3D\PHQW $ 8SRQILQDOFRPSOHWLRQDQGDFFHSWDQFHRIWKH:RUNLQDFFRUGDQFHZLWK3DUDJUDSKRIWKH *HQHUDO&RQGLWLRQV2ZQHUVKDOOSD\WKHUHPDLQGHURIWKH&RQWUDFW3ULFHDVUHFRPPHQGHGE\ (QJLQHHUDVSURYLGHGLQVDLG3DUDJUDSK $57,&/(±,17(5(67 $OODPRXQWVQRWSDLGZKHQGXHVKDOOEHDULQWHUHVWDWWKHUDWHRISHUFHQWSHUDQQXP Page 16 of 899 *$/:$</$1(:(7/$1'5(6725$7,213/$1 $*5((0(17 3$*( $57,&/(±&2175$&725¶65(35(6(17$7,216 ,Q RUGHU WR LQGXFH WKH 2ZQHU WR HQWHU LQWR WKLV &RQWUDFW&RQWUDFWRU PDNHV WKH IROORZLQJ UHSUHVHQWDWLRQV $ &RQWUDFWRUKDVH[DPLQHGDQGFDUHIXOO\VWXGLHGWKH&RQWUDFW'RFXPHQWVDQGDQ\GDWDDQG UHIHUHQFHLGHQWVLGHQWLILHGLQWKH&RQWUDFW'RFXPHQWV % &RQWUDFWRUKDVYLVLWHGWKH6LWHFRQGXFWHGDWKRURXJKDOHUWYLVXDOH[DPLQDWLRQRIWKH6LWHDQG DGMDFHQWDUHDVDQGEHFRPHIDPLOLDUZLWKDQGLVVDWLVILHGDVWRWKHJHQHUDOORFDODQG6LWH FRQGLWLRQVWKDWPD\DIIHFWFRVWSURJUHVVDQGSHUIRUPDQFHRIWKH:RUN & &RQWUDFWRULVIDPLOLDUZLWKDQGLVVDWLVILHGDVWRDOO/DZVDQG5HJXODWLRQVWKDWPD\DIIHFWFRVW SURJUHVVDQGSHUIRUPDQFHRIWKH:RUN ' &RQWUDFWRU KDV FDUHIXOO\ VWXGLHG DOO UHSRUWV RI H[SORUDWLRQV DQG WHVWV RI VXEVXUIDFH FRQGLWLRQVDWRUDGMDFHQWWRWKH6LWHDQGDOOGUDZLQJVRISK\VLFDOFRQGLWLRQVUHODWLQJWRH[LVWLQJ VXUIDFHRUVXEVXUIDFHVWUXFWXUHVDWWKH6LWHWKDWKDYHEHHQLGHQWLILHGLQWKH6XSSOHPHQWDU\ &RQGLWLRQVHVSHFLDOO\ZLWKUHVSHFWWR7HFKQLFDO'DWDLQVXFKUHSRUWVDQGGUDZLQJVDQG UHSRUWVDQGGUDZLQJVUHODWLQJWR+D]DUGRXV(QYLURQPHQWDO&RQGLWLRQVLIDQ\DWRUDGMDFHQW WRWKH6LWHWKDWKDYHEHHQLGHQWLILHGLQWKH6XSSOHPHQWDU\&RQGLWLRQVHVSHFLDOO\ZLWKUHVSHFW WR7HFKQLFDO'DWDLQVXFKUHSRUWVDQGGUDZLQJV ( &RQWUDFWRUKDVFRQVLGHUHGWKHLQIRUPDWLRQNQRZQWR&RQWUDFWRULWVHOILQIRUPDWLRQFRPPRQO\ NQRZQWRFRQWUDFWRUVGRLQJEXVLQHVVLQWKHORFDOLW\RIWKH6LWHLQIRUPDWLRQDQGREVHUYDWLRQV REWDLQHGIURPYLVLWVWRWKH6LWHWKH&RQWUDFW'RFXPHQWVDQGWKH6LWHUHODWHGUHSRUWVDQG GUDZLQJVLGHQWLILHGLQWKH&RQWUDFW'RFXPHQWVZLWKUHVSHFWWRWKHHIIHFWRIVXFKLQIRUPDWLRQ REVHUYDWLRQVDQGGRFXPHQWVRQWKHFRVWSURJUHVVDQGSHUIRUPDQFHRIWKH:RUNWKH PHDQVPHWKRGVWHFKQLTXHVVHTXHQFHVDQGSURFHGXUHVRIFRQVWUXFWLRQWREHHPSOR\HGE\ &RQWUDFWRUDQG&RQWUDFWRU¶VVDIHW\SUHFDXWLRQVDQGSURJUDPV ) %DVHGRQWKHLQIRUPDWLRQDQGREVHUYDWLRQVUHIHUUHGWRLQWKHSUHFHGLQJSDUDJUDSK&RQWUDFWRU DJUHHVWKDWQRIXUWKHUH[DPLQDWLRQVLQYHVWLJDWLRQVH[SORUDWLRQVWHVWVVWXGLHVRUGDWDDUH QHFHVVDU\IRUWKHSHUIRUPDQFHRIWKH:RUNDWWKH&RQWUDFW3ULFHZLWKLQWKH&RQWUDFW7LPHV DQGLQDFFRUGDQFHZLWKWKHRWKHUWHUPVDQGFRQGLWLRQVWKH&RQWUDFW * &RQWUDFWRULVDZDUHRIWKHJHQHUDOQDWXUHRIZRUNWREHSHUIRUPHGE\2ZQHUDQGRWKHUVDWWKH 6LWHWKDWUHODWHVWRWKH:RUNDVLQGLFDWHGLQWKH&RQWUDFW'RFXPHQWV + &RQWUDFWRU KDV JLYHQ (QJLQHHU ZULWWHQ QRWLFH RI DOO FRQIOLFWV HUURUV DPELJXLWLHV RU GLVFUHSDQFLHVWKDW&RQWUDFWRUKDVGLVFRYHUHGLQWKH&RQWUDFW'RFXPHQWVDQGWKHZULWWHQ UHVROXWLRQWKHUHRIE\(QJLQHHULVDFFHSWDEOHWR&RQWUDFWRU , 7KH&RQWUDFW'RFXPHQWVDUHJHQHUDOO\VXIILFLHQWWRLQGLFDWHDQGFRQYH\XQGHUVWDQGLQJRIDOO WHUPVDQGFRQGLWLRQVIRUSHUIRUPDQFHDQGIXUQLVKLQJRIWKH:RUN - &RQWUDFWRU¶V HQWU\ LQWR WKLV &RQWUDFW FRQVWLWXWHV DQ LQFRQWURYHUWLEOH UHSUHVHQWDWLRQ E\ &RQWUDFWRUWKDWZLWKRXWH[FHSWLRQDOOSULFHVLQWKH$JUHHPHQWDUHSUHPLVHGXSRQSHUIRUPLQJ DQGIXUQLVKLQJWKH:RUNUHTXLUHGE\WKH&RQWUDFW'RFXPHQWV . 8QOHVVRWKHUZLVHVSHFLILHGLQWKH&RQWUDFW'RFXPHQWVWKH&RQWUDFWRUVKDOOXSRQUHFHLSWRI WKH H[HFXWHG &RQWUDFW 'RFXPHQWV VXEPLW LQ ZULWLQJ WR WKH 2ZQHUWKHQDPHVRIWKH 6XEFRQWUDFWRUVSURSRVHGIRUWKHZRUN6XEFRQWUDFWRUVPD\QRWEHFKDQJHGH[FHSWDWWKH UHTXHVWRUWKHZLWKWKHFRQVHQWRIWKH2ZQHU / 7KH &RQWUDFW 'RFXPHQWV VKDOO QRW EH FRQVWUXHG DV FUHDWLQJ DQ\ FRQWUDFWXDO UHODWLRQVKLS EHWZHHQWKH2ZQHUDQGDQ\VXEFRQWUDFWRU $57,&/(±&2175$&7'2&80(176 &RQWHQWV $ 7KH&RQWUDFW'RFXPHQWVFRQVLVWRIWKHIROORZLQJ 7KLV$JUHHPHQW 3HUIRUPDQFHERQG Page 17 of 899 *$/:$</$1(:(7/$1'5(6725$7,213/$1 $*5((0(17 3$*( 3D\PHQWERQG 2WKHUERQGV D 0DLQWHQDQFHERQG *HQHUDO&RQGLWLRQV 6XSSOHPHQWDU\&RQGLWLRQV 6SHFLILFDWLRQVDVOLVWHGLQWKHWDEOHRIFRQWHQWVRIWKH3URMHFW0DQXDO 7KH FXUUHQW YHUVLRQ RI &LW\ RI /DNHYLOOH 8WLOLW\ 6WUHHW &RQVWUXFWLRQ 6WDQGDUG 6SHFLILFDWLRQV%RRNQRWDWWDFKHG 'UDZLQJVQRWDWWDFKHGEXWLQFRUSRUDWHGE\UHIHUHQFHFRQVLVWLQJRIVKHHWVZLWKHDFK VKHHWEHDULQJWKHIROORZLQJJHQHUDOWLWOH*DOZD\/DQH:HWODQG5HVWRUDWLRQ3ODQ GDWHG $GGHQGD ([KLELWVWRWKLV$JUHHPHQWHQXPHUDWHGDVIROORZV D &RQWUDFWRU¶V4XRWH E 1RQ&ROOXVLRQ$IILGDYLW F 5HVSRQVLEOH&RQWUDFWRU9HULILFDWLRQDQG&HUWLILFDWLRQ)RUP 7KHIROORZLQJZKLFKPD\EHGHOLYHUHGRULVVXHGRQRUDIWHUWKH(IIHFWLYH'DWHRIWKH &RQWUDFWDQGDUHQRWDWWDFKHGKHUHWR D 1RWLFHWR3URFHHG E :RUN&KDQJH'LUHFWLYHV F &KDQJH2UGHUV G )LHOG2UGHUV % 7KH GRFXPHQWV OLVWHG LQ 3DUDJUDSK $ DUH DWWDFKHG WR WKLV $JUHHPHQW H[FHSW DV H[SUHVVO\QRWHGRWKHUZLVHDERYH & 7KHUHDUHQR&RQWUDFW'RFXPHQWVRWKHUWKDQWKRVHOLVWHGDERYHLQWKLV$UWLFOH ' 7KH&RQWUDFW'RFXPHQWVPD\RQO\EHDPHQGHGPRGLILHGRUVXSSOHPHQWHGDVSURYLGHGLQ WKH*HQHUDO&RQGLWLRQV $57,&/(±0,6&(//$1(286 7HUPV $ 7HUPVXVHGLQWKLV$JUHHPHQWZLOOKDYHWKHPHDQLQJVVWDWHGLQWKH*HQHUDO&RQGLWLRQVDQG WKH6XSSOHPHQWDU\&RQGLWLRQV $VVLJQPHQWRI&RQWUDFW $ 8QOHVVH[SUHVVO\DJUHHGWRHOVHZKHUHLQWKH&RQWUDFWQRDVVLJQPHQWE\DSDUW\KHUHWRRIDQ\ ULJKWVXQGHURULQWHUHVWVLQWKH&RQWUDFWZLOOEHELQGLQJRQDQRWKHUSDUW\KHUHWRZLWKRXWWKH ZULWWHQFRQVHQWRIWKHSDUW\VRXJKWWREHERXQGDQGVSHFLILFDOO\EXWZLWKRXWOLPLWDWLRQPRQH\ WKDWPD\EHFRPHGXHDQGPRQH\WKDWLVGXHPD\QRWEHDVVLJQHGZLWKRXWVXFKFRQVHQW H[FHSWWRWKHH[WHQWWKDWWKHHIIHFWRIWKLVUHVWULFWLRQPD\EHOLPLWHGE\ODZDQGXQOHVV VSHFLILFDOO\VWDWHGWRWKHFRQWUDU\LQDQ\ZULWWHQFRQVHQWWRDQDVVLJQPHQWQRDVVLJQPHQWZLOO UHOHDVH RU GLVFKDUJH WKH DVVLJQRU IURP DQ\ GXW\ RU UHVSRQVLELOLW\ XQGHU WKH &RQWUDFW 'RFXPHQWV 6XFFHVVRUVDQG$VVLJQV $ 2ZQHUDQG&RQWUDFWRUHDFKELQGVLWVHOILWVVXFFHVVRUVDVVLJQVDQGOHJDOUHSUHVHQWDWLYHVWR WKHRWKHUSDUW\KHUHWRLWVVXFFHVVRUVDVVLJQVDQGOHJDOUHSUHVHQWDWLYHVLQUHVSHFWWRDOO FRYHQDQWVDJUHHPHQWVDQGREOLJDWLRQVFRQWDLQHGLQWKH&RQWUDFW'RFXPHQWV Page 18 of 899 *$/:$</$1(:(7/$1'5(6725$7,213/$1 $*5((0(17 3$*( 6HYHUDELOLW\ $ $Q\SURYLVLRQRUSDUWRIWKH&RQWUDFW'RFXPHQWVKHOGWREHYRLGRUXQHQIRUFHDEOHXQGHUDQ\ /DZRU5HJXODWLRQVKDOOEHGHHPHGVWULFNHQDQGDOOUHPDLQLQJSURYLVLRQVVKDOOFRQWLQXHWREH YDOLGDQGELQGLQJXSRQ2ZQHUDQG&RQWUDFWRUZKRDJUHHWKDWWKH&RQWUDFW'RFXPHQWVVKDOO EHUHIRUPHGWRUHSODFHVXFKVWULFNHQSURYLVLRQRUSDUWWKHUHRIZLWKDYDOLGDQGHQIRUFHDEOH SURYLVLRQWKDWFRPHVDVFORVHDVSRVVLEOHWRH[SUHVVLQJWKHLQWHQWLRQRIWKHVWULFNHQSURYLVLRQ &RQWUDFWRU¶V&HUWLILFDWLRQV $ 7KH SURYLVLRQV RI 0,11 67$7 & 5HVSRQVLEOH &RQWUDFWRU DUH LPSRVHG DV D UHTXLUHPHQWRIWKLV&RQWUDFW7KLV&RQWUDFWPD\EHWHUPLQDWHGE\WKH2ZQHUDWDQ\WLPHXSRQ GLVFRYHU\E\WKH2ZQHUWKDWWKHSULPHFRQWUDFWRURUVXEFRQWUDFWRUKDVVXEPLWWHGDIDOVH VWDWHPHQWXQGHURDWKYHULI\LQJFRPSOLDQFHZLWKDQ\RIWKHPLQLPXPFULWHULDVHWIRUWKLQWKH 6WDWXWH % 7KHSURYLVLRQVRI0,1167$7VXEGLYLVLRQDDUHLPSRVHGDVDUHTXLUHPHQWRIWKLV &RQWUDFW (DFK FRQWUDFW RI D PXQLFLSDOLW\ PXVW UHTXLUH WKH SULPH FRQWUDFWRU WR SD\ DQ\ VXEFRQWUDFWRU ZLWKLQ WHQ GD\V RI WKH SULPH FRQWUDFWRU¶V UHFHLSW RI SD\PHQW IURP WKH PXQLFLSDOLW\IRUXQGLVSXWHGVHUYLFHVSURYLGHGE\WKHVXEFRQWUDFWRU7KHFRQWUDFWPXVW UHTXLUHWKHSULPHFRQWUDFWRUWRSD\LQWHUHVWRISHUFHQWSHUPRQWKRUDQ\SDUWRID PRQWK WR WKH VXEFRQWUDFWRU RQ DQ\ XQGLVSXWHG DPRXQW QRW SDLG RQ WLPH WR WKH VXEFRQWUDFWRU7KHPLQLPXPPRQWKO\LQWHUHVWSHQDOW\SD\PHQWIRUDQXQSDLGEDODQFHRI RUPRUHLV)RUDQXQSDLGEDODQFHRIOHVVWKDQWKHSULPHFRQWUDFWRUVKDOO SD\WKHDFWXDOSHQDOW\GXHWRWKHVXEFRQWUDFWRU$6XEFRQWUDFWRUZKRSUHYDLOVLQDFLYLO DFWLRQWRFROOHFWLQWHUHVWSHQDOWLHVIURPDSULPHFRQWUDFWRUPXVWEHDZDUGHGLWVFRVWVDQG GLVEXUVHPHQWVLQFOXGLQJDWWRUQH\¶VIHHVLQFXUUHGLQEULQJLQJWKHDFWLRQ /ŶĚĞŵŶŝƚǇ ͘ dŚĞŽŶƚƌĂĐƚŽƌĂŐƌĞĞƐƚŽŝŶĚĞŵŶŝĨǇĂŶĚŚŽůĚƚŚĞŝƚǇŚĂƌŵůĞƐƐĨƌŽŵĂŶǇĐůĂŝŵŵĂĚĞďǇ ƚŚŝƌĚƉĂƌƚŝĞƐĂƐĂƌĞƐƵůƚŽĨƚŚĞƐĞƌǀŝĐĞƐƉĞƌĨŽƌŵĞĚďǇŝƚ͘/ŶĂĚĚŝƚŝŽŶ͕ƚŚĞŽŶƚƌĂĐƚŽƌƐŚĂůů ƌĞŝŵďƵƌƐĞƚŚĞŝƚǇĨŽƌĂŶǇĐŽƐƚŽĨƌĞĂƐŽŶĂďůĞĂƚƚŽƌŶĞǇ͛ƐĨĞĞƐŝƚŵĂǇŝŶĐƵƌĂƐĂƌĞƐƵůƚŽĨĂŶǇ ƐƵĐŚĐůĂŝŵƐ͘ KƚŚĞƌWƌŽǀŝƐŝŽŶƐ $KǁŶĞƌƐƚŝƉƵůĂƚĞƐƚŚĂƚŝĨƚŚĞ'ĞŶĞƌĂůŽŶĚŝƚŝŽŶƐƚŚĂƚĂƌĞŵĂĚĞĂƉĂƌƚŽĨƚŚŝƐŽŶƚƌĂĐƚĂƌĞ ďĂƐĞĚ ŽŶ :Π ͲϳϬϬ͕ ^ƚĂŶĚĂƌĚ 'ĞŶĞƌĂů ŽŶĚŝƚŝŽŶƐ ĨŽƌ ƚŚĞ ŽŶƐƚƌƵĐƚŝŽŶ ŽŶƚƌĂĐƚ͕ ƉƵďůŝƐŚĞĚďǇƚŚĞŶŐŝŶĞĞƌƐ:ŽŝŶƚŽŶƚƌĂĐƚŽĐƵŵĞŶƚƐŽŵŵŝƚƚĞĞΠ͕ĂŶĚŝĨKǁŶĞƌŝƐƚŚĞƉĂƌƚǇ ƚŚĂƚŚĂƐĨƵƌŶŝƐŚĞĚƐĂŝĚ'ĞŶĞƌĂůŽŶĚŝƚŝŽŶƐ͕ƚŚĞŶKǁŶĞƌŚĂƐƉůĂŝŶůǇƐŚŽǁŶĂůůŵŽĚŝĨŝĐĂƚŝŽŶƐ ƚŽƚŚĞƐƚĂŶĚĂƌĚǁŽƌĚŝŶŐŽĨƐƵĐŚƉƵďůŝƐŚĞĚĚŽĐƵŵĞŶƚƚŽƚŚĞŽŶƚƌĂĐƚŽƌ͕ƚŚƌŽƵŐŚĂƉƌŽĐĞƐƐ ƐƵĐŚ ĂƐ ŚŝŐŚůŝŐŚƚŝŶŐ Žƌ ͞ƚƌĂĐŬ ĐŚĂŶŐĞƐ͟ ;ƌĞĚůŝŶĞͬƐƚƌŝŬĞŽƵƚͿ͕ Žƌ ŝŶ ƚŚĞ ^ƵƉƉůĞŵĞŶƚĂƌǇ ŽŶĚŝƚŝŽŶƐ͘ %ŶǇƉƌŽǀŝƐŝŽŶŽƌƉĂƌƚŽĨƚŚĞŽŶƚƌĂĐƚŽĐƵŵĞŶƚƐŚĞůĚƚŽďĞǀŽŝĚŽƌƵŶĞŶĨŽƌĐĞĂďůĞƵŶĚĞƌĂŶǇ ůĂǁŽƌƌĞŐƵůĂƚŝŽŶƐŚĂůůďĞĚĞĞŵĞĚƐƚƌŝĐŬĞŶ͕ĂŶĚĂůůƌĞŵĂŝŶŝŶŐƉƌŽǀŝƐŝŽŶƐƐŚĂůůĐŽŶƚŝŶƵĞƚŽďĞ ǀĂůŝĚĂŶĚďŝŶĚŝŶŐƵƉŽŶKǁŶĞƌĂŶĚŽŶƚƌĂĐƚŽƌ͕ǁŚŽĂŐƌĞĞƚŚĂƚƚŚĞŽŶƚƌĂĐƚŽĐƵŵĞŶƚƐƐŚĂůů ďĞƌĞĨŽƌŵĞĚƚŽƌĞƉůĂĐĞƐƵĐŚƐƚƌŝĐŬĞŶƉƌŽǀŝƐŝŽŶŽƌƉĂƌƚƚŚĞƌĞŽĨǁŝƚŚĂǀĂůŝĚĂŶĚĞŶĨŽƌĐĞĂďůĞ ƉƌŽǀŝƐŝŽŶ ƚŚĂƚ ĐŽŵĞƐ ĂƐ ĐůŽƐĞ ĂƐ ƉŽƐƐŝďůĞ ƚŽ ĞǆƉƌĞƐƐŝŶŐ ƚŚĞ ŝŶƚĞŶƚŝŽŶ ŽĨ ƚŚĞ ƐƚƌŝĐŬĞŶ ƉƌŽǀŝƐŝŽŶƐ͘ ^ŽĨƚǁĂƌĞ>ŝĐĞŶƐĞ͘ $/ĨƚŚĞĞƋƵŝƉŵĞŶƚƉƌŽǀŝĚĞĚďǇƚŚĞŽŶƚƌĂĐƚŽƌƉƵƌƐƵĂŶƚƚŽƚŚŝƐŽŶƚƌĂĐƚĐŽŶƚĂŝŶƐƐŽĨƚǁĂƌĞ͕ ŝŶĐůƵĚŝŶŐƚŚĂƚǁŚŝĐŚƚŚĞŵĂŶƵĨĂĐƚƵƌĞƌŵĂǇŚĂǀĞĞŵďĞĚĚĞĚŝŶƚŽƚŚĞŚĂƌĚǁĂƌĞĂƐĂŶŝŶƚĞŐƌĂů ƉĂƌƚŽĨƚŚĞĞƋƵŝƉŵĞŶƚ͕ƚŚĞŽŶƚƌĂĐƚŽƌƐŚĂůůƉĂǇĂůůƐŽĨƚǁĂƌĞůŝĐĞŶƐŝŶŐĨĞĞƐ͘dŚĞŽŶƚƌĂĐƚŽƌ ƐŚĂůůĂůƐŽƉĂǇĨŽƌĂůůƐŽĨƚǁĂƌĞƵƉĚĂƚŝŶŐĨĞĞƐĨŽƌĂƉĞƌŝŽĚŽĨŽŶĞǇĞĂƌĨŽůůŽǁŝŶŐĐƵƚŽǀĞƌ͘dŚĞ ŽŶƚƌĂĐƚŽƌƐŚĂůůŚĂǀĞŶŽŽďůŝŐĂƚŝŽŶƚŽƉĂǇĨŽƌƐƵĐŚĨĞĞƐƚŚĞƌĞĂĨƚĞƌ͘EŽƚŚŝŶŐŝŶƚŚĞƐŽĨƚǁĂƌĞ Page 19 of 899 *$/:$</$1(:(7/$1'5(6725$7,213/$1 $*5((0(17 3$*( ůŝĐĞŶƐĞŽƌůŝĐĞŶƐŝŶŐĂŐƌĞĞŵĞŶƚƐŚĂůůŽďůŝŐĂƚĞƚŚĞŝƚǇƚŽƉĂǇĂŶǇĂĚĚŝƚŝŽŶĂůĨĞĞƐĂƐĂĐŽŶĚŝƚŝŽŶ ĨŽƌĐŽŶƚŝŶƵŝŶŐƚŽƵƐĞƚŚĞƐŽĨƚǁĂƌĞ͘ WĂƚĞŶƚĞĚĚĞǀŝĐĞƐ͕ŵĂƚĞƌŝĂůƐĂŶĚƉƌŽĐĞƐƐĞƐ͘ $/ĨƚŚĞŽŶƚƌĂĐƚƌĞƋƵŝƌĞƐ͕ŽƌƚŚĞŽŶƚƌĂĐƚŽƌĚĞƐŝƌĞƐ͕ƚŚĞƵƐĞŽĨĂŶǇĚĞƐŝŐŶ͕ĚĞǀŝĐĞ͕ŵĂƚĞƌŝĂůŽƌ ƉƌŽĐĞƐƐĐŽǀĞƌĞĚďǇůĞƚƚĞƌƐ͕ƉĂƚĞŶƚŽƌĐŽƉǇƌŝŐŚƚ͕ƚƌĂĚĞŵĂƌŬŽƌƚƌĂĚĞŶĂŵĞ͕ƚŚĞŽŶƚƌĂĐƚŽƌ ƐŚĂůůƉƌŽǀŝĚĞĨŽƌƐƵĐŚƵƐĞďǇƐƵŝƚĂďůĞůĞŐĂůĂŐƌĞĞŵĞŶƚǁŝƚŚƚŚĞƉĂƚĞŶƚĞĞŽƌŽǁŶĞƌĂŶĚĂĐŽƉǇ ŽĨƐĂŝĚĂŐƌĞĞŵĞŶƚƐŚĂůůďĞĨŝůĞĚǁŝƚŚƚŚĞKǁŶĞƌ͘/ĨŶŽƐƵĐŚĂŐƌĞĞŵĞŶƚŝƐŵĂĚĞŽƌĨŝůĞĚĂƐ ŶŽƚĞĚ͕ƚŚĞŽŶƚƌĂĐƚŽƌƐŚĂůůŝŶĚĞŵŶŝĨǇĂŶĚŚŽůĚŚĂƌŵůĞƐƐƚŚĞKǁŶĞƌĨƌŽŵĂŶǇĂŶĚĂůůĐůĂŝŵƐ ĨŽƌŝŶĨƌŝŶŐĞŵĞŶƚďǇƌĞĂƐŽŶŽĨƚŚĞƵƐĞŽĨĂŶǇƐƵĐŚƉĂƚĞŶƚĞĚĚĞƐŝŐŶĞĚ͕ĚĞǀŝĐĞ͕ŵĂƚĞƌŝĂůŽƌ ƉƌŽĐĞƐƐ͕ŽƌĂŶǇƚƌĂĚĞŵĂƌŬŽƌƚƌĂĚĞŶĂŵĞŽƌĐŽƉǇƌŝŐŚƚŝŶĐŽŶŶĞĐƚŝŽŶǁŝƚŚƚŚĞWƌŽũĞĐƚĂŐƌĞĞĚ ƚŽďĞƉĞƌĨŽƌŵĞĚƵŶĚĞƌƚŚĞŽŶƚƌĂĐƚ͕ĂŶĚƐŚĂůůŝŶĚĞŵŶŝĨǇĂŶĚĚĞĨĞŶĚƚŚĞKǁŶĞƌĨŽƌĂŶǇĐŽƐƚƐ͕ ůŝĂďŝůŝƚǇ͕ĞǆƉĞŶƐĞƐĂŶĚĂƚƚŽƌŶĞǇΖƐĨĞĞƐƚŚĂƚƌĞƐƵůƚĨƌŽŵĂŶǇƐƵĐŚŝŶĨƌŝŶŐĞŵĞŶƚ͘ ƐƐŝŐŶŵĞŶƚ͘ $EĞŝƚŚĞƌƉĂƌƚǇŵĂǇĂƐƐŝŐŶ͕ƐƵďůĞƚ͕ŽƌƚƌĂŶƐĨĞƌĂŶǇŝŶƚĞƌĞƐƚŽƌŽďůŝŐĂƚŝŽŶŝŶƚŚŝƐŽŶƚƌĂĐƚ ǁŝƚŚŽƵƚƚŚĞƉƌŝŽƌǁƌŝƚƚĞŶĐŽŶƐĞŶƚŽĨƚŚĞŽƚŚĞƌƉĂƌƚǇ͕ĂŶĚƚŚĞŶŽŶůǇƵƉŽŶƐƵĐŚƚĞƌŵƐĂŶĚ ĐŽŶĚŝƚŝŽŶƐĂƐďŽƚŚƉĂƌƚŝĞƐŵĂǇĂŐƌĞĞƚŽĂŶĚƐĞƚĨŽƌƚŚŝŶǁƌŝƚŝŶŐ͘ WĞƌŵŝƚƐĂŶĚ>ŝĐĞŶƐĞƐ͖ZŝŐŚƚƐͲŽĨͲtĂǇĂŶĚĂƐĞŵĞŶƚƐ͘ $dŚĞ ŽŶƚƌĂĐƚŽƌ ƐŚĂůů ŐŝǀĞ Ăůů ŶŽƚŝĐĞƐ ŶĞĐĞƐƐĂƌǇ ĂŶĚ ŝŶĐŝĚĞŶƚĂůƚŽƚŚĞĐŽŶƐƚƌƵĐƚŝŽŶĂŶĚ ĐŽŵƉůĞƚŝŽŶ ŽĨ ƚŚĞ WƌŽũĞĐƚ͘ dŚĞŝƚǇ ǁŝůů ŽďƚĂŝŶ Ăůů ŶĞĐĞƐƐĂƌǇƌŝŐŚƚƐͲŽĨͲǁĂǇ ĂŶĚ ĞĂƐĞŵĞŶƚƐ͘dŚĞŽŶƚƌĂĐƚŽƌƐŚĂůůŶŽƚďĞĞŶƚŝƚůĞĚƚŽĂŶǇĂĚĚŝƚŝŽŶĂůĐŽŵƉĞŶƐĂƚŝŽŶĨŽƌĂŶǇ ĐŽŶƐƚƌƵĐƚŝŽŶĚĞůĂǇƌĞƐƵůƚŝŶŐĨƌŽŵƚŚĞŝƚǇ͛ƐŶŽƚƚŝŵĞůǇŽďƚĂŝŶŝŶŐƌŝŐŚƚƐͲŽĨͲǁĂǇŽƌĞĂƐĞŵĞŶƚƐ͘ Page 20 of 899 *$/:$</$1(:(7/$1'5(6725$7,213/$1 $*5((0(17 3$*( /Et/dE^^t,ZK&͕KǁŶĞƌĂŶĚŽŶƚƌĂĐƚŽƌŚĂǀĞƐŝŐŶĞĚƚŚŝƐŐƌĞĞŵĞŶƚ͘ 7KLV$JUHHPHQWZLOOEHHIIHFWLYHRQBBBBBBBBBBBBBBBBBBZKLFKLVWKH(IIHFWLYH'DWHRIWKH&RQWUDFW 2:1(5 &2175$&725 %\ %\ 7LWOH 7LWOH ,I&RQWUDFWRULVDFRUSRUDWLRQDSDUWQHUVKLSRUD MRLQWYHQWXUHDWWDFKHYLGHQFHRIDXWKRULW\WR VLJQ $WWHVW $WWHVW 7LWOH 7LWOH $GGUHVVIRUJLYLQJQRWLFHV $GGUHVVIRUJLYLQJQRWLFHV /LFHQVH1R ZKHUHDSSOLFDEOH ,I2ZQHULVDFRUSRUDWLRQDWWDFKHYLGHQFHRI DXWKRULW\WRVLJQ,I2ZQHULVDSXEOLFERG\DWWDFK HYLGHQFHRIDXWKRULW\WRVLJQDQGUHVROXWLRQRU RWKHUGRFXPHQWVDXWKRUL]LQJH[HFXWLRQRIWKLV $JUHHPHQW Page 21 of 899 kimley-horn.com 14800 Galaxie Avenue, Suite 200, Apple Valley, MN 55124 952 905 2887 September 23, 2025 Mr. Mac Cafferty Environmental Resources Manager City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Re: Summary of Quotes Lakeville Wetland Restoration Project Dear Mr. Cafferty: By 3:00 p.m. on Friday, September 19th, quotes were received for two alternatives, labeled Schedule A and Schedule B, and opened for the above-referenced project. Quotes were received from three (3) contractors with the bid amounts as follows: Contractor Schedule A Bid Sunram Construction, Inc. $127,665.00 MNL Corp. $122,049.00 Resources Environmental Solutions LLC $157,265.00 Contractor Schedule B Bid Sunram Construction, Inc. $105,152.00 MNL Corp. $108,883.75 Resources Environmental Solutions LLC $157,263.80 *All bid amounts shown on this letter and the attached bid tabulation are the corrected bid amounts. Minor errors were found in 1 of the 6 bids that did not affect the bidding order. After tabulating quotes, Sunram Construction, Inc. is the apparent low bidder with a quote of $105,152.00 for the bid alternative associated with Schedule B. Kimley- Horn recommends that the contract be awarded to Sunram Construction, Inc., constructing the project via Schedule B’s design, for $105,152.00. Page 22 of 899 Owner:City of Lakeville Project:Lakeville Wetland Restoration Plan Schedule:A Description:Lakeville Wetland Restoration Item No.Mn/DOT No.Item Description Unit Contract Quantity Unit Price Amount Unit Price Amount Unit Price Amount Unit Price Amount 1 2021.501 MOBILIZATION LUMP SUM 1 8,000.00$ 8,000.00$ 13,920.00$ 13,920.00$ 10,000.00$ 10,000.00$ 16,625.00$ 16,625.00$ 2 2106.507 EXCAVATION - COMMON CU YD 1412 20.00$ 28,240.00$ 41.25$ 58,245.00$ 44.00$ 62,128.00$ 32.00$ 45,184.00$ 3 2123.610 STREET SWEEPER (WITH PICKUP BROOM) HOUR 10 175.00$ 1,750.00$ 125.00$ 1,250.00$ 299.00$ 2,990.00$ 260.00$ 2,600.00$ 4 2564.602 INSTALL SIGN EACH 18 200.00$ 3,600.00$ 75.00$ 1,350.00$ 229.00$ 4,122.00$ 70.00$ 1,260.00$ 5 2573.501 STABILIZED CONSTRUCTION EXIT LUMP SUM 1 1,000.00$ 1,000.00$ 1,700.00$ 1,700.00$ 11,200.00$ 11,200.00$ 4,175.00$ 4,175.00$ 6 2573.501 EROSION CONTROL SUPERVISOR LUMP SUM 1 1,000.00$ 1,000.00$ 1,900.00$ 1,900.00$ 2,389.00$ 2,389.00$ 5,220.00$ 5,220.00$ 7 2573.503 SILT FENCE; TYPE MS LIN FT 6100 2.50$ 15,250.00$ 2.25$ 13,725.00$ 2.90$ 17,690.00$ 2.50$ 15,250.00$ 8 2573.503 SEDIMENT CONTROL LOG TYPE WOOD FIBER LIN FT 1400 5.00$ 7,000.00$ 4.25$ 5,950.00$ 5.95$ 8,330.00$ 3.30$ 4,620.00$ 9 2575.505 SEEDING ACRE 13 300.00$ 3,900.00$ 525.00$ 6,825.00$ 232.00$ 3,016.00$ 265.00$ 3,445.00$ 10 2575.505 MOWING ACRE 20 200.00$ 4,000.00$ 132.00$ 2,640.00$ 146.00$ 2,920.00$ 265.00$ 5,300.00$ 11 2575.505 WEED SPRAYING ACRE 30 75.00$ 2,250.00$ 190.00$ 5,700.00$ 210.00$ 6,300.00$ 125.00$ 3,750.00$ 12 2575.509 MULCH MATERIAL TYPE 3 TON 20 330.00$ 6,600.00$ 475.00$ 9,500.00$ 824.00$ 16,480.00$ 485.00$ 9,700.00$ 13 2575.605 LAKEVILLE NATIVE BUFFER MIX ACRE 8 475.00$ 3,800.00$ 535.00$ 4,280.00$ 826.00$ 6,608.00$ 540.00$ 4,320.00$ 14 2575.605 MODIFIED LAKEVILLE NATIVE BUFFER MIX ACRE 2 475.00$ 950.00$ 340.00$ 680.00$ 1,546.00$ 3,092.00$ 300.00$ 600.00$ Schedule A Total:87,340.00$ 127,665.00$ 157,265.00$ 122,049.00$ MNLSUNRAM RESENGINEER'S ESTIMATE Page 23 of 899 Owner:City of Lakeville Project:Lakeville Wetland Restoration Plan MNLSUNRAM RESENGINEER'S ESTIMATE Schedule:B Description:Lakeville Wetland Restoration - Bid Alt 1 Item No.Mn/DOT No.Item Description Unit Contract Quantity Unit Price Amount Unit Price Amount Unit Price Amount Unit Price Amount 1 2021.501 MOBILIZATION LUMP SUM 1 8,000.00$ 8,000.00$ 10,225.25$ 10,225.25$ 10,000.00$ 10,000.00$ 16,625.00$ 16,625.00$ 2 2106.507 EXCAVATION - COMMON CU YD 1412 20.00$ 28,240.00$ 11.25$ 15,885.00$ 36.90$ 52,102.80$ 18.10$ 25,557.20$ 3 2106.507 COMMON EMBANKMENT (CV) CU YD 969 20.00$ 19,380.00$ 23.25$ 22,529.25$ 9.00$ 8,721.00$ 4.95$ 4,796.55$ 4 2123.610 STREET SWEEPER (WITH PICKUP BROOM) HOUR 10 175.00$ 1,750.00$ 125.00$ 1,250.00$ 299.00$ 2,990.00$ 260.00$ 2,600.00$ 5 2564.602 INSTALL SIGN EACH 18 200.00$ 3,600.00$ 75.00$ 1,350.00$ 229.00$ 4,122.00$ 70.00$ 1,260.00$ 6 2573.501 STABILIZED CONSTRUCTION EXIT LUMP SUM 1 1,000.00$ 1,000.00$ 1,700.00$ 1,700.00$ 11,200.00$ 11,200.00$ 4,715.00$ 4,715.00$ 7 2573.501 EROSION CONTROL SUPERVISOR LUMP SUM 1 1,000.00$ 1,000.00$ 1,900.00$ 1,900.00$ 2,389.00$ 2,389.00$ 5,220.00$ 5,220.00$ 8 2573.503 SILT FENCE; TYPE MS LIN FT 6550 2.50$ 16,375.00$ 2.25$ 14,737.50$ 2.90$ 18,995.00$ 2.50$ 16,375.00$ 9 2573.503 SEDIMENT CONTROL LOG TYPE WOOD FIBER LIN FT 1400 5.00$ 7,000.00$ 4.25$ 5,950.00$ 5.95$ 8,330.00$ 3.30$ 4,620.00$ 10 2575.505 SEEDING ACRE 13 300.00$ 3,900.00$ 525.00$ 6,825.00$ 232.00$ 3,016.00$ 265.00$ 3,445.00$ 11 2575.505 MOWING ACRE 20 200.00$ 4,000.00$ 132.00$ 2,640.00$ 146.00$ 2,920.00$ 265.00$ 5,300.00$ 12 2575.505 WEED SPRAYING ACRE 30 75.00$ 2,250.00$ 190.00$ 5,700.00$ 210.00$ 6,300.00$ 125.00$ 3,750.00$ 13 2575.509 MULCH MATERIAL TYPE 3 TON 20 330.00$ 6,600.00$ 475.00$ 9,500.00$ 824.00$ 16,480.00$ 485.00$ 9,700.00$ 14 2575.605 LAKEVILLE NATIVE BUFFER MIX ACRE 8 475.00$ 3,800.00$ 535.00$ 4,280.00$ 826.00$ 6,608.00$ 540.00$ 4,320.00$ 15 2575.605 MODIFIED LAKEVILLE NATIVE BUFFER MIX ACRE 2 475.00$ 950.00$ 340.00$ 680.00$ 1,545.00$ 3,090.00$ 300.00$ 600.00$ Schedule B Total:107,845.00$ 105,152.00$ 157,263.80$ 108,883.75$ Page 24 of 899 Page 1 kimley-horn.com 14800 Galaxie Ave, Suite 200, Apple Valley, MN 952-905-2887 August 22, 2025 Mr. Mac Cafferty Environmental Resources Manager City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 RE: Lakeville Wetland Restoration Dear Mr. Cafferty: Kimley-Horn and Associates, Inc. (Kimley-Horn) is pleased to submit this Amendment to the City of Lakeville (City) for construction phase services for the Lakeville Wetland Restoration project. Our project understanding, proposed scope of services, schedule, and fee are detailed below. PROJECT UNDERSTANDING The existing project site, owned by the City of Lakeville, is a 14-acre existing wetland area. The proposed project consists of minor site grading, tilling/seeding of existing and proposed graded areas, and site control to facilitate the growth of a Type II wetland area. The area contains a DNR trout stream on the southern boundary of the project that is to be protected from all construction activity. Our detailed scope of work based on our understanding of the project is provided below. SCOPE OF WORK Task 6: Contract Documents & Bidding Assistance Task 6.1 – Contract Documents We will prepare a project manual containing contract documents for construction. It is assumed that the contract documents will follow previous City of Lakeville project manuals and contain the following: - Agreement Between Owner and Contractor - General Conditions - Supplementary Conditions - Special Provisions as necessary - Plan Drawings and Seeding Details - Contractor’s Quote, Non-Collusion Affidavit, Responsible Contractor Verification and Certification Form. It is assumed that Kimley-Horn will apply for an NPDES permit on behalf of the City and County, to be transferred to the selected contractor, with the NPDES permit fee paid for by the City. Page 25 of 899 Page 2 kimley-horn.com 14800 Galaxie Ave, Suite 200, Apple Valley, MN 952-905-2887 Task 6.2 – Bidding Assistance We will prepare a quote document for the project and provide the bid package to at least three Contractors (contacts to be provided by the City of Lakeville). During the bidding period, we will be available to answer requests for information regarding the project. We will lead an on-site, pre-quote meeting at the site area to present the project, its objectives, and key areas to be aware of throughout the project. Kimley-Horn will provide a written summary of the meeting alongside responses to Contractor questions. We will review quotes to submitted to the City for the project and provide a tabulation and recommendation to the City following the end of bidding Following award of contract and selection of contractor, we will coordinate with the contractor to prepare for construction to include coordination of the construction schedule, as well as an onsite pre- construction meeting. Task 7. Construction Phase Services Task 7.1 – Construction Coordination and Monthly Pay Applications We will provide construction coordination assistance to City staff and our on-site construction observer. We have assumed this task will include assisting our on-site observer with design questions, coordinating with City and Contractor staff on any RFIs or project items, and assisting with monthly pay applications. We have assumed approximately two (2) hours of effort per week for the assumed six (6) weeks of construction activity will be necessary for construction coordination. We have assumed up to two (2) monthly/final payment applications will be prepared to reach closeout of the project. Task 7.2 – Construction Observation We will provide one construction observer for the duration of the construction project in 2025. We have assumed the project will span a six (6) week construction schedule through the 2025 construction year. The construction observer duties will consist of the following tasks: • Provide construction observation on all grading and seeding improvements • Daily reports • Photographs before, during, and after construction • Construction observation for evaluation that construction is in conformance with the Plans and City standards/specifications • Regular coordination with the project contractor and City staff • Coordination with Kimley-Horn’s design engineer on any design related inquiries Page 26 of 899 Page 3 kimley-horn.com 14800 Galaxie Ave, Suite 200, Apple Valley, MN 952-905-2887 We estimate on-site observation will be necessary up to six (6) hours per week on average from a construction observer for up to six (6) weeks of construction activity. However, we do anticipate the on-site observation time will vary week to week and over the duration of the project based on the scope of work being completed on-site during that week. All construction observation time will be logged in the daily reports for documentation and coordination with City staff. Kimley-Horn shall have no responsibility for any of the construction contractor’s means, methods, and techniques, equipment choice and usage, sequence, schedule, safety programs, or safety practices, nor shall Kimley-Horn have any authority or responsibility to stop or direct the construction work. Kimley-Horn’s visits to the project site will be for the purpose of endeavoring to provide the City a greater degree of confidence that the completed work will generally conform to the construction documents. Kimley-Horn neither guarantees the performance of the construction contractor, nor assumes responsibility for the construction contractor’s failure to perform its work in accordance with the contract documents. The construction contractor is solely responsible for constructing the project in conformity to the designs and specifications. Any design related issues or questions that arise during construction by the Contractor will be answered by the City. Kimley-Horn’s services are limited to the construction observation scope and limitations listed above, and all design items are to be addressed by the City. Task 7.3 – Preparation of Change Orders and Construction Closeout Documents Upon request by City staff, Kimley-Horn will prepare necessary change orders for the project. We have assumed the preparation of up to one (1) change order may be necessary. We will assist the City with construction closeout documentation. Task 7.4 – Construction Staking EFN Inc., as a Kimley-Horn subconsultant, will perform construction staking and as-built survey for the project improvements per section 10 of the City of Lakeville Utility & Street Construction Standard Specifications. Construction staking staff will work in close coordination with the construction observer and contractor to allow for proper notification of when staking is needed. As-built survey points will be provided to the City of Lakeville following completion of construction. SCHEDULE A project schedule is provided below. Quotes received from Contractors September 4, 2025 Contract Award from City Council September 15, 2025 Begin Construction September 2025 Substantial Completion December 2025 Final Completion June 2026 Page 27 of 899 Page 4 kimley-horn.com 14800 Galaxie Ave, Suite 200, Apple Valley, MN 952-905-2887 ESTIMATED COSTS Kimley-Horn will provide the scope of services identified above on an hourly basis. A detailed breakdown of hours and costs per task is provided as Attachment 2. Our total estimated cost for the Scope of Services is summarized in the table below. Task 6 – Contract Documents & Bidding Assistance $9,900 Task 7 – Construction Phase Services $18,500 Subtotal $28,400 Reimbursable Expenses $700 NPDES Permit Fee $400 Total $29,500 We propose to complete the services detailed in this proposal in accordance with Kimley-Horn’s Master Services Agreement with the City of Lakeville, dated September 20, 2021, on an hourly basis with a not-to-exceed cost of $29,500 including all labor and reimbursable expenses. Labor fee will be billed according to our current standard hourly rate schedule. Fees and times stated in this Proposal are valid for 120 days after the date of this letter. We appreciate the opportunity to submit this proposal and look forward to working with you on this project. Please feel free to contact me if you have any questions. Sincerely, KIMLEY-HORN AND ASSOCIATES, INC. Mike Kinning, P.E. Eric Fosmo, P.E. Project Manager Senior Associate / Authorized Signer Accepted by: Date: Accepted by: Date: Page 28 of 899 Date: 10/6/2025 Resolution Awarding Construction Contract to Sunram Construction for Stormwater Management Basin Maintenance Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution awarding a construction contract to Sunram Construction for Stormwater Management Basin Maintenance, City Project 24-49. Overview The City, Dakota County and Vermillion River Watershed Joint Powers Organization (VRWJPO) are partnering to complete maintenance of an existing stormwater management system basin located southwest of the Kenwood Trail (CSAH 50) and Jaguar Avenue intersection, City Project 24-49. Existing drain tile facilities have failed, causing sand to wash into the underground conveyance system. In addition, the stability of the berms within the stormwater management facilities are failing due to muskrat tunneling/activity. Maintenance activities include: a) drain tile replacement, b) filter aggregate replacement, c) equalizer pipe installation, and d) basin excavation and expansion. The maintenance activities are designed to restore the stormwater management system's functionality and preserve the City's stormwater infrastructure investment. The City received three quotes for maintenance activities for City Project 24-49, ranging from a low quote of $90,609.00 submitted by Sunram Construction to a high quote of $140,353.94. The engineer's estimate of the construction cost was $101,395.50. The City, County and VRWJPO will share project responsibilities and costs consistent with terms and conditions established in a future Joint Powers Agreement. The City is the lead agency; therefore, the total project cost is reflected in this memo. Supporting Information 1. 2025.10.06 Resolution Awarding Construction Contract 2. 2025.10.06 Agreement for Construction 3. 2025.09.29 Summary of Quotes Financial Impact: $90,609.00 Budgeted: Yes Source: Utility Fund - Environmental Res. Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Maria Friedges, Environmental Resources Specialist Page 29 of 899 CITY OF LAKEVILLE RESOLUTION NO. 25- Resolution Awarding Construction Contract to Sunram Construction, Inc. for Stormwater Management Basin Maintenance WHEREAS, the City of Lakeville received quotes on Friday, September 26, 2025, for Stormwater Management Basin Maintenance related to City Project 24-49; and WHEREAS, the lowest responsible quote was from Sunram Construction, Inc. NOW, THEREFORE, BE IT RESOLVED, that the City Council of the City of Lakeville, Minnesota: Hereby awards the contract to the lowest responsible quoter that meets all the quote requirements, Sunram Construction, Inc., with a quote in the amount of $90,609.00. The construction is proposed to be completed as specified in the contract documents. ADOPTED by the Lakeville City Council this 6th day of October 2025. ______________________________ Luke M. Hellier, Mayor _________________________________ Ann Orlofsky, City Clerk Page 30 of 899 ! "## $ %&% ##'(###)* (" +,' )* !## "## $-!,.'(/' .01.023435 2&% .01" )*, +,' (1 !## "## $ ! 6&% .0 ! 3&% ##'#' " # 1"1, #'(#1'(# " "#(' +,' " " 3&2 )*## , ##'(#"!"#!$%&'(1'(# " "# (' .!( %7&8 " # , # '(# ## #, , # '(# ## #, ## '/# 1 !!1# ##19,#:(( ##1"#' ##1(#'" ((1 * ; )*##"#'(#"#")&'( 3&6 !: ' " .!( 3&%/ ## ,"" "# # " )* '(# # / ' (" .!( 3&2 /1 (#, < "## ( # !: # 1<( 1"",# /#/(/!#!#(! ,## ,""" )* '(#'!#1 " 9,! , ("1! #9,'! "# , (#= % #9,'! ## #%>&?4% ,#"@9, +'! "## '(# 1 ## ''(# 2 A#,'(# !! '(# ,# # 6 A#,(/'( #:((( B '# Page 31 of 899 3 @9,'! ##,',#/1 ####" (" (0, , ("(' /' * 7&% ##("'(#" )* +,' ', "##1 ,00, ', $ A##C.)*1',9,# ,'" <( # " (#"'"C.)*',#(#! ,(' ,# 9," ' D ;1 < 1(/ " <( " C.)* <( "C.)* " " ""/+" '9, (/ .!( %6&6" # 1 '9, !,1 ' ",#9, # " ' ! #"## <. "C.)* ,0"#0, ' ,# 9, EFFFFFFFFFFFF ( 8&% ## ,'((# ".' #%7" # ((# ".'##( ! (/ # 8&2 ## '* (! (' , " . " D ((# ".', " ' ,! ("' " )* (/ .!( 8&2% #1 (/ , ((# ".' / ,''#' ' 9,' " ## , (' ##' , ,#"G#, # (/ # "C.)* ,'", '(#1 / ,#"G#, 1 (/ # % ., #'(#1(! (' ##'',9,# (! # ,1 1 # !!! " (' (/, #'# , ', ' #1#,!,#' #9,'! 1 57(")*'(# #!!" )* 7&('(# ' !1" (! " )* / " !1 #! (! " )* ' " !1 ###!= 57(" "'# 9,('( )* #!! ; C(, #'(#1 ##(', ,"" #(' %&&(" )*'(#1# , ', "" (, ,.!( %7&% " # 1# 2&&(" !D '" /#,")*'(# (, # "' '(#("#(' 8&6 C("#'(#(" )* .!( %7&8" # 1 ##( '" . '' ! (/ .!( %7&8 Page 32 of 899 + ?&% ##', ( , ## "7((,' , - >&% , 1 '* "##! ( $ <'",## , +,' 1 " " +,' ; / 1, ,! 1#/ ,#<'" 0 1'"'# " !#1##1 '"" 1(! 1("'" )* "'# " ##@ !,# '"" 1 (! 1("'" )* + ",## , ##$ % ( " <(# " , ," 0 ##! "( # #!< ! ," , ," ,, /" ,((#' 1 (## ( #+ , ( ! 12 ( ! #!:, /'# 1"10 /" ,((#' 1 (## ( #+ , ( ! "'* #"="'''# * !, ##" ="' / "'/ = +,' = 4#( ! " +,' 1 ( """ , "'1 / 1,' % 1(! 1("'" )*=2 ' 1' 1 9, 1 9, 1(, " ,'(# 6D "(, (!' A ; "' / " (!(!( 1 ! ", <' 1/ ! 1<(# 1 1 , 1 " ("'" )* .1 ' 1 ' " !#,"*("' # )* +,' !/ ! " ## "# 1 1 '!, 1 ( / +,' 1 #, " ! (# +,' !## ,""/, !"## ' "("'", !" )* - D , /# ( ,<(##( !'(' ,(("'! ", ! )*9, +,' H C# (" +,' 1 ##1,((" <, +,' 1 ,' ! ' " , (( " *, ' !<( 9, " @ +,' ## , ! ,# # ( , Page 33 of 899 5&% +,' " "##!$ % !'(! %FF?F1#, / 2 ."'(! FFFFFF1#, / 6 .'(! FFFFFF1#, / 3 (! FFFFFF1#, / 7 # (! FFFFFF1#, / 8 ,((#' (! FFFFFF1#, / ? (" # #" " .0 ,# > +! ,(" !"FFF ! "##!!##$FFF1FFF 5 ,' FFFFFF1#, / %& < !',' "## $ D ;(! FFFFFF1#, / 4##, ""/ ( #G""A' %% "##! '#/ ," ""/+" $ . )* !+/ ! A# ; ,' # .!( 5&% !' <( <( # / +,' # / #5 + +,' '#'1'"1 ,((#' (/ # ' %&&% ' , !'## / '! # ,((#' %&&2 C# <( #!# 1 !'( " ! , ##! ( , " ( ,! ,=1 ("##, ,#'1' '',' ,' ! , , <( < """ '#'#1,# ("## !'1 !'## # ! ! "' , ( # , +,' Page 34 of 899 * %&&6 #"1 , 1 ! 1#!#( / ( 1 , 1 ! 1#!#( / (## / 1!' 1#! +,' %&&3 ! (/ (" +,' #/,"#, @!,# ##' *1##'!(/ ##, /#!,(1 ! +,' ## "'(# , *(/ ( " /#"# (/ ' # ( #<( ! " *(/ %&&7 " (/ " %82>7 ( # '( 9,'" '' ',( / (' , ,'"# ', /"!'(# " '',' " , ; (/ " 3?%3271 ,/ 3'( 9,'" % " ',(# ', 9, (' ( , " (' D ( " (' "' ',(#", (, / (/ , ', 9, ('( "%4%B2((' (" ' , , (, ', ( ' , '','' # (#('",(#" E%&&' E%&A,(#"# E%&&1 (' ## ( ,#(#, ,, (/# /# ## (# "'('', , ' 1#,!D " 1,!! %&&8 # ! '" # '# "'#'' ( ,#" / ("'1 ## ', " " #D " ', ,#" , #' %&&?$ ! (,# " # '(" -+I4?&&1# " ,1(,# ! -+,' ''I1" ( ", # 1 (## ##'" !" , (,# ,' 1 ,! ( , ! #! !* ! #B *,1 ,((#' ; (/ (" +,' #/,"#, #!,# ##' *1##'!(/ ##, /#!,(1 ! +,' ## "'(# , *(/ ( " /#"# (/ ' # ( #<( ! " *(/ %&&> % & " 9,('(/ (, , "1 #,! ',",' /' !# (" 9,('1 ##(## "# !" ### ("## ",(!" "(""##!,/ ## /#!(" , " " ! " Page 35 of 899 ( # # !!' ###! (#" ",!, " %&&5 !' (& " 9, 1 1 , " !1/1'# ( /# 1((! 1'*'1 ## (/" , , ,##!#!' ((" !' ##"# " , !' '"# 1 ##'" # '# "'###' " "!' " , " , ( !1/1'#( 1 '*'(! .0! ("', 1 ##'"" " 1 ##1<( J " ,#"' , "!' %&%& & (' !1 ,#1 " #! , ( " (1 #,( , ' ( '! " ! %&%% ))* & ## !/ ## # , '(# " .0 ## ## ! 4"4 ' ####'( " ,# ,#!"' D '#!! 4"4 ' Page 36 of 899 + "# "$%%#&$'$() ! !'##""/FFFFFFFFFF ""/+" ) $ $ ;$ ;$ #$ #$ +# ( '( (' , ! ' ! &- $ $ #$ #$ "!/! $ "!/! $ @ $ +% ((- +#$% ( ' ! &#$% (' ! . / &- Page 37 of 899 Stantec Consulting Services Inc. One Carlson Parkway Suite 100, Plymouth, MN 55447 September 29, 2025 City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Re: Jaguar Pond Improvements Project City Project Number: 24-49 Quote Results Dear City of Lakeville, Quotes were opened for the Project stated above on September 26, 2025. Transmitted herewith is a copy of the Quote Tabulation for your information and file. A copy will also be distributed to the Quoters once the Project has been awarded. There were a total of 3 Quotes. The following summarizes the results of the Quotes received: Contractor Total Base Quote Low Sunram Construction, Inc $90,609.00 #2 Minger Construction Co, Inc $118,278.50 #3 Blackstone Contractors, LLC $140,353.94 The low Quote on the Project was Sunram Construction, Inc. with a Total Base Quote Amount of $90,609.00. These 3 Quotes have been reviewed and are found to be in order. If the City Council wishes to award the Project to the low Quote, then Sunram Construction, Inc should be awarded the Project on the Total Base Quote in the Amount of $90,609.00. Should you have any questions, please feel free to contact me at (763) 479-5174. Sincerely, STANTEC CONSULTING SERVICES INC. Nick Wyers, P.E. Enclosure Page 38 of 899 Date: 10/6/2025 Amendment to Contract with Summit Fire Protection Corporation Proposed Action Staff recommends adoption of the following motion: Move to approve first amendment for contractact for services for City of Lakevilles Fire and Life Saftey services with Summit Fire Protection Co. Overview The Water Treatment Facility recently updated the roll-down chemical room gate operators for fire protection. To meet code requirements, these gates must be connected to the main fire alarm panel. The existing panel is obsolete and cannot accept the new gate control system. Staff proposes upgrading the facility’s fire alarm panel to a new system that meets code and is standardized with other facility systems. Supporting Information 1. First Amendment to Contract for Services 2. Contract for Services 2024-2026_ with Summit 3. Lakeville Water Treatment Plant Fire system quote Financial Impact: $37,950.00 Budgeted: Yes Source: Utilities Operating Budget Major Maintenance Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Tom Breeggemann Facility Supervisor Page 39 of 899 1 237039v1 FIRST AMENDMENT TO CONTRACT FOR SERVICES THIS FIRST AMENDMENT (this "Amendment") is made as of this 6th day of October, 2025, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation ("City"), and SUMMIT FIRE PROTECTION CORPORATION, a Minnesota corporation, (“Contractor”). WHEREAS, the City and Contractor entered into a Contract For Services on December 18th , 2023 for Fire and Life Safety services at all municipal buildings. (“Contract”); WHEREAS, the City desires to have Contractor provide additional Fire and Life Safety services for Water Treatment Facility. NOW THEREFORE, THE PARTIES HERETO AGREE AS FOLLOWS: 1. Amendment to Paragraph 1 of the Contract. Paragraph 1 of the Contract is amended to include in the Work, the work proposed in Contractor’s Proposal attached as Exhibit C. 2. Amendment to Paragraph 2(C) of the Contract. Paragraph 2(C) of the Agreement is amendedin its entirety to read as follows C. Contractors Proposal (Exhibit B) and Contractors’ Quote Dated September 9th , 2025 (Exhibit C) 3. Amendment to Contract. The Contract is amended to include Exhibit C as attached hereto. IN WITNESS WHEREOF, the City and Contractor have entered into this Amendment as of the date first above written. [Remainder of page intentionally left blank] [Signature pages to follow] Page 40 of 899 2 237039v1 CITY OF LAKEVILLE BY:___________________________ Luke M. Hellier, Mayor AND ___________________________ Ann Orlofsky, City Clerk SUMMIT FIRE PROTECTION Co. By:__________________________________ Print Name:___________________________ Its: _________________________________ Page 41 of 899 3 237039v1 EXHIBIT D Page 42 of 899 Proposal and Contract Summit Companies (“Summit”) makes the following proposal (the “Proposal”): Date: September 9, 2025 Re: Fire Alarm System Upgrade Project Name: Lakeville Water Treatment Plant Attn: Tom Breeggeman tbreeggemann@lakevillemn.gov I appreciate the opportunity to provide the quote for a New fire alarm system SCOPE OF WORK Notifier NFS-320 Addressable panel Replace Manual pull stations (20) Replace Smoke Detectors (32) Replace addressable modules (25) Replace addressable relays (17) Add addressable relays for new electronic gates (8) Replace horn Strobes (25) Replace strobes (2) Add cellular communicator EXCLUSIONS 1) Additional requirements from AHJ 2) After hours labor 3) Painting or Patching. Summit agrees to the above project parts and installation as well as testing for total price of $37,950.00 Annual Monitoring contract $780.00 Additional items that are not indicated on this contract which may be requested by owner, any insurance agency, or Authority Having Jurisdiction (AHJ). Completion of the Project: Summit offers to provide to Owner the equipment, supplies and materials, as well as the installation services and labor to complete the Project, as described in the Specifications. This Proposal shall be null and void, at Summit’s option, if Summit does not receive a signed acceptance of this Proposal by Owner within thirty (30) days. Summit reserves the right to adjust all prices based on the cost of materials at the time this Proposal is accepted by Owner. In order to guarantee pricing, Owner may be required to pay for materials at the time of acceptance of this Proposal. General Conditions: The General Conditions attached to this Proposal are a part of this Proposal. Upon acceptance of this Proposal by Owner, the General Conditions will be a part of the contract between Summit and Owner. Page 43 of 899 SUMMIT FIRE PROTECTION: By: Gene Stifter Signature Pete Schommer Print Name Sales Representative Summit Fire Protection Phone: (763)-349-1975 OWNER ACCEPTANCE OF PROPOSAL Summit’s Proposal is hereby accepted and agreed to by Owner. Owner acknowledges that Owner received and read the Proposal and the attached General Conditions. Upon acceptance by Owner, this Proposal, along with the attached General Conditions, will be a binding contract between Summit and Owner. OWNER: By: Signature Print Name Date SUMMIT COMPANIES PROPOSAL AND CONTRACT GENERAL CONDITIONS These General Conditions are attached to and made a part of the Summit Proposal and Contract to which they are attached (collectively, the “Contract”) as if fully set forth on the front page of the Contract. As used in these General Conditions, “Summit,” “Owner,” “Project,” and “Contract Price” shall have the same meanings as those terms have in the Contract. 1. Payment. Owner agrees to pay the Contract Price for the Project as and when required in the Contract. If Owner fails to pay the Contract Price, or any installment thereof, within ten (10) days after the date the same is due and payable, Owner shall automatically be assessed and shall pay a late charge equivalent to three percent (3%) of the amount of such late payment, together with interest on such late payment at the lower of the maximum rate allowed by applicable law or the rate of eighteen percent (18%) per annum. Page 44 of 899 2. Changes. Except for substitutions, as described below in this paragraph, any alteration or modification to the Project must be documented and approved by Summit and Owner by a written change order signed by Summit and Owner. Summit reserves the right to require Owner to pay for all change order items (labor, equipment and any other materials) at the time of signing the change order. In the event of discontinuations, changes or the unavailability of specific equipment or materials described in the Specifications, Summit will have the right to substitute equipment and materials with substantially similar quality and features; provided, however, that if the replacement items are more expensive, then Summit shall notify Owner and Owner may elect whether to pay the additional expense (as an increase to the Contract Price) or to modify the Proposal to include less expensive items, if available, that would not increase the Contract Price. 3. Limited Warranty. All materials and labor supplied by Summit will be warranted for one (1) year from the date of completion of the Project. Upon request, Summit will supply a signed warranty letter to Owner, which states the completion date of the Project and the warranty termination date. Certain equipment may include manufacturer’s warranties. Summit provides no additional warranty on such equipment. Owner shall have the right to seek enforcement of any such manufacturer’s warranty. Summit shall have no obligation to seek enforcement of any such manufacturer’s warranty against the manufacturer. Any labor or other services requested by Owner of Summit in connection with Summit’s warranty after the one (1) year warranty termination date shall be paid by Owner to Summit based on Summit’s standard fees and charges at the time. No other express or implied warranties are made by Summit. Summit’s warranty shall not apply with respect to misuse, abuse or any use that is not in conformity with all applicable specifications and instructions. Except as specifically set forth in this Contract, Summit, and/or its agents and representatives makes no warranty or representation, express or implied, with respect to use, construction standards, workmanship, materials, merchantability or fitness for a particular purpose. 4. Taxes. Any taxes or other governmental charges related to the Project shall be paid by Owner to Summit and shall be in addition to the Contract Price. In addition, if any fees or permits (such as one or more building permits) are required in connection with the Project, Owner shall secure and pay for any such fees and permits, the cost of which shall be in addition to the Contract Price 5. Unavoidable Delays. To the extent any time period for performance by Summit applies, Summit shall not be responsible for any delays due to federal, state or municipal actions or regulations, strikes or other labor shortages, equipment or other materials delays or shortages, acts or omissions of Owner, or any other events or causes beyond the control of Summit. 6. Access. Owner shall allow Summit to have reasonable access to the job site to allow the completion of the Project on the dates and at the times requested by Summit personnel. 7. Risk of Loss. Risk of loss shall pass to Owner at the time the equipment and other materials that are part of the Project are delivered to the job site. This means that, for example, in the event of damage or destruction due to casualty, or in the event of theft, Owner shall be responsible for payment for such equipment and materials even if the Project has not been completed. Title to the equipment and other materials shall be held by Summit until payment in full of the Contract Price, at which time title shall pass to Owner. Summit shall have the right to remove the equipment and other materials that are a part of the Project if payment of the full Contract Price is not made by Owner immediately upon completion of the Project. That right shall be in addition to, and not in limitation of, Summit other rights and remedies. 8. MECHANIC LIEN NOTICE. YOU ARE ENTITLED UNDER MINNESOTA LAW TO THE FOLLOWING NOTICE: (a) ANY PERSON OR COMPANY SUPPLYING LABOR OR MATERIALS FOR THIS IMPROVEMENT TO YOUR PROPERTY MAY FILE A LIEN AGAINST YOUR PROPERTY IF THAT PERSON OR COMPANY IS NOT PAID FOR THEIR CONTRIBUTIONS. (b) UNDER MINNESOTA LAW, YOU HAVE THE RIGHT TO PAY PERSONS WHO SUPPLIED LABOR OR MATERIALS FOR THIS IMPROVEMENT DIRECTLY AND DEDUCT THIS AMOUNT FROM OUR CONTRACT PRICE, OR WITHHOLD THE AMOUNTS DUE THEM FROM US UNTIL 120 DAYS AFTER COMPLETION OF THE IMPROVEMENT UNLESS WE GIVE YOU A LIEN WAIVER SIGNED BY PERSONS WHO SUPPLIED ANY LABOR OR MATERIAL FOR THE IMPROVEMENT AND WHO GAVE YOU TIMELY NOTICE. 9. Limitation of Liability and Remedies. The Project is not an insurance policy or a substitute for an insurance policy. In the event of any breach, default or negligence by Summit under this Contract, Owner agrees that the maximum liability of Summit shall not exceed an amount equal to the Contract Price. Owner expressly waives any right to make any claim in excess of that amount. Further, Owner waives any right to any claims for punitive, exemplary or consequential damages. Owner shall provide Summit with reasonable notice of any claim and a reasonable opportunity to cure the alleged breach or default. Owner shall indemnify, defend and hold Summit harmless from and against claims, actions, costs and expenses, including reasonable legal fees and costs, arising out of any injury, death or damage occurring on or about the job site unless caused by the gross negligence or willful misconduct of Summit. 10. Owner’s Failure to Pay. If Owner fails to pay any amount due to Summit as and when required, Summit shall have the right, but not the obligation, to immediately stop work on the Project and Summit may pursue any and all available remedies, including the right to place a lien Page 45 of 899 against the Project site. In addition, Owner shall be obligated to reimburse Summit for reasonable legal fees and costs incurred by Summit in the enforcement of this Contract. 11. Binding Arbitration Agreement. Except as otherwise set forth in Section 10 above, in the event of any dispute between Owner and Summit, whether during the performance of the work and services contemplated under this Contract or after, Owner and Summit agree to negotiate in good faith towards the resolution of the dispute. If Owner and Summit are unable to resolve the dispute within twenty (20) days after the date the dispute arises, then Owner and Summit agree to resolve the dispute through binding arbitration. All disputes arising out of or relating to this Contract including, without limitation, claims relating to the formation, performance or interpretation of this Contract, and claims of negligence, breach of contract and breach of warranty, which are not resolved either through direct negotiation as provided above, shall be resolved by binding arbitration under the Construction Industry Arbitration Rules of the American Arbitration Association then in effect. This arbitration agreement will be governed by the Federal Arbitration Act and the Minnesota Uniform Arbitration Act. Arbitration will be commenced by written demand for arbitration filed with the American Arbitration Association and the notice of filing, together with a copy of the written demand for arbitration, be provided to the other party in accordance with the notice provisions of this Contract. However, no arbitration or legal action will be commenced following expiration of the application statute of limitations or repose. Judgment on the arbitration award will be confirmed in any court with jurisdiction. Owner and Summit agree that any subcontractor, material supplier, or sub-subcontractor may be made a party to the arbitration proceeding. Venue for the arbitration will be Ramsey County, Minnesota. Summit expressly reserves all mechanics lien rights under Chapter 514 of the Minnesota Statutes and may take such other legal action as is needed to perfect such rights. The provisions contained in this paragraph will survive the completion of construction and termination of this Contract. 12. Miscellaneous. The headings used herein are for convenience only and are not to be used in interpreting this Contract. This Contract shall be construed, enforced and interpreted under the laws of the State of Minnesota. This Contract may not be modified, amended or changed orally, but only by an agreement in writing signed by the parties hereto. Neither party shall be deemed to have waived any rights under this Contract unless such waiver is given in writing and signed by such party. If any provision of this Contract is invalid or unenforceable, such provision shall be deemed to be modified to be within the limits of enforceability or validity, if feasible; however, if the offending provision cannot be so modified, it shall be stricken and all other provisions of this Contract in all other respects shall remain valid and enforceable. This Contract is not assignable by Owner. This Contract is the entire agreement between the parties regarding the subject matter of this Contract; any prior or simultaneous oral or written agreement regarding the subject matter hereof is superseded by this Contract. Page 46 of 899 Page 47 of 899 Page 48 of 899 Page 49 of 899 Page 50 of 899 Page 51 of 899 Page 52 of 899 Page 53 of 899 Page 54 of 899 Proposal and Contract Summit Companies (“Summit”) makes the following proposal (the “Proposal”): Date: September 9, 2025 Re: Fire Alarm System Upgrade Project Name: Lakeville Water Treatment Plant Attn: Tom Breeggeman tbreeggemann@lakevillemn.gov I appreciate the opportunity to provide the quote for a New fire alarm system SCOPE OF WORK Notifier NFS-320 Addressable panel Replace Manual pull stations (20) Replace Smoke Detectors (32) Replace addressable modules (25) Replace addressable relays (17) Add addressable relays for new electronic gates (8) Replace horn Strobes (25) Replace strobes (2) Add cellular communicator EXCLUSIONS 1) Additional requirements from AHJ 2) After hours labor 3) Painting or Patching. Summit agrees to the above project parts and installation as well as testing for total price of $37,950.00 Annual Monitoring contract $780.00 Additional items that are not indicated on this contract which may be requested by owner, any insurance agency, or Authority Having Jurisdiction (AHJ). Completion of the Project: Summit offers to provide to Owner the equipment, supplies and materials, as well as the installation services and labor to complete the Project, as described in the Specifications. This Proposal shall be null and void, at Summit’s option, if Summit does not receive a signed acceptance of this Proposal by Owner within thirty (30) days. Summit reserves the right to adjust all prices based on the cost of materials at the time this Proposal is accepted by Owner. In order to guarantee pricing, Owner may be required to pay for materials at the time of acceptance of this Proposal. General Conditions: The General Conditions attached to this Proposal are a part of this Proposal. Upon acceptance of this Proposal by Owner, the General Conditions will be a part of the contract between Summit and Owner. Page 55 of 899 SUMMIT FIRE PROTECTION: By: Gene Stifter Signature Pete Schommer Print Name Sales Representative Summit Fire Protection Phone: (763)-349-1975 OWNER ACCEPTANCE OF PROPOSAL Summit’s Proposal is hereby accepted and agreed to by Owner. Owner acknowledges that Owner received and read the Proposal and the attached General Conditions. Upon acceptance by Owner, this Proposal, along with the attached General Conditions, will be a binding contract between Summit and Owner. OWNER: By: Signature Print Name Date SUMMIT COMPANIES PROPOSAL AND CONTRACT GENERAL CONDITIONS These General Conditions are attached to and made a part of the Summit Proposal and Contract to which they are attached (collectively, the “Contract”) as if fully set forth on the front page of the Contract. As used in these General Conditions, “Summit,” “Owner,” “Project,” and “Contract Price” shall have the same meanings as those terms have in the Contract. 1. Payment. Owner agrees to pay the Contract Price for the Project as and when required in the Contract. If Owner fails to pay the Contract Price, or any installment thereof, within ten (10) days after the date the same is due and payable, Owner shall automatically be assessed and shall pay a late charge equivalent to three percent (3%) of the amount of such late payment, together with interest on such late payment at the lower of the maximum rate allowed by applicable law or the rate of eighteen percent (18%) per annum. Page 56 of 899 2. Changes. Except for substitutions, as described below in this paragraph, any alteration or modification to the Project must be documented and approved by Summit and Owner by a written change order signed by Summit and Owner. Summit reserves the right to require Owner to pay for all change order items (labor, equipment and any other materials) at the time of signing the change order. In the event of discontinuations, changes or the unavailability of specific equipment or materials described in the Specifications, Summit will have the right to substitute equipment and materials with substantially similar quality and features; provided, however, that if the replacement items are more expensive, then Summit shall notify Owner and Owner may elect whether to pay the additional expense (as an increase to the Contract Price) or to modify the Proposal to include less expensive items, if available, that would not increase the Contract Price. 3. Limited Warranty. All materials and labor supplied by Summit will be warranted for one (1) year from the date of completion of the Project. Upon request, Summit will supply a signed warranty letter to Owner, which states the completion date of the Project and the warranty termination date. Certain equipment may include manufacturer’s warranties. Summit provides no additional warranty on such equipment. Owner shall have the right to seek enforcement of any such manufacturer’s warranty. Summit shall have no obligation to seek enforcement of any such manufacturer’s warranty against the manufacturer. Any labor or other services requested by Owner of Summit in connection with Summit’s warranty after the one (1) year warranty termination date shall be paid by Owner to Summit based on Summit’s standard fees and charges at the time. No other express or implied warranties are made by Summit. Summit’s warranty shall not apply with respect to misuse, abuse or any use that is not in conformity with all applicable specifications and instructions. Except as specifically set forth in this Contract, Summit, and/or its agents and representatives makes no warranty or representation, express or implied, with respect to use, construction standards, workmanship, materials, merchantability or fitness for a particular purpose. 4. Taxes. Any taxes or other governmental charges related to the Project shall be paid by Owner to Summit and shall be in addition to the Contract Price. In addition, if any fees or permits (such as one or more building permits) are required in connection with the Project, Owner shall secure and pay for any such fees and permits, the cost of which shall be in addition to the Contract Price 5. Unavoidable Delays. To the extent any time period for performance by Summit applies, Summit shall not be responsible for any delays due to federal, state or municipal actions or regulations, strikes or other labor shortages, equipment or other materials delays or shortages, acts or omissions of Owner, or any other events or causes beyond the control of Summit. 6. Access. Owner shall allow Summit to have reasonable access to the job site to allow the completion of the Project on the dates and at the times requested by Summit personnel. 7. Risk of Loss. Risk of loss shall pass to Owner at the time the equipment and other materials that are part of the Project are delivered to the job site. This means that, for example, in the event of damage or destruction due to casualty, or in the event of theft, Owner shall be responsible for payment for such equipment and materials even if the Project has not been completed. Title to the equipment and other materials shall be held by Summit until payment in full of the Contract Price, at which time title shall pass to Owner. Summit shall have the right to remove the equipment and other materials that are a part of the Project if payment of the full Contract Price is not made by Owner immediately upon completion of the Project. That right shall be in addition to, and not in limitation of, Summit other rights and remedies. 8. MECHANIC LIEN NOTICE. YOU ARE ENTITLED UNDER MINNESOTA LAW TO THE FOLLOWING NOTICE: (a) ANY PERSON OR COMPANY SUPPLYING LABOR OR MATERIALS FOR THIS IMPROVEMENT TO YOUR PROPERTY MAY FILE A LIEN AGAINST YOUR PROPERTY IF THAT PERSON OR COMPANY IS NOT PAID FOR THEIR CONTRIBUTIONS. (b) UNDER MINNESOTA LAW, YOU HAVE THE RIGHT TO PAY PERSONS WHO SUPPLIED LABOR OR MATERIALS FOR THIS IMPROVEMENT DIRECTLY AND DEDUCT THIS AMOUNT FROM OUR CONTRACT PRICE, OR WITHHOLD THE AMOUNTS DUE THEM FROM US UNTIL 120 DAYS AFTER COMPLETION OF THE IMPROVEMENT UNLESS WE GIVE YOU A LIEN WAIVER SIGNED BY PERSONS WHO SUPPLIED ANY LABOR OR MATERIAL FOR THE IMPROVEMENT AND WHO GAVE YOU TIMELY NOTICE. 9. Limitation of Liability and Remedies. The Project is not an insurance policy or a substitute for an insurance policy. In the event of any breach, default or negligence by Summit under this Contract, Owner agrees that the maximum liability of Summit shall not exceed an amount equal to the Contract Price. Owner expressly waives any right to make any claim in excess of that amount. Further, Owner waives any right to any claims for punitive, exemplary or consequential damages. Owner shall provide Summit with reasonable notice of any claim and a reasonable opportunity to cure the alleged breach or default. Owner shall indemnify, defend and hold Summit harmless from and against claims, actions, costs and expenses, including reasonable legal fees and costs, arising out of any injury, death or damage occurring on or about the job site unless caused by the gross negligence or willful misconduct of Summit. 10. Owner’s Failure to Pay. If Owner fails to pay any amount due to Summit as and when required, Summit shall have the right, but not the obligation, to immediately stop work on the Project and Summit may pursue any and all available remedies, including the right to place a lien Page 57 of 899 against the Project site. In addition, Owner shall be obligated to reimburse Summit for reasonable legal fees and costs incurred by Summit in the enforcement of this Contract. 11. Binding Arbitration Agreement. Except as otherwise set forth in Section 10 above, in the event of any dispute between Owner and Summit, whether during the performance of the work and services contemplated under this Contract or after, Owner and Summit agree to negotiate in good faith towards the resolution of the dispute. If Owner and Summit are unable to resolve the dispute within twenty (20) days after the date the dispute arises, then Owner and Summit agree to resolve the dispute through binding arbitration. All disputes arising out of or relating to this Contract including, without limitation, claims relating to the formation, performance or interpretation of this Contract, and claims of negligence, breach of contract and breach of warranty, which are not resolved either through direct negotiation as provided above, shall be resolved by binding arbitration under the Construction Industry Arbitration Rules of the American Arbitration Association then in effect. This arbitration agreement will be governed by the Federal Arbitration Act and the Minnesota Uniform Arbitration Act. Arbitration will be commenced by written demand for arbitration filed with the American Arbitration Association and the notice of filing, together with a copy of the written demand for arbitration, be provided to the other party in accordance with the notice provisions of this Contract. However, no arbitration or legal action will be commenced following expiration of the application statute of limitations or repose. Judgment on the arbitration award will be confirmed in any court with jurisdiction. Owner and Summit agree that any subcontractor, material supplier, or sub-subcontractor may be made a party to the arbitration proceeding. Venue for the arbitration will be Ramsey County, Minnesota. Summit expressly reserves all mechanics lien rights under Chapter 514 of the Minnesota Statutes and may take such other legal action as is needed to perfect such rights. The provisions contained in this paragraph will survive the completion of construction and termination of this Contract. 12. Miscellaneous. The headings used herein are for convenience only and are not to be used in interpreting this Contract. This Contract shall be construed, enforced and interpreted under the laws of the State of Minnesota. This Contract may not be modified, amended or changed orally, but only by an agreement in writing signed by the parties hereto. Neither party shall be deemed to have waived any rights under this Contract unless such waiver is given in writing and signed by such party. If any provision of this Contract is invalid or unenforceable, such provision shall be deemed to be modified to be within the limits of enforceability or validity, if feasible; however, if the offending provision cannot be so modified, it shall be stricken and all other provisions of this Contract in all other respects shall remain valid and enforceable. This Contract is not assignable by Owner. This Contract is the entire agreement between the parties regarding the subject matter of this Contract; any prior or simultaneous oral or written agreement regarding the subject matter hereof is superseded by this Contract. Page 58 of 899 Date: 10/6/2025 Contract for City Hall Interior Painting Proposed Action Staff recommends adoption of the following motion: Move to approve a contract with Mint Painting LLC. to remove existing wall covering in hallways and break room and paint interior spaces. Overview Following the recent construction project to relocate several city departments and add new service counters, City Hall’s hallway finishes were left with gaps and inconsistencies. This project proposes removing the remaining wallpaper in the hallways, preparing the walls, and repainting the hallway and lobby areas to achieve a uniform and consistent appearance throughout the facility. The project also includes modernizing the breakroom by removing outdated wallpaper and repainting, updating the art rails in both hallways, and repainting doors and window frames to provide the facility with a refreshed appearance. Supporting Information 1. Contract Mint Painting 2. Mint Painting City Hall Hallway Estimate 3. Met-Con City Hall Hallway Estimate Financial Impact: $32,800 Budgeted: Yes Source: Building Fund 4000.4010.6540 Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Tom Breeggemann, Facility Supervisor Page 59 of 899 215047v2 1 NON-BID CONTRACT FOR PURCHASE OF GOODS AND SERVICES AGREEMENT made this 6th day of October, 2025, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation ("City") and MINT PAINTING LLC., a Minnesota limited liability company. (“Contractor”). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents,” all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement. B. Contractor’s Quote dated September 11th , 2025 (Exhibit A) C. Initial Contractor Verification of Compliance (Exhibit B) In the event of a conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts. Contract Document “A” has the first priority and Contract Document “C” has the last priority. 2. CONTRACTOR OBLIGATIONS. The Contractor shall provide the goods, services and perform the work in accordance with the Contract Documents for the removal of all wall coverings in the hallways and break room, skim coat and prepare wall surfaces for paint, and complete painting of the hallways, breakroom, and main lobby walls, main lobby ceilings, and designated door and window frames at Lakeville City Hall. Contractor shall protect adjacent areas during work, and perform cleanup upon completion. Contractor shall provide all personnel, supervision, services, materials, tools, equipment and supplies and do all things necessary and ancillary thereto specified in the Contract Documents. This contract may be terminated by the City at any time upon discovery by the City that the Contractor or any of its subcontractors has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn. Stat. § 16C.285, Subdivision 3, the Responsible Contractor statute. 3. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. C. Contractor has given City written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by City is acceptable to Contractor. Page 60 of 899 215047v2 2 D. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. 4. COMPENSATION. Contractor shall be paid by the City for the goods and services described in exhibit A, but not to exceed: thirty-two thousand, eight hundred dollars and zero cents. ($32,800.00) which is inclusive of reimbursable expenses. The fee shall not be adjusted even if the estimated number of hours to perform a task, or any other estimate, assumption or matter is wrong or exceeded. Payment shall be made periodically after a service has been completed and within thirty- five (35) days of receipt of an invoice. 5. COMPLETION DATE. The Contractor shall complete the Work on or before December 31st 2025. 6. WARRANTY. The Contractor guarantees that all warranties as specified in the Quote shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship. In addition to the warranties required in the specifications the Contractor provides the following warranties. The Contractor is responsible for any and all defects in workmanship and materials and upon notification by the City shall immediately replace or repair the defective workmanship and materials without cost to the City. The Contractor warrants that only new unused materials will be used. The Contractor further warrants to the City that all materials and services furnished under the Contract will be in conformance with Contract Documents and that the goods are of merchantable quality and are fit for the use for which they are sold. These warranties are in addition to any manufacturer's standard warranty, and any warranty provided by law. 7. RIGHTS AND REMEDIES. A. The duties and obligations imposed by the Contract Documents, and the rights and remedies available thereunder shall be in addition to, and not a limitation of, any duties, obligations, rights and remedies otherwise imposed or available by law. B. No action, or failure to act, by the City or the Contractor shall constitute a waiver of any right or duty afforded any of them under the Contract, nor shall any such action or failure to act constitute an approval of, or acquiescence in, any breach there under, except as may be specifically agreed in writing. 8. INSPECTION AT DELIVERY. At the point of delivery, the City will have the right inspect the goods for compliance with the Contract Documents prior to installation. As the result of the inspection, the City will: A. Accept the goods subject to an inspection report requiring correction; or B. Refuse to make payment until corrections are complete. 9. CHANGES TO WORK. Without invalidating the Contract, the City may, at any time, or from time to time, order additions, deletions or revisions in the work provided under this Agreement; these will be authorized by an amendment to the Contract. Upon approval of an amendment, Contractor shall proceed with the work provided under the amendment. Changes in Page 61 of 899 215047v2 3 the Contract Price shall be based upon the prices identified in the Quote provided or negotiated between the parties based on similar work provided in the Proposal. 10. UNAUTHORIZED WORK. Additional work performed without authorization of an amendment of this Contract will not entitle Contractor to an increase in the Compensation or an extension of the Contract. 11. DOCUMENTS. The City shall be the owner of all documents, reports, studies, analysis and the like prepared by the Contractor in conjunction with this contract. 12. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Contractor shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of goods and services to be provided. 13. STANDARD OF CARE. Contractor shall exercise the same degrees of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional Contractor under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Contractor’s services. 14. INDEMNIFICATION. To the fullest extent permitted by law, Contractor agrees to defend, indemnify and hold harmless the City, and its employees, officials, and agents from and against all claims, actions, damages, losses and expenses, including reasonable attorney fees, arising out of Contractor’s negligence or its performance or failure to perform its obligations under this Contract. Contractor’s indemnification obligation shall apply to subcontractor(s), or anyone directly or indirectly employed or hired by Contractor, or anyone for whose acts Contractor may be liable. Contractor agrees this indemnity obligation shall survive the completion or termination of this Contract. 15. INSURANCE. Prior to the start of the project, Contractor shall furnish to the City a certificate of insurance showing proof of the required insurance required under this Paragraph. Contractor shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, such insurance as shall protect Contractor and the City for work covered by the Contract including workers’ compensation claims and property damage, bodily and personal injury which may arise from operations under this Contract, whether such operations are by Contractor or anyone directly or indirectly employed by either of them. The minimum amounts of insurance shall be as follows: Commercial General Liability (or in combination with an umbrella policy) $2,000,000 Each Occurrence $2,000,000 Products/Completed Operations Aggregate $2,000,000 Annual Aggregate The following coverages shall be included: Premises and Operations Bodily Injury and Property Damage Personal and Advertising Injury Blanket Contractual Liability Products and Completed Operations Liability Automobile Liability Page 62 of 899 215047v2 4 $2,000,000 Combined Single Limit – Bodily Injury & Property Damage Including Owned, Hired & Non-Owned Automobiles Workers Compensation Workers’ Compensation insurance in accordance with the statutory requirements of the State of Minnesota, including Employer’s Liability with minimum limits are as follows: $500,000 – Bodily Injury by Disease per employee $500,000 – Bodily Injury by Disease aggregate $500,000 – Bodily Injury by Accident The Contractor’s insurance must be “Primary and Non-Contributory”. All insurance policies (or riders) required by this Contract shall be (i) taken out by and maintained with responsible insurance companies organized under the laws of one of the states of the United States and qualified to do business in the State of Minnesota, (ii) shall name the City, its employees and agents as additional insureds (CGL and umbrella only) by endorsement which shall be filed with the City. A copy of the endorsement must be submitted with the certificate of insurance. Contractor’s policies and Certificate of Insurance shall contain a provision that coverage afforded under the policies shall not be cancelled without at least thirty (30) days’ advanced written notice to the City, or ten (10) days’ notice for non-payment of premium. An Umbrella or Excess Liability insurance policy may be used to supplement Contractor’s policy limits on a follow-form basis to satisfy the full policy limits required by this Contract. 16. INDEPENDENT CONTRACTOR. The City hereby retains the Contractor as an independent contractor upon the terms and conditions set forth in this Agreement. The Contractor is not an employee of the City and is free to contract with other entities as provided herein. Contractor shall be responsible for selecting the means and methods of performing the work. Contractor shall furnish any and all supplies, equipment, and incidentals necessary for Contractor's performance under this Agreement. City and Contractor agree that Contractor shall not at any time or in any manner represent that Contractor or any of Contractor's agents or employees are in any manner agents or employees of the City. Contractor shall be exclusively responsible under this Agreement for Contractor's own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 17. SUBCONTRACTORS. Contractor shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Contractor shall comply with Minnesota Statute § 471.425. Contractor must pay Subcontractor for all undisputed services provided by Subcontractor within ten days of Contractor’s receipt of payment from City. Contractor must pay interest of 1.5 percent per month or any part of a month to Subcontractor on any undisputed amount not paid on time to Subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100 or more is $10. 18. ASSIGNMENT. Neither party shall assign this Agreement, nor any interest arising herein, without the written consent of the other party. Page 63 of 899 215047v2 5 19. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 20. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 21. CONTROLLING LAW. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. 22. COPYRIGHT. Contractor shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. 23. RECORDS/AUDIT. The Contractor shall maintain complete and accurate records of time and expense involved in the performance of services. Pursuant to Minnesota Statutes § 16C.05, Subd. 5, any books, records, documents, and accounting procedures and practices of City and Contractor relevant to the Agreement are subject to examination by City and Contactor, and either the Legislative Auditor or the State Auditor as appropriate. City and Contractor agree to maintain these records for a period of six years from the date of performance of all services covered under this Agreement. 24. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Contractor must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by the Contractor pursuant to this Agreement. Contractor is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Contractor receives a request to release data, Contractor must immediately notify City. City will give Contractor instructions concerning the release of the data to the requesting party before the data is released. Contractor agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Contractor’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 25. TERMINATION. This Agreement may be terminated by City on two (2) days’ written notice delivered to Contractor at the address on file with the City. Upon termination under this provision if there is no fault of the Contractor, the Contractor shall be paid for goods and services rendered and reimbursable expenses until the effective date of termination. If the City terminates the Agreement because the Contractor has failed to perform in accordance with this Agreement, no further payment shall be made to the Contractor, and the City may retain another Contractor to undertake or complete the work identified in this Agreement. Page 64 of 899 Page 65 of 899 ESTIMATE Discover the "Mint" difference. Flawless finishes, exceptional customer service. MINT PAINTING LLC 14310 Park Ave Burnsville, Minnesota 55337 United States Phone: 612-703-5482 - Office Mobile: 612-735-3071 - Dennis Direct www.mintpaintingservices.com Bill to City of Lakeville Tom Robinson 20195 Holyoke Avenue Lakeville, Minnesota 55044 United States 952-224-6219 trobinson@lakevillemn.gov Estimate Number:25-054 Customer Ref:City Hall hallways Estimate Date:September 11, 2025 Valid Until:October 11, 2025 Grand Total (USD):$32,800.00 Product/service Quantity Price Amount Wallpaper removal & Paint North & South wing- Remove all wallpaper and glue adhesive from the north and south wing, including the north wing vestibule. Skim walls for a uniform, smooth finish. Prime and paint in any color all the way up to the transparent ceiling. Including repair to all stress cracks near the transparent ceiling. Bump out soffits to be painted in a different color. 1 $22,800.00 $22,800.00 Wallpaper removal & Paint Break room- Remove all wallpaper and glue adhesive. Skim walls for a uniform, smooth finish. Prime and paint 2 coats in any color. 1 $4,800.00 $4,800.00 Lobby Ceiling Prep and paint the lobby ceiling, including the part that enters the beginning of both wings. Excluding any of the vaulted area in the center of the lobby. 1 $1,600.00 $1,600.00 Door frames Prep and paint 27 door frames. This includes the frames that have side or top windows in them. 125$ per frame 27 $110.00 $2,970.00 Window frames Prep and paint 5 small window frames in the south wing and 4 large window frames to the council chambers. 75$ per frame 9 $70.00 $630.00 Includes: Paint, Materials, & Labor 1 $0.00 $0.00 Grand Total (USD):$32,800.00We proudly use quality Sherwin Williams products. Exhibit A Page 66 of 899 Page 67 of 899 SUBCONTRACTORS LIST SUBCONTRACTORS LIST PROJECT TITLE: Attach Additional Sheets if Necessary Contractor: By (please print name) Signature (please sign name) Its Page 68 of 899 ESTIMATE Discover the "Mint" difference. Flawless finishes, exceptional customer service. MINT PAINTING LLC 14310 Park Ave Burnsville, Minnesota 55337 United States Phone: 612-703-5482 - Office Mobile: 612-735-3071 - Dennis Direct www.mintpaintingservices.com Bill to City of Lakeville Tom Robinson 20195 Holyoke Avenue Lakeville, Minnesota 55044 United States 952-224-6219 trobinson@lakevillemn.gov Estimate Number:25-054 Customer Ref:City Hall hallways Estimate Date:September 11, 2025 Valid Until:October 11, 2025 Grand Total (USD):$32,800.00 Product/service Quantity Price Amount Wallpaper removal & Paint North & South wing- Remove all wallpaper and glue adhesive from the north and south wing, including the north wing vestibule. Skim walls for a uniform, smooth finish. Prime and paint in any color all the way up to the transparent ceiling. Including repair to all stress cracks near the transparent ceiling. Bump out soffits to be painted in a different color. 1 $22,800.00 $22,800.00 Wallpaper removal & Paint Break room- Remove all wallpaper and glue adhesive. Skim walls for a uniform, smooth finish. Prime and paint 2 coats in any color. 1 $4,800.00 $4,800.00 Lobby Ceiling Prep and paint the lobby ceiling, including the part that enters the beginning of both wings. Excluding any of the vaulted area in the center of the lobby. 1 $1,600.00 $1,600.00 Door frames Prep and paint 27 door frames. This includes the frames that have side or top windows in them. 125$ per frame 27 $110.00 $2,970.00 Window frames Prep and paint 5 small window frames in the south wing and 4 large window frames to the council chambers. 75$ per frame 9 $70.00 $630.00 Includes: Paint, Materials, & Labor 1 $0.00 $0.00 Grand Total (USD):$32,800.00We proudly use quality Sherwin Williams products. Page 69 of 899 Page 70 of 899 Date: 10/6/2025 Contract for Lakeville Area Art Center Boiler Replacement Proposed Action Staff recommends adoption of the following motion: Move to approve a contract with Faribo Plumbing and Heating Inc. for the replacement of two snow melt boilers. Overview The Lakeville Area Art Center has two snow melt boilers that serve the paver entrance to the theater. Recently, one of the boilers developed an unrepairable leak in the heat exchanger and is no longer functional. Due to the age of the equipment, staff is proposing the replacement of both boilers with two new high-efficiency units to ensure reliable operation and improved energy performance. Supporting Information 1. Contract with Faribo Plumbing and Heating 2. Quote from Faribo Plumbing and Heating 3. Quote from Archer Mechanical Financial Impact: $22,500 Budgeted: Yes Source: Building Fund 4000.4014.6280 Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Tom Breeggemann Facility Supervisor Page 71 of 899 215047v2 1 NON-BID CONTRACT FOR PURCHASE OF GOODS AND SERVICES AGREEMENT made this 6th day of October, 2025, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation ("City") and FARIBO PLUMBING & HEATING, INC. a Minnesota corporation (“Contractor”). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents,” all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement. B. Contractor’s Quote dated September 16th , 2025 (Exhibit A) C. Initial Contractor Verification of Compliance (Exhibit B) In the event of a conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts. Contract Document “A” has the first priority and Contract Document “C” has the last priority. 2. CONTRACTOR OBLIGATIONS. The Contractor shall provide the goods, services and perform the work in accordance with the Contract Documents for the replacement of two boilers at the Lakeville Area Arts Center. Contractor shall remove existing boilers and replace with condensing boilers, install a bypass filter, and condensate piping. Contractor shall provide all personnel, supervision, services, materials, tools, equipment and supplies and do all things necessary and ancillary thereto specified in the Contract Documents. This contract may be terminated by the City at any time upon discovery by the City that the Contractor or any of its subcontractors has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn. Stat. § 16C.285, Subdivision 3, the Responsible Contractor statute. 3. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. C. Contractor has given City written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by City is acceptable to Contractor. D. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. Page 72 of 899 215047v2 2 4. COMPENSATION. Contractor shall be paid by the City for the goods and services described in exhibit A, but not to exceed: twenty-two thousand, five hundred dollars and zero cents. ($22,500.00) which is inclusive of reimbursable expenses. The fee shall not be adjusted even if the estimated number of hours to perform a task, or any other estimate, assumption or matter is wrong or exceeded. Payment shall be made periodically after a service has been completed and within thirty- five (35) days of receipt of an invoice. 5. COMPLETION DATE. The Contractor shall complete the Work on or before November 21st 2025. 6. WARRANTY. The Contractor guarantees that all warranties as specified in the Quote shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship. In addition to the warranties required in the specifications the Contractor provides the following warranties. The Contractor is responsible for any and all defects in workmanship and materials and upon notification by the City shall immediately replace or repair the defective workmanship and materials without cost to the City. The Contractor warrants that only new unused materials will be used. The Contractor further warrants to the City that all materials and services furnished under the Contract will be in conformance with Contract Documents and that the goods are of merchantable quality and are fit for the use for which they are sold. These warranties are in addition to any manufacturer's standard warranty, and any warranty provided by law. 7. RIGHTS AND REMEDIES. A. The duties and obligations imposed by the Contract Documents, and the rights and remedies available thereunder shall be in addition to, and not a limitation of, any duties, obligations, rights and remedies otherwise imposed or available by law. B. No action, or failure to act, by the City or the Contractor shall constitute a waiver of any right or duty afforded any of them under the Contract, nor shall any such action or failure to act constitute an approval of, or acquiescence in, any breach there under, except as may be specifically agreed in writing. 8. INSPECTION AT DELIVERY. At the point of delivery, the City will have the right inspect the goods for compliance with the Contract Documents prior to installation. As the result of the inspection, the City will: A. Accept the goods subject to an inspection report requiring correction; or B. Refuse to make payment until corrections are complete. 9. CHANGES TO WORK. Without invalidating the Contract, the City may, at any time, or from time to time, order additions, deletions or revisions in the work provided under this Agreement; these will be authorized by an amendment to the Contract. Upon approval of an amendment, Contractor shall proceed with the work provided under the amendment. Changes in the Contract Price shall be based upon the prices identified in the Quote provided or negotiated between the parties based on similar work provided in the Proposal. Page 73 of 899 215047v2 3 10. UNAUTHORIZED WORK. Additional work performed without authorization of an amendment of this Contract will not entitle Contractor to an increase in the Compensation or an extension of the Contract. 11. DOCUMENTS. The City shall be the owner of all documents, reports, studies, analysis and the like prepared by the Contractor in conjunction with this contract. 12. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Contractor shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of goods and services to be provided. 13. STANDARD OF CARE. Contractor shall exercise the same degrees of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional Contractor under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Contractor’s services. 14. INDEMNIFICATION. To the fullest extent permitted by law, Contractor agrees to defend, indemnify and hold harmless the City, and its employees, officials, and agents from and against all claims, actions, damages, losses and expenses, including reasonable attorney fees, arising out of Contractor’s negligence or its performance or failure to perform its obligations under this Contract. Contractor’s indemnification obligation shall apply to subcontractor(s), or anyone directly or indirectly employed or hired by Contractor, or anyone for whose acts Contractor may be liable. Contractor agrees this indemnity obligation shall survive the completion or termination of this Contract. 15. INSURANCE. Prior to the start of the project, Contractor shall furnish to the City a certificate of insurance showing proof of the required insurance required under this Paragraph. Contractor shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, such insurance as shall protect Contractor and the City for work covered by the Contract including workers’ compensation claims and property damage, bodily and personal injury which may arise from operations under this Contract, whether such operations are by Contractor or anyone directly or indirectly employed by either of them. The minimum amounts of insurance shall be as follows: Commercial General Liability (or in combination with an umbrella policy) $2,000,000 Each Occurrence $2,000,000 Products/Completed Operations Aggregate $2,000,000 Annual Aggregate The following coverages shall be included: Premises and Operations Bodily Injury and Property Damage Personal and Advertising Injury Blanket Contractual Liability Products and Completed Operations Liability Automobile Liability $2,000,000 Combined Single Limit – Bodily Injury & Property Damage Including Owned, Hired & Non-Owned Automobiles Page 74 of 899 215047v2 4 Workers Compensation Workers’ Compensation insurance in accordance with the statutory requirements of the State of Minnesota, including Employer’s Liability with minimum limits are as follows: $500,000 – Bodily Injury by Disease per employee $500,000 – Bodily Injury by Disease aggregate $500,000 – Bodily Injury by Accident The Contractor’s insurance must be “Primary and Non-Contributory”. All insurance policies (or riders) required by this Contract shall be (i) taken out by and maintained with responsible insurance companies organized under the laws of one of the states of the United States and qualified to do business in the State of Minnesota, (ii) shall name the City, its employees and agents as additional insureds (CGL and umbrella only) by endorsement which shall be filed with the City. A copy of the endorsement must be submitted with the certificate of insurance. Contractor’s policies and Certificate of Insurance shall contain a provision that coverage afforded under the policies shall not be cancelled without at least thirty (30) days’ advanced written notice to the City, or ten (10) days’ notice for non-payment of premium. An Umbrella or Excess Liability insurance policy may be used to supplement Contractor’s policy limits on a follow-form basis to satisfy the full policy limits required by this Contract. 16. INDEPENDENT CONTRACTOR. The City hereby retains the Contractor as an independent contractor upon the terms and conditions set forth in this Agreement. The Contractor is not an employee of the City and is free to contract with other entities as provided herein. Contractor shall be responsible for selecting the means and methods of performing the work. Contractor shall furnish any and all supplies, equipment, and incidentals necessary for Contractor's performance under this Agreement. City and Contractor agree that Contractor shall not at any time or in any manner represent that Contractor or any of Contractor's agents or employees are in any manner agents or employees of the City. Contractor shall be exclusively responsible under this Agreement for Contractor's own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 17. SUBCONTRACTORS. Contractor shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Contractor shall comply with Minnesota Statute § 471.425. Contractor must pay Subcontractor for all undisputed services provided by Subcontractor within ten days of Contractor’s receipt of payment from City. Contractor must pay interest of 1.5 percent per month or any part of a month to Subcontractor on any undisputed amount not paid on time to Subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100 or more is $10. 18. ASSIGNMENT. Neither party shall assign this Agreement, nor any interest arising herein, without the written consent of the other party. 19. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. Page 75 of 899 215047v2 5 20. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 21. CONTROLLING LAW. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. 22. COPYRIGHT. Contractor shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. 23. RECORDS/AUDIT. The Contractor shall maintain complete and accurate records of time and expense involved in the performance of services. Pursuant to Minnesota Statutes § 16C.05, Subd. 5, any books, records, documents, and accounting procedures and practices of City and Contractor relevant to the Agreement are subject to examination by City and Contactor, and either the Legislative Auditor or the State Auditor as appropriate. City and Contractor agree to maintain these records for a period of six years from the date of performance of all services covered under this Agreement. 24. MINNESOTA GOVERNMENT DATA PRACTICES ACT. Contractor must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to (1) all data provided by the City pursuant to this Agreement, and (2) all data, created, collected, received, stored, used, maintained, or disseminated by the Contractor pursuant to this Agreement. Contractor is subject to all the provisions of the Minnesota Government Data Practices Act, including but not limited to the civil remedies of Minnesota Statutes Section 13.08, as if it were a government entity. In the event Contractor receives a request to release data, Contractor must immediately notify City. City will give Contractor instructions concerning the release of the data to the requesting party before the data is released. Contractor agrees to defend, indemnify, and hold City, its officials, officers, agents, employees, and volunteers harmless from any claims resulting from Contractor’s officers’, agents’, city’s, partners’, employees’, volunteers’, assignees’ or subcontractors’ unlawful disclosure and/or use of protected data. The terms of this paragraph shall survive the cancellation or termination of this Agreement. 25. TERMINATION. This Agreement may be terminated by City on two (2) days’ written notice delivered to Contractor at the address on file with the City. Upon termination under this provision if there is no fault of the Contractor, the Contractor shall be paid for goods and services rendered and reimbursable expenses until the effective date of termination. If the City terminates the Agreement because the Contractor has failed to perform in accordance with this Agreement, no further payment shall be made to the Contractor, and the City may retain another Contractor to undertake or complete the work identified in this Agreement. Page 76 of 899 215047v2 6 Dated: October 6th , 2025 CITY OF LAKEVILLE By: Luke M. Hellier, Mayor And: Ann Orlofsky, City Clerk Dated: October 6th, 2025 FARIBO PLUMBING & HEATING INC. By: Print Name:_________________________________ Its:________________________________________ Page 77 of 899 Page 78 of 899 1614 Cliff Road E. Burnsville, MN - 952-894-2323 - Archermechanical.com – Subsidiary of REMOVE/REPLACE 2 SNOW MELT BOILERS AT ART CENTER, LAKEVILLE Proposal # JCC 25-2809 To: Tom Breeggemann City of Lakeville. (952) 224-6219 tbreeggemann@lakevillemn.gov Date: 9-22-2025 Scope: Remove/replace boilers (2) serving Ice Melt. Proposal is based on using existing inground piping, hot water circulating pump, expansion tank, valves, controls and air eliminating devices. Glycol to be supplied by City of Lakeville. Included: − Boilers (2) o Viessmann (200-W) o 199,000 MBH input o Natural gas − Regulators (2) − Vent/combustion air o Vent from boilers to go in existing vent space to roof o Use existing combustion air − Gas pipe o Connect existing main gas pipe located in mechanical room to boilers − Permits and inspections − Labor − Disposal of existing boilers Not included: − Additional repairs found while performing tasks listed above − Balancing − Bond costs − Overtime hours − Temporary heat, power, lighting, water, toilet, etc. − Painting or other general construction items − Electrical work − Abatement of Hazardous Materials − Cost increase caused by manufacture − Glycol − Electrical Page 79 of 899 1614 Cliff Road E. Burnsville, MN - 952-894-2323 - Archermechanical.com – Subsidiary of REMOVE/REPLACE SNOW MELT BOILERS AT ART CENTER, LAKEVILLE Proposal # JCC 25-2809 WORK IS GUARANTEED TO BE AS SPECIFIED. ALL WORK IS TO BE COMPLETED IN A WORKMANLIKE MANNER. ANY ALTERATION OR DEVIATION FROM ABOVE SPECIFICATIONS INVOLVING EXTRA COSTS WILL BE EXECUTED ONLY UPON WRITTEN ORDERS AND WILL BECOME AN EXTRA CHARGE OVER AND ABOVE THE ESTIMATE. ALL AGREEMENTS ARE CONTINGENT UPON STRIKES, ACCIDENTS OR DELAYS BEYOND OUR CONTROL. OWNER TO CARRY FIRE, TORNADO AND OTHER NECESSARY INSURANCE. ARCHER EMPLOYEES ARE FULLY COVERED BY WORKMEN’S COMPENSATION INSURANCE. Price………………………………………………………………………………. $54,671.00 Archer Mechanical may withdraw Proposal if not accepted within 30 days and work does not start within 90 days. Payment: Final Payment will be made at the time of job completion as outlined in the specifications listed above Acceptance of Proposal: The prices, specifications and conditions are satisfactory and are hereby accepted. You are authorized to do the work as specified. Payment will be made as outlined above. Customers Signature_____________________________________Date_________________ Upon acceptance sign, date and return to Archer Mechanical LLC. Respectfully submitted by, Jason Chelmo Archer Mechanical 952-894-2323 office Page 80 of 899 Date: 10/6/2025 Authorize Funding and Approve Landscaping Services with Friedges Landscaping for Avonlea 4th Addition and Avonlea 5th Addition Proposed Action Staff recommends adoption of the following motion: Move to authorize funding and approve landscaping services with Friedges Landscaping for Avonlea 4th and 5th Additions. Overview The developer of Avonlea 4th Addition and Avonlea 5th Addition requested that the City complete the remaining required public improvements associated with the developments. The remaining work includes planting buffer landscaping, trees and shrubs that were either missed during the original installation or have since died and require replacement. To bring the site into compliance with the approved landscaping plan, 98 buffer shrubs along 185th Street and 28 replacement or missing trees throughout the site must be planted. The work will be funded 100% by an escrow provided by the developer. Supporting Information 1. Planting Quote for Avonlea 4th and 5th Addtions Financial Impact: $23,000 Budgeted: Yes Source: Escrow Envision Lakeville Community Values: Design that Connects the Community Report Completed by: Alanna Sobottka, Civil Engineer Page 81 of 899 City of Lakeville - Forestry Development Planting - Fall 2025 Avonlea Scientific Name Common Name Quantity Stock Per Tree Cost Quote Acer x freemanii 'Sienna'Maple, Freeman - Sienna Glen 4 2.5" B&B Celtis occidentalis Hackberry, Northern 2 2.5" B&B Larix Laricina American Larch 2 5' HT. Malus 'Starlite'Crabapple - Starlite 2 2" B&B Picea glauca var. densata Black Hills Spruce 3 6' HT. Pinus strobus White Pine 2 6' HT. Populus tremuloides Quaking Aspen 8 1.5" CONT. Quercus bicolor Oak, Swamp White 1 2.5" B&B 4 2.5" B&B Viburnum trilobum 'J.N. Select' Redwing Cranberry Viburnum 32 36" HT.,POT Amelanchier alnigolia 'Regent'Regent Serviceberry 66 36" HT.,POT SUB-TOTAL: Fall Tree Planting - B&B Nursery Stock and Container Planting to include a 3-4 foot diameter, 3 inch deep mulch ring around each tree per the mulching specifications. $590.00 Quercus bicolor Oak, Swamp White $570.00 $405.00 $520.00 $530.00 $520.00 $400.00 $600.00 $600.00 $90.00 $90.00 $2,360.00 $1,140.00 $810.00 $1,040.00 $1,590.00 $1,040.00 $3,200.00 $600.00 $2,400.00 $2,880.00 $5,940.00 $23,000.00 Mayor City ClerkDate Date Page 82 of 899 Date: 10/6/2025 Professional Services Supplemental Agreement to Repaint the Water Tower in the Dakota Heights Neighborhood Proposed Action Staff recommends adoption of the following motion: Move to approve a professional services supplemental agreement with SEH, Inc for repainting the water tower in the Dakotak Heights neighborhood. Overview The 2-million-gallon water tower in the Dakota Heights neighborhood, constructed in 1975, is in need of a complete repainting. The tank was last inspected in 2024, with many sections of the coating found to be in poor condition. Flash rust is visible on the exterior, and corrosion is occurring on the interior roof rafters and weld seams. In 2012, limited repainting repairs were performed to extend the life of the existing coating. However, those improvements were only intended as a temporary measure until a full repainting could be completed. The proposed project will remove the existing coatings and fully repaint both the exterior and interior of the tank, along with other miscellaneous improvements. SEH, Inc. has submitted a proposal outlining the scope of services and estimated costs for final design preparation, bidding, and construction observation and administration, in accordance with the City’s 2024 Professional Services Agreement. The project is scheduled to go out for bids in January, with construction anticipated to begin in late July 2026. Supporting Information 1. Supplemental Agreement Financial Impact: $99,640 Budgeted: Yes Source: Water Fund Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Paul Oehme, Public Works Director Page 83 of 899 Short Elliott Hendrickson Inc. Letter Agreement - 1 City of Lakeville Affirmative Action, Equal Opportunity Employer (Rev. 05.29.25) Supplemental Letter Agreement In accordance with the Master Agreement for Professional Services between City of Lakeville (“Client”), and Short Elliott Hendrickson Inc. (“Consultant”), effective September 16, 2024, this Supplemental Letter Agreement dated September 22, 2025 authorizes and describes the scope, schedule, and payment conditions for Consultant’s work on the Project described as: City of Lakeville – Dakota Heights 2 MG Ground Storage Tank Rehabilitation & Holyoke/Downtown Maintenance. Client’s Authorized Representative: Mr. Paul Oehme, PE Address: 18400 Ipava Avenue, Lakeville, MN 55044 Telephone: 952.985.2700 email: poehme@lakevillemn.gov Project Manager: Brad Sipe Address: 3535 Vadnais Center Drive, St. Paul, Minnesota 55110 Telephone: 6517652955 email: bsipe@sehinc.com Scope: The Services to be provided by Consultant: See attached letter Schedule: See attached letter Payment: See attached letter The payment method, basis, frequency and other special conditions are set forth in attached Exhibit A-1. Other Terms and Conditions: Other or additional terms contrary to the Master Agreement for Professional Services that apply solely to this project as specifically agreed to by signature of the Parties and set forth herein: None. Short Elliott Hendrickson Inc. City of Lakeville By: [[DocuSignSignature_1]] By: [[DocuSignSignature_2]] Full Name: Miles Jensen Full Name: Luke M. Hellier Title: Client Service Manager Title: Mayor Attest:__________________________________ __________________________________Ann Orlofsky, City Clerk Page 84 of 899 Short Elliott Hendrickson Inc. Letter Agreement - 2 City of Lakeville (Rev. 05.29.25) Exhibit A-1 Payments to Consultant for Services and Expenses Using the Hourly Basis Option The Agreement for Professional Services is amended and supplemented to include the following agreement of the parties: A. Hourly Basis Option The Client and Consultant select the hourly basis for payment for services provided by Consultant. Consultant shall be compensated monthly. Monthly charges for services shall be based on Consultant’s current billing rates for applicable employees plus charges for expenses and equipment. Consultant will provide an estimate of the costs for services in this Agreement. It is agreed that after 90% of the estimated compensation has been earned and if it appears that completion of the services cannot be accomplished within the remaining 10% of the estimated compensation, Consultant will notify the Client and confer with representatives of the Client to determine the basis for completing the work. Compensation to Consultant based on the rates is conditioned on completion of the work within the effective period of the rates. Should the time required to complete the work be extended beyond this period, the rates shall be appropriately adjusted. B. Expenses The following items involve expenditures made by Consultant employees or professional consultants on behalf of the Client. Their costs are not included in the hourly charges made for services but instead are reimbursable expenses required in addition to hourly charges for services and shall be paid for as described in this Agreement: 1. Transportation and travel expenses. 2. Long distance services, dedicated data and communication services, teleconferences, Project Web sites, and extranets. 3. Lodging and meal expense connected with the Project. 4. Fees paid, in the name of the Client, for securing approval of authorities having jurisdiction over the Project. 5. Plots, Reports, plan and specification reproduction expenses. 6. Postage, handling and delivery. 7. Expense of overtime work requiring higher than regular rates, if authorized in advance by the Client. 8. Renderings, models, mock-ups, professional photography, and presentation materials requested by the Client. 9. All taxes levied on professional services and on reimbursable expenses. 10. Other special expenses required in connection with the Project. 11. The cost of special consultants or technical services as required. The cost of subconsultant services shall include actual expenditure plus 10% markup for the cost of administration and insurance. The Client shall pay Consultant monthly for expenses. C. Equipment Utilization The utilization of specialized equipment, including automation equipment, is recognized as benefiting the Client. The Client, therefore, agrees to pay the cost for the use of such specialized equipment on the project. Consultant invoices to the Client will contain detailed information regarding the use of specialized equipment on the project and charges will be based on the standard rates for the equipment published by Consultant. The Client shall pay Consultant monthly for equipment utilization. Page 85 of 899 Engineers | Architects | Planners | Scientists Short Elliott Hendrickson Inc., 3535 Vadnais Center Drive, St. Paul, MN 55110-3507 651.490.2000 | 800.325.2055 | 888.908.8166 fax | sehinc.com SEH is 100% employee-owned | Affirmative Action–Equal Opportunity Employer September 22, 2025 RE: Dakota Heights 2 MG Ground Storage Tank Rehabilitation & Holyoke/Downtown Maintenance Lakeville, Minnesota SEH No. LAKEV 187626 14.00 Mr. Paul Oehme, PE Public Works Director City of Lakeville 18400 Ipava Avenue Lakeville, MN 55044 Dear Mr. Oehme: As per your request, the City of Lakeville is in need of full-service design, inspection and contract administration services for the reconditioning of the City’s elevated 2,00,000-gallon ground storage tank located at 17985 Jacquard Path Lakeville MN with Maintenance being completed at the Holyoke and Downtown Tanks. Short Elliott Hendrickson Inc. (SEH®) appreciates the opportunity to submit a proposal for providing these services. This proposal includes our project understanding, project team, project approach, schedule, scope of services, project fees, and benefits to the City of Lakeville. PROJECT UNDERSTANDING SEH had discussions with staff to determine the City’s directives in relation to the maintenance and long- term service of this facility. The discussions with the City were used to determine the approach for this project to meet the City’s scope. After reviewing the information provided and recommendations, we understand your project expectations, the work required for these facilities, and the staffing and scheduling needs necessary for a successful project outcome. PROJECT TEAM Our team’s many advantages include extensive water tank construction and coatings inspection experience, as well as being one of the few Minnesota engineering consultants with an in-house protective coatings’ management staff. This industry expertise has been recognized by the American Council of Engineering Companies (ACEC) with numerous water tank design and rehabilitation awards over our more than 80 years of water storage tank experience. All proposed services will be completed by SEH with our own personnel. Page 86 of 899 Mr. Paul Oehme, PE September 22, 2025 Page 2 Brad Sipe will be the Project Manager for this City of Lakeville project and is a NACE Certified Coating Inspector – Level 3. With a career in protective coatings beginning in 2011, Brad has more than 14 years of contractor experience specializing in project management involving protective coatings and rehabilitation projects. Brad’s previous experience working for rehabilitation contractors arms him with unique knowledge for protective coatings projects. This knowledge assists with contractor scheduling and logistics, foresight of project complications to reduce or eliminate potential change orders prior to the bid phase and contract work, and the level of critical inspection required to successfully complete a project while providing value to the owner in the reduction of overall cost. Simon McCormak, PE, will serve as project engineer and has more than 14 years of experience in water distribution planning and specification development for water storage reconditioning. With respect to project inspection, SEH will provide the City with a NACE Certified inspector working under the direct supervision of the project manager. SEH staff have training to be working under the direct supervision of a structural engineer and/or Certified Welding Inspector (CWI), as applicable to the final project scope. Additional team members include coatings expert Jeff Joseph and James Coyle with a combined experience of more than 25 years in the protective coatings industry. PROJECT APPROACH SEH will work directly with the City staff to implement the recommendations required to recondition this facility. The scope of work, is as follows:  Exterior Repairs and Modifications  Clean out the existing overflow pipe at the discharge and replace the screen with a corrosion resistant 3/8” or smaller mesh screen, or flap valve  Remove and replace the neoprene gasket and bands covering the gap between the access tube and tank roof  Remove loose, cracked, and spalled grout under the column as noted; repair using non-shrink 3000 psi grout or elastomeric sealant as applicable  Interior Repairs and Modifications  Remove rail style safety climbs and install cable style safety climbs on the interior dry ladders  Add interior wet mixer and control panel  Coating Rehabilitation  All steel exterior surfaces should be prepared to an SSPC SP-6 or equal “Commercial Blast” level of cleanliness. This should be followed by a zinc/polyamide-epoxy/acrylic-polyurethane coating system. To avoid fugitive dust emissions and/or paint drift, a full-containment structure will need to be constructed. No logo shall be applied to this tank at the request of the owner.  Lower Concrete Pedestal of the tank should be prepared to an SSPC SP-13 or equal “Concrete Surface Preparation” CSP 3 to 5 level of cleanliness. This should be followed by a polyamide- epoxy/acrylic-polyurethane coating system.  All Interior wet surfaces should be prepared to an SSPC SP-10 “Near-White Metal Blast Cleaning” standard of cleanliness. After cleaning, exposed surfaces should be painted with three- coats of a compatible zinc/epoxy-polyamide system meeting standard NSF 600. Page 87 of 899 Mr. Paul Oehme, PE September 22, 2025 Page 3  Holyoke Tank & Downtown Tank  Interior Repairs and Modifications o Add interior wet mixer and control panel  Coating Rehabilitation o All Interior wet damaged surfaces should be prepared to an SSPC SP-7 “Brush-off Blast Cleaning” standard of cleanliness. After cleaning, exposed surfaces should be painted with two-coats of a compatible epoxy/epoxy-polyamide system meeting standard NSF 61/600. SEH is aware of the costs in completing a reconditioning project, both through on-going reconditioning projects within the region and through our project manager’s past contractor work experience. Today’s coating systems are formulated to last 20 to 25 years with periodic maintenance. The success of the project starts with attention to the initial preparation of the surface and application of the coating system, which is why inspection of the work becomes so important. Finally, SEH will incorporate provisions into the specification requiring a two-year contractor warranty for this facility. This proposal includes services for conducting the warranty inspection. PROJECT SCHEDULE Upon your authorization, SEH is ready to proceed. The overall project schedule is based on the City’s ability to remove these facilities from service independently without detriment to its water distribution system or residents. As identified above, a formal timing of the project will be confirmed with City staff at the initiation meeting. Aside from scheduling issues specific to demands on water distribution, ambient conditions needed for proper coating application and cure are required. Therefore, our schedule will take into consideration timing, sequencing of operations, and product selection. Event Date Consultant Selection October 2025 Submit Draft Plans/Specifications for City Review 4 Weeks from notification to Begin Advertise for Bids January 2026 Bid Opening February 2026 Project Award 2 Weeks from Bid Opening Preconstruction Meeting 2 Weeks prior to Project Commencement Early Project Commencement* July 20, 2026 Late Project Completion (Substantial)* September 31, 2026 *Project schedule dates are flexible to meet the demands of the City for these facilities and will be finalized based on when the water tower may be taken out of service for the Eleven (11) week contract duration, however we recommend completing the design and bidding phases as soon as practical to capitalize on current market pricing. Project completion is scheduled allowing sufficient time to complete the project within the 2026 construction seasons in the event of unforeseen delays. Page 88 of 899 Mr. Paul Oehme, PE September 22, 2025 Page 4 SCOPE OF SERVICES I. Design Services The work tasks and deliverables for this section shall include:  Pre-Design  Meet to review recommendations with the City to review scope  Establish overall project requirements and objectives related to contractor procurement and schedule  Specifications and Contract Documents  Prepare contract documents, drawings, and specifications, including both general conditions (where required) and technical sections as related to facility surface preparation and coating application (Specifying systems in accordance with AWWA D102), and structural modifications.  Meet (1) with City staff to review plans and specifications  Submit final contract documents to the City for review and approval  Prepare final engineer’s estimate and schedule based on the final plans  Provide permit application and specification to the Minnesota Department of Health *Permitting fee(s) reimbursed by the City (included in budget) II. Construction Services The work tasks and deliverables for this section shall include: From Previous experience it was said that the City would complete the Bidding and advertising.  Bidding Administration  Provide response to bidder questions  Issue addenda, as applicable  Review bids and prepare letter of award recommendation to the City Council III. Contract Administration The work tasks and deliverables for this section shall include:  Construction Administration  Coordinate and facilitate a pre-construction meeting and subsequent meeting minutes  Perform periodic on-site reviews of project work and provide status reports to the City  Coordinate and facilitate on-site progress meetings  Prepare monthly pay request forms for City approval Prepare change orders, as required  Prepare letter of final review and acceptance in coordination with the on-site inspector  Review submittals and other pertinent documentation associated with the plans/specifications o Shop drawing review o Welder qualifications/certifications/procedures o Coating materials o TCLP sampling plan o Spent material collection and disposal Page 89 of 899 Mr. Paul Oehme, PE September 22, 2025 Page 5 IV. Construction Observations The work tasks and deliverables for this section shall include:  Construction Observation/Inspections Inspection and record keeping for surface preparation and coatings will be provided by a NACE Certified Coatings Inspector. Inspection and record keeping for welding work will be conducted by a Certified Welding inspector (CWI) and/or an inspector trained to be working under the direct supervision of a structural engineer or CWI. Daily records of construction activities of both the prime contractor and their subcontractors will be kept. SEH proposes to provide *critical inspection services for this project as outlined below and assumes a six-day contractor work week and project duration of Eleven (11) weeks (limited to reconditioning operations). *Critical inspection places an emphasis of observation time on operations related to surface preparation and prime-coat application. Inspections outside these operations are intended to be coordinated in cooperation with contractor, or at the City’s request. PROPOSED CONSTRUCTION OBSERVATION EFFORT Operation Week Estimated Inspection Hours Mobilization 1 8 Repairs/Modifications 2 20 Surface Preparation and Prime Coat Application 3-6 180 Intermediate Coat Application 7 60 Finish Coat Application 8-9 90 Site Restoration/Punch-List/Disinfection 9-10 40 Holyoke & Downtown Repairs 11-12 60 Total* 458 *Inspection time includes travel and reports, in addition to time spent on site. In circumstances where the Contractor requires additional inspection hours outside of specified working times SEH specifications place the responsibility of additional inspection fees on the Contractor to reduce costs incurred by the City.  During the project, SEH will perform the following tasks:  Inspect structural repairs and modifications for conformance to the specifications  Monitor field operations and testing in accordance with the specifications, manufacturer recommendations, and government regulations as related to: o Surface preparation materials and equipment o Surface preparation operations inclusive of paint removal and approval of samples o Coating application materials and equipment o Coating operations inclusive of mixing and application  Prepare and file copies of reports on the construction activities  Work directly with residents and property owners, responding to construction related issues  Participate in regularly scheduled on-site meeting with City staff during active work periods and prepare a written update including applicable updating progress for public notification(s)  Prepare punch list at substantial completion Page 90 of 899 Mr. Paul Oehme, PE September 22, 2025 Page 6  Assist the City with coordination of facility disinfection and testing (contractor initiated)  Prepare final inspection letter to the contractor  Final Review  Conduct a final project review verifying completion of punch list items with contractor  Prepare Engineer’s recommendation of project final completion  Provide City with As-Built record drawings of the project (electronic format) V. Warranty Inspection The deliverables and work tasks for a two-year warranty inspection in accordance with this section of the proposed specification shall include:  Contacting the City approximately six months prior to the expiration date to verify our proceeding with contracted operations  Coordinating with the City and SEH (the “ROV” method is proposed for interior investigation) the schedule for the inspection  SEH notifying the contractor of the inspection date Upon completion, a letter will be sent to the City and the contractor informing each party of the inspection results and recommended repairs and requesting scheduling any follow up work with the City. SEH will rely on the City for access and operation of their facility as needed for completing the above operations. Our fee does not include any necessary inspection of warranty repairs resulting from the above Warranty assessment. The City will be billed for the Warranty inspection following submission of the SEH result letter. PROPOSED COST OF ENGINEERING SERVICES SEH proposes to complete Tasks I-V, identified under Design Services, Bidding Administration, Contract Administration, Construction Observation/Inspection Services and Warranty Inspection on an Hourly, Not- to-Exceed basis for the fee of $99,640.00. The breakdown of fees is to be considered as hourly, but also transferrable between Tasks as may be needed to complete the project scope in its entirety as described herein. We understand this total value of proposal cannot increase without further authorization from you. Task Amount 1. Pre-design and Construction Document Preparation $8,900 2. Bidding Administration $2,400.00 3. Contract Administration $16,840.00 4. Construction Observation/Inspection Services $59,000.00 5. Warranty Inspection – 2 Year $3,500.00 6. Holyoke & Downtown Maintenance Inspections $9,000.00 TOTAL COST $99,640.00 Page 91 of 899 Mr. Paul Oehme, PE September 22, 2025 Page 7 CLOSURE We want to thank you for the opportunity to provide the City of Lakeville with this proposal. As always, it is very important to us our services continue to meet and surpass your needs and expectations. After you have had an opportunity to review this proposal, we would like to hear any comments, concerns, or questions you may have. If this letter satisfactorily sets forth your understanding of our agreement, please sign the enclosed copy of this letter in the space provided below and return one copy to us. If you have any questions or would like to discuss this proposal in greater detail, please contact me at your convenience at 615.613.3880, or contact Miles Jensen, our Client Service Manager at 218.343.0260. We look forward to working with you on this project. Sincerely, SHORT ELLIOTT HENDRICKSON INC. Brad Sipe, NACE Miles Jensen Protective Coatings Manager Client Service Manager (Lic. AZ, CO, IA, IL, IN, KS, MD, MI, MO, MN, ND, NE, NM, OH, SD, TX, VA, WI) dmk Attachment https://sehincazure-my.sharepoint.com/personal/dkoontz_sehinc_com/documents/dkoontz/brad sipe/lakeville holyoke tank maintenance proposal 091925.docx Page 92 of 899 Date: 10/6/2025 Lease Agreement for Storage of Public Works Equipment Proposed Action Staff recommends adoption of the following motion: Move to approve lease agreement for public works seasonal equipment Overview In 2025, the Streets and Parks Divisions began storing seasonal equipment at a leased facility following the demolition of the old Public Works building to make way for the FiRST Center. Summer vehicles and equipment, such as mowers and street sweepers, are stored during the winter months, while winter equipment, such as plow vehicles and plow attachments, is stored during the summer months. Temporary storage space is needed until a permanent solution is identified. The City leased space on Hamburg Avenue in 2025 for this purpose. Staff is requesting to lease the same space again in 2026 under the same terms and with 3% increase in the rent from the 2025 agreement. Supporting Information 1. 2026 Lease Agreement Financial Impact: $10,215/month Budgeted: Yes Source: Street Division Budget Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Paul Oehme, Public Works Director Page 93 of 899 Page 94 of 899 Page 95 of 899 Page 96 of 899 Page 97 of 899 Page 98 of 899 Date: 10/6/2025 Authorize Early Decertification of TIF 22 and Return Excess Tax Increment Funds to Dakota County Proposed Action Staff recommends adoption of the following motion: Move to approve Resolution: 1) Approving TIF #22 for early decertification on or before December 31, 2025; and 2) Approving excess tax increment to be returned to Dakota County for redistribution. Overview TIF District #22, Launch Park, was created in April 2017 to facilitate the expansion of private development, to maintain and increase employment, and to increase the tax base. The TIF Plan included a TIF PayGo note of $1,000,000, which was satisfied after the first half 2025 tax increment payment. Based upon the Office of the State Auditor Five Year and Six Year rules, the City is not allowed to keep the district open and continue to collect increment after the in-district (pay-go) note is satisfied. Therefore, the City needs to request that TIF #22 be decertified as of December 31, 2025. Additionally, excess increment that is not eligible and/or not planned to be used within the project area needs to be returned to Dakota County as excess increment. The City will receive a portion of the tax increment captured back ($141,600) when it is redistributed to the taxing districts, which staff will present potential uses for to the city council at a later date. Supporting Information 1. Resolution - Request Decertification of TIF #22- Launch Financial Impact: $141,600 Budgeted: No Source: Tax Increment revenues Envision Lakeville Community Values: Good Value for Public Service; Diversified Economic Development Report Completed by: Julie Stahl, Finance Director Page 99 of 899 CITY OF LAKEVILLE RESOLUTION No______ Early Decertification of TIF #22 WHEREAS, the Tax Increment Financing (TIF) district #22 for the Launch Park project, included a Tax Increment Revenue Note in the maximum principal amount of $1,000,000, which was repaid in full in July 2025; and WHEREAS, the Office of the State Auditor requires early decertification of a TIF district once pay-go notes are satisfied in order to make the new value of development more quickly available to the tax base; and WHEREAS, the City is obligated to return excess tax increment to the County for redistribution to the School District, County and City. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Lakeville, Minnesota: 1. TIF District #22 is approved for early decertification, on or before December 31. 2025. 2. Excess tax increment to be returned to the County for redistribution. ADOPTED this 6th day of October 2025 by the City Council of the City of Lakeville. CITY OF LAKEVILLE By: ________________________________ Luke M. Hellier, Mayor ATTEST: ________________________________ Ann Orlofsky, City Clerk Page 100 of 899 Date: 10/6/2025 Call Public Hearing Relating to Imposition of Service Charge for Special Services District No.1 Proposed Action Staff recommends adoption of the following motion: Move to approve Resolution Calling a Public Hearing Relating to the Imposition of a Service Charge for Special Service District No. 1 Overview On July 6, 1998, the City Council approved Ordinance 631 establishing a Special Service District No. 1. The Special Service District Advisory Board has not submitted a budget for the period of July 1, 2026 to June 30, 2025. It is anticipated that the Board will request a zero special service charge payable in 2026. The Board has not requested a special service charge for the past seven years (2019 through 2025). The purpose of still holding this hearing is to keep the District active in the event the Board would like to request a special service charge in the future. Approval of the motion will result in a public hearing on November 3, 2025. A notice will be posted in the SunThisweek for the public hearing and mailed/emailed to each business organization subject to a service charge within this district. For consistency purposes with prior years, the resolution being considered for approval contains language as if a service charge would be considered and approved. Minnesota Statute 428A.03 requires that a public hearing must be conducted each calendar year with notices mailed to each business organization subject to the service charge. After the public hearing is conducted, and the resolution is adopted, the amounts will be certified to the Dakota County Treasurer/Auditor for collection with taxes payable in 2026. The Special Service District is subject to Minnesota Statutes 428A and City of Lakeville Ordinance 631. Supporting Information 1. Ordinance 631 2. Resolution Downtown Special Services District - Calling Public Hearing Page 101 of 899 Financial Impact: $TBD Budgeted: No Source: Special Service Charge Levy Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Julie Stahl, Finance Director Page 102 of 899 Page 103 of 899 Page 104 of 899 Page 105 of 899 Page 106 of 899 Page 107 of 899 Page 108 of 899 Page 109 of 899 Page 110 of 899 CITY OF LAKEVILLE RESOLUTION NO. ________ Resolution Calling a Public Hearing Relating to the Imposition of a Service Charge for Special Service District No. 1 WHEREAS, the Downtown Lakeville Business Association will be adopting a proposed budget and requesting the imposition of a service charge to be collected with taxes payable in 2026; and WHEREAS, Minnesota State Statutes require that a public hearing be conducted each calendar year with notices mailed to each business organization subject to the service charge. NOW, THEREFORE, BE IT RESOLVED, by the City Council of Lakeville, Minnesota, that a public hearing will be conducted at 6:00 pm on Monday, November 3, 2025 relating to the proposed budget for the Special Service District No. 1 and imposing a service charge thereon. ADOPTED by the Lakeville City Council this 6th day of October 2025. CITY OF LAKEVILLE By: ________________________________ Luke M. Hellier, Mayor ________________________________ Ann Orlofsky, City Clerk Page 111 of 899 Date: 10/6/2025 Resolution Approving the Selection of the Brazos Citation Software Solution Proposed Action Staff recommends adoption of the following motion: To approve the selection of the Brazos Citation Software Solution in cooperation with the Local Government Information System (LOGIS) Association Overview The Lakeville Police Department partners with LOGIS for many technological needs to carry out various public safety functions and services. One such need is a citation software product. The current product that the police department utilizes, through LOGIS, is APS Ticketwriter. We were informed that this product will no longer be meeting the needs of the LOGIS partner agencies and a new product was identified. The timeline for implementation of the new product, Brazos Citation System, is set for mid-2026. Earlier this year, we were notified that there would be a cost increase for the move to this new product. We had previously budgeted $5,508 for the APS Ticketwriter product as part of our LOGIS package and were informed the 2026 cost for the Brazos system was estimated at $13,886. Based upon that information, we did previously make an $8,000 budget adjustment in our preliminary request submitted to finance to include for fiscal year 2026. The LOGIS governing body is requesting a Council resolution from each agency involved indicating their approval to move forward with the new product. Supporting Information 1. Brazos Resolution 2. Letter of Understanding_Brazos 10.1.25 Financial Impact: $13,886 Budgeted: Yes Source: Patrol Software Subscriptions Envision Lakeville Community Values: Safety Throughout the Community Report Completed by: Brad Paulson, Chief of Police Page 112 of 899 CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. _____ RESOLUTION APPROVING THE SELECTION OF THE BRAZOS CITATION SOFTWARE SOLUTION IN COOPEREATION WITH THE LOCAL GOVERNMENT INFORMATION SYSTEM (LOGIS) ASSOCIATION WHEREAS, the City of Lakeville has identified specific technology needs necessary to carry out various public safety functions and services; and WHEREAS, it has determined that it can best meet those needs by partnering with LOGIS to secure the Brazos citation software solution and support services; and WHEREAS, it has received a formal price quote for the annual costs associated with this initiative as outlined in the attached Letter of Understanding. NOW THEREFORE BE IT RESOLVED by the City Council of the City of Lakeville that this commitment to the Brazos citation software solution is hereby approved and Lakeville Police Chief Bradley Paulson is designated as the Member Representative authorized to execute the Letter of Understanding. ADOPTED this _______ day of October, 2025, by the City Council of the City of Lakeville. CITY OF LAKEVILLE BY: _______________________________ Luke M. Hellier, Mayor ATTEST: ______________________________ Ann Orlofsky, City Clerk Page 113 of 899 Page 1 of 2 Brazos Citation Software Solution Letter of Understanding September 19, 2025 Dear LOGIS Member, This Letter of Understanding is intended to memorialize the members’ decision to authorize LOGIS to enter into a contract with Brazos, a Tyler Technologies company, to acquire access to a new electronic citation software solution on behalf of its members. In prior communications, members were informed that the Brazos solution is being provided to the membership through an annual site-license subscription between Brazos and LOGIS. With the cost of this subscription being proportionally allocated to the members as part of the annual budget process. The site license must be procured prior to beginning the process to migrate members from the legacy system to Brazos. As such, if a member chooses to terminate their participation in the Brazos service offering, they remain responsible for their share of the software licensing that has been secured by LOGIS on their behalf. The following table depicts each member’s share of the 2026 site license as presented at the September 16, 2025, Police Executive Steering Committee meeting: Page 114 of 899 Page 2 of 2 Please note that members should expect annual inflationary-type increases in subsequent calendar years. This Letter of Understanding has been reviewed and approved as indicated below. Christopher K. Miller LOGIS Executive Director Chief Brad Paulson Lakeville Police Department Date: Date: Page 115 of 899 Date: 10/6/2025 Kenyon Green Encroachment Agreement Proposed Action Staff recommends adoption of the following motion: Move to approve an encroachment agreement for a retaining wall. Overview The City Council approved the final plat for Kenyon Green on September 15, 2025. The City owns easements for drainage and utility purposes over portions of the Property. The Owner desires to construct a retaining wall which encroaches on the City’s easement area. The encroachment agreement is required so the City shall have no responsibility to maintain or repair the retaining wall located within the drainage and utility easement area and is not liable for any damage caused to the retaining wall because of it being constructed in the City’s easement. Supporting Information 1. Kenyon Green Encroachment Agreement 2. Kenyon Green Final Plat Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: A Home for All Ages and Stages of Life Report Completed by: Heather Botten, Senior Planner Page 116 of 899 Page 117 of 899 Page 118 of 899 Page 119 of 899 Page 120 of 899 Page 121 of 899 Point ofBeginningThe S Line of the NW 1/4 ofSec. 13, Twp. 114, Rng. 21Dakota County Aluminum MonumentThe SW Corner of the NW 1/4 ofSec. 13 Twp. 114, Rng. 21The W ' l y R / W L i n e o f Tru n k H i g h w a y 3 5 W S e r v i c e R o a d Per P l a t o f P r a i r i e L a k e 1 s t A d d i t i o n and F o u n d M o n u m e n t a t i o nS89°54'54"W 213.63Roadway Easement PerDoc. No. 357734R/W Easement PerDoc. No. 2020602St ree t , U t i l i ty & D ra inage Easemen tPer Doc . No . 1729802SE Corner of OUTLOT A,EMERALD PROFESSIONAL CENTERFound 1/2 Inch Open Iron PipeFound 1/2 InchOpen Iron PipeFound R/W MonumentMonument Falls in RoadwayNo Monument Found or SetMonument Falls in RoadwayNo Monument Found or SetMonument Falls in RoadwayNo Monument Found or SetCenterline of TownRoad (184th Street)Per DescriptionCenterl ine per Doc .No. 1729802Street, Utility & Drainage EasementPer Doc. No. 1729802S64°52'06"E 521.20N58°59'54 "E 256 .0574.94Δ=33°01'41"R=130.00CB=N75°30'44"EC=73.91S2 2 ° 5 0 ' 2 7 " W 3 8 7 . 6 6 127.8 1 Δ=21° 4 5 ' 4 6 " R=33 6 . 4 9S89°54'54"W 585.26Monument Fa l ls in RoadwayNo Monumen t Found o r Se tCente r L ine o f Town Road (184 th S t )Per the P la t o f PRA IR IE LAKE 1ST ADD IT ION (Desc .=357 .25)Portion of Kenyon Ave Dedicated in thePlat of PRAIRIE LAKE 1ST ADDITION(Desc.=585.19)(Meas . ) 355 .65S89°54'54"W 4503.84534 59.00N89°54'53"ES00°05'07"E 114.00S89°54'53"W59.00N00°05'07"W 114.0059.0031.0059.00N89°54'53"E59.0031.0031.00 N89°54'53"E26.0026.00 26.0026.00 31.00 S00°02'41"E 48.6436.00S89°57'19"WS 4 1 ° 1 8 ' 1 8 "W 7 1 . 8 8S89°57'19"W 82.06S66°15'07"W51.32SOUTH 141.36 157.49Δ=26°32'23"R=340.00N64°12'07"W 337.0233.32 S58°14'03 "W 149 .10237.81 14. 6 168.78S89°54'54"W 595.3075.83 Δ=12°54'4 2 " 75.00 78910N64°12'07"W 114.00S64°12'07"E 114.0031.00N25°47'53"E31.00N25°47'53"E59.0026.0026.0059.0026.00N25°47'53"E26.0059.0031.0059.00S25°47'53"W31.0059.00 31.00N2 5 ° 4 7 ' 5 3 " E31.00N25°47'53"E59.00 26.00N2 5 ° 4 7 ' 5 3 " E26.0059. 0 0 26.0026.0059. 0 0 31.0059. 0 0 S2 5 ° 4 7 ' 5 3 " W31.0059. 0 0 1112131415161731.00N25°47'53"E31.0026.00N25°47'53"E26.0059.0031.0059.00S25°47'53"W31.0059.00 S64°12'07"E 114.00N64°12'07"W 114.00S64°12'07"E 88.00N64°12'07"W 88.00S57°17'49"E 83.94S62°02'28"E39.9646.12S50°38'48"EN65°33'21"W 71.29N64°12'07"W10.001BLOCK 1C.S.A.H. NO. 60(185TH STREET WEST)KENYON AVENUEKENYON AVENUEThe East-West 1/4 Line ofSec. 13, Twp. 114, Rng. 21Dakota County Cast Iron MonumentThe E 1/4 Corner of Sec. 13 Twp. 114, Rng. 21Width VariesWid t h V a r i e s Wet LandWet LandDra inage &Ut i l i ty Easemen tDrainage &Utility EasementDrainage &Utility EasementN25°47'53"E N2 5 ° 4 7 ' 5 3 " E N25°47'53"E59.00 11.67S00°05'06"E 181.61S62°07'16"E 75.67S51°56'22"E29.94 S01°17'03"W7.56S34°26'06"E 58.4435.77S37°06'45"ES19°01'00"E19.15S00°05'06"E44.3336.26S18°12'11"WSOUTH23.16150.02445.08OUTLOT A325.35R=340.00Δ=25°40'51"152.39Δ=22°30'37"133.58S10°41'58"E62.45N00°05'06"W 553.40East Line of OUTLOT A,EMERALD PROFESSIONAL CENTER& Its Northerly Extension 478.40 26Drainage &Utility EasementOver All of Lot 223.92 Δ=4°01'47"17.6818.24376.50Δ=8 ° 5 1 ' 0 4 " 51.9 8 503.52N89°57'18"E 96.6941.50 S00°02'42"ES89°57'18"W 120.00S00°02'42"E24.172 3 . 0 98.05(De s c . = 4 2 5 . 2 8 ) (Me a s . ) 4 2 3 . 2 6 (De s c . = S 2 2 ° 5 4 ' 5 4 " W ) 373 . 0 5(Meas.)CB=N77°28'18"WC=156.09(De s c . = 2 1 ° 3 7 ' 4 3 " ) (Me a s . ) 4 2 3 . 2 6 (De s c . = 1 2 7 . 0 2 ) (Meas.) (Meas.)CB=S71°04'29"WC=151.12KENYON GREENNBearings are based on the south line of theNorthwest Quarter of Sec. 13, Twp. 114, Rng. 21having an assumed bearing of S 89°54'54" W.Denotes a Found Iron Monument (Type as shown on plat)Denotes a 1/2 inch by 14 inch Rebar Marked "RLS 44565"Denotes a Dakota County Monument.100255002550SCALE IN FEETKNOW ALL PERSONS BY THESE PRESENTS: That R.E.C., Inc., a Minnesota corporation, fee owner of the following described property:A tract of land in the Northwest Quarter of Section 13, Township 114 North, Range 21 West, Dakota County, Minnesota, described as follows:Beginning at a point in the south line of said Northwest Quarter, 213.63 feet east of the southwest corner thereof; the south line of said NorthwestQuarter has an assumed bearing of North 89 degrees 54 minutes 54 seconds East; thence North 0 degrees 5 minutes 6 seconds West, 553.40 feetto the center line of a town road; thence along said centerline South 64 degrees 52 minutes 6 seconds East, 521.20 feet, thence continue on saidcenterline North 58 degrees 59 minutes 54 seconds East, 357.25 feet, to a point on the westerly right of way line of Trunk Highway 35W serviceroad; thence southerly along said right of way South 22 degrees 54 minutes 54 seconds West, 425.28 feet; thence continue along said right of wayon a curve concave to the east having a central angle of 21 degrees 37 minutes 43 seconds and a radius of 336.49 feet a distance of 127.02 feet toa point on the south line of said Northwest Quarter; thence South 89 degrees 54 minutes 54 seconds West, along said south line, 585.19 feet to thepoint of beginning.Has caused the same to be surveyed and platted as KENYON GREEN and does hereby dedicate to the public, for public use, the public way and the drainage andutility easements as created by this plat.In witness whereof said R.E.C., Inc., a Minnesota corporation, has caused these presents to be signed by its proper officerthis day of , 20.R.E.C., Inc.By:J. Michael Waldo, Chief Executive OfficerSTATE OF , COUNTY OF This instrument was acknowledged before me this day of , 20, by J. Michael Waldo, the ChiefExecutive Officer of R.E.C., Inc., a Minnesota corporation, on behalf of the corporation. My Commission Expires:Notary Public, Signature Notary Public, Printed NameNotary Public County,SURVEYORS CERTIFICATEI Rory L. Synstelien, do hereby certify that this plat was prepared by me or under my direct supervision; that I am a duly Licensed Land Surveyor in the Stateof Minnesota; that this plat is a correct representation of the boundary survey; that all mathematical data and labels are correctly designated on this plat; thatall monuments depicted on this plat have been, or will be correctly set within one year; that all water boundaries and wet lands, as defined in MinnesotaStatutes, Section 505.01, Subd. 3, as of the date of the surveyor's certification are shown and labeled on this plat; and all public ways are shown and labeled onthis plat.Dated this day of , 20.Rory L. Synstelien, Land SurveyorMinnesota License No. 44565STATE OF MINNESOTA, COUNTY OF HENNEPINThis instrument was acknowledged before me this day of , 20, by Rory L. Synstelien, a Licensed Land Surveyor. My Commission Expires:January 31, 20Notary Public, Signature Notary Public, Printed NameNotary Public County, MinnesotaCITY COUNCIL OF LAKEVILLE, COUNTY OF DAKOTA, STATE OF MINNESOTAThis plat was approved by the City Council of Lakeville, Minnesota at a regular meeting thereof held this day of , 20 ,and hereby certifies compliance with all the requirements as set forth in Minnesota Statutes, Section 505.03, Subd. 2.By:, Mayor By: , City ClerkCOUNTY SURVEYOR, COUNTY OF DAKOTA, STATE OF MINNESOTAI hereby certify that in accordance with Minnesota Statutes, Section 505.021, Subd. 11, this plat has been reviewed and approvedthis day of , 20.By Todd B. Tollefson, Dakota County SurveyorCOUNTY BOARD, COUNTY OF DAKOTA, STATE OF MINNESOTAWe do hereby certify that on the 21st day of May, 2024, the Board of Commissioners of Dakota County, Minnesota, approved this plat of KENYON GREEN andsaid plat is in compliance with the provisions of Minnesota Statutes, Section 505.03, Subd. 2, and pursuant to the Dakota County Contiguous Plat Ordinance.By Dakota County Board Chair By Dakota County Treasurer-AuditorDEPARTMENT OF PROPERTY TAXATION AND RECORDS, COUNTY OF DAKOTA, STATE OF MINNESOTAPursuant to Minnesota Statutes, Section 505.021, Subdivision 9, taxes payable in the year on real estate hereinbefore described, have been paid.Also pursuant to Minnesota Statutes, Section 272.12, there are no delinquent taxes and transfers entered onthis day of , 20.By Amy A. Koethe, Director, Department of Property Taxation and RecordsCOUNTY RECORDER, COUNTY OF DAKOTA, STATE OF MINNESOTAI hereby certify that this plat of KENYON GREEN was filed in the office of the County Recorder for public record onthisday of , 20, at o'clockM. andwas duly filed in Bookof Plats, Page, as Document Number .By Amy A. Koethe, County RecorderOFFICIAL PLAT(Desc.) Denotes a bearing and or distance per description(Meas.) Denotes a measured bearing and or distance Denotes restricted access to Dakota County per theDakota County Contiguous Plat OrdinanceVICINITY MAPSEC. 13 - T144 - R21DAKOTA COUNTY, MINNESOTANNOT TO SCALEPage 122 of 899 Date: 10/6/2025 Rescue Truck Purchase Proposed Action Staff recommends adoption of the following motion: Move to approve the purchase of a rescue truck. Overview The Fire Department continually evaluates its fleet to ensure that apparatus meet the operational and service delivery needs of our growing community. Traditionally, fire engines are staffed and respond to a wide variety of fire and rescue calls. However, a review of call data shows that a significant percentage of the department’s responses are medical in nature, often requiring fewer personnel and less apparatus capacity than a full engine. To better align with current and future service demands, staff is recommending the purchase of a rescue truck in lieu of a replacement fire engine that was scheduled for replacement in 2025. Supporting Information 1. Lakeville Fire K3500 Crew SB (1) 2. 1d2cc09b-7f5a-45bd-b356-90f542109ade (1) 3. New Rescue Truck Memo Financial Impact: $134,506 Budgeted: Yes Source: 4100.4112.6540.00 Envision Lakeville Community Values: Good Value for Public Service, Safety Throughout the Community Report Completed by: Michael Meyer, Fire Chief Page 123 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com CITY OF LAKEVIILLE Prepared For: BOB MACH FIRE DEPT Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE Page 124 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 2 Quote Worksheet MSRP Base Price $58,300.00 Dest Charge $2,195.00 Total Options $6,015.00 Subtotal $66,510.00 BID ASSIST ($3,500.00) Subtotal Pre-Tax Adjustments ($3,500.00) Less Customer Discount ($5,402.00) Subtotal Discount ($5,402.00) Trade-In $0.00 Subtotal Trade-In $0.00 Taxable Price $57,608.00 Sales Tax $0.00 TRANSIT TAX $20.00 Subtotal Taxes $20.00 $0.00 Subtotal Post-Tax Adjustments $0.00 Total Sales Price $57,628.00 Dealer Signature / Date Customer Signature / Date Selected Model and Options MODEL CODE MODEL MSRP TK30743 2025 GMC Sierra 3500HD 4WD Crew Cab 159" SLE $58,300.00 COLORS CODE DESCRIPTION G7C Cardinal Red (Available at extra charge.) Page 125 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 3 EMISSIONS CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP FE9 Emissions, Federal requirements 0.00 lbs 0.00 lbs $0.00 ENGINE CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP L8T Engine, 6.6L V8 with Direct Injection and Variable Valve Timing, gasoline (401 hp [299 kW] @ 5200 rpm, 464 lb-ft of torque [629 N- m] @ 4000 rpm) (STD) 0.00 lbs 0.00 lbs $0.00 TRANSMISSION CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP MKM Transmission, Allison 10-Speed automatic (STD)0.00 lbs 0.00 lbs $0.00 GVWR CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP JGN GVWR, 11,550 lbs. (5239 kg) with single rear wheels (STD) (Included and only available with TK30743 model and (L8T) 6.6L V8 gas engine. Requires single rear wheels.) 0.00 lbs 0.00 lbs Inc. AXLE CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP GT4 Rear axle, 3.73 ratio (Requires (L8T) 6.6L V8 gas engine.)0.00 lbs 0.00 lbs $0.00 PREFERRED EQUIPMENT GROUP CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP 3SA SLE Preferred Equipment Group includes standard equipment 0.00 lbs 0.00 lbs $0.00 Page 126 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 4 WHEELS CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP PXD Wheels, 18" (45.7 cm) machined aluminum wheel with Dark Grey metallic accents (STD) (Requires single rear wheels. Included with (RFX) X31 Off-Road and Protection Package.) 0.00 lbs 0.00 lbs $0.00 TIRES CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP QF6 Tires, LT275/70R18E all-terrain, blackwall (STD) (Requires single rear wheels. Included with (RFX) X31 Off-Road and Protection Package.) 0.00 lbs 0.00 lbs $0.00 PAINT CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP G7C Cardinal Red (Available at extra charge.)0.00 lbs 0.00 lbs $495.00 SEAT TYPE CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP AZ3 Seats, front 40/20/40 split-bench with covered armrest storage and under-seat storage (lockable) (STD) 0.00 lbs 0.00 lbs $0.00 SEAT TRIM CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP H0U Jet Black, Cloth seat trim 0.00 lbs 0.00 lbs $0.00 RADIO CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP IOK Audio System, 13.4" diagonal Premium GMC Infotainment System with Google built in apps such as navigation and voice assistance, includes color touch-screen, multi-touch display, AM/FM stereo, Bluetooth streaming audio for music and most phones; featuring wireless Android Auto and Apple CarPlay capability for compatible phones. (STD) 0.00 lbs 0.00 lbs $0.00 Page 127 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 5 ADDITIONAL EQUIPMENT - PACKAGE CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP B59 Remote Start Package includes (BTV) Remote Start, (UTJ) content theft alarm and (C49) rear-window defogger (Included in (PDU) SLE Value Package.) 0.00 lbs 0.00 lbs $525.00 PCQ SLE Convenience Package includes (CJ2) dual climate control, (A2X) 10-way power driver seat including power lumbar, (N37) manual tilt/telescoping steering column and (T3U) LED fog lights; Single rear wheel models also include (U01) Roof Marker Lamps (Included with (PDU) SLE Value Package. Requires (B59) Remote Start Package. Note (U01) Roof Marker Lamps are not available with (YF5) California state emissions requirements on single rear wheels.) 0.00 lbs 0.00 lbs $915.00 PED Sierra HD Pro Safety Plus Package includes (UKV) Trailer Side Blind Zone Alert, (UFG) Rear Cross Traffic Alert, (UVN) Bed View Camera, (UV2) HD Surround Vision, (UD5) Front and rear park assist and (TRG) Trailer Camera Provisions (Includes (UET) In- Vehicle Trailering App. Requires (C49) rear-window defogger. Requires (DWI) trailer mirrors. Not available with (ZW9) Pickup bed delete.) 0.00 lbs 0.00 lbs $1,335.00 VYU Snow Plow Prep/Camper Package includes (KW5) 220-amp alternator, includes increased front GAWR on Heavy Duty models, (NZZ) skid plates (transfer case and oil pan), pass through dash grommet hole and roof emergency light provisions. Contact GM Upfitter Integration at www.gmupfitter.com for plow installation details and assistance. Note: if ordered for Camper usage, recommend ordering (UY2) Trailering wiring provisions (Requires 4WD model and includes (KW5) 220-amp alternator and is upgradeable to (KHF) Dual alternators (220-amp primary, 170-amp auxiliary). Not available with (F60) Heavy Duty Front Spring/Camper Package.) 0.00 lbs 0.00 lbs $300.00 ADDITIONAL EQUIPMENT - MECHANICAL CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP KW5 Alternator, 220 amps (Included with (L5P) Duramax 6.6L Turbo- Diesel V8 engine or (VYU) Snow Plow Prep/Camper Package. Free flow on (L8T) 6.6L V8 gas engine.) 0.00 lbs 0.00 lbs Inc. NQH Transfer case, two-speed active electronic Autotrac with push button control (Requires 4WD models.) 0.00 lbs 0.00 lbs $200.00 NZZ Skid Plates protect the oil pan, front axle and transfer case (Included with (X31) X31 Off-Road Package or (VYU) Snow Plow Prep/Camper Package.) 0.00 lbs 0.00 lbs Inc. Page 128 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 6 ADDITIONAL EQUIPMENT - EXTERIOR CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP B1J Wheelhouse liners, rear (Not available with (ZW9) pickup bed delete. Not available with dual rear wheel models.) 0.00 lbs 0.00 lbs $140.00 CGN Bed Liner, Spray-on Pickup bedliner with GMC logo (does not include spray-on liner on tailgate due to Black composite inner panel) (Included with (RFX) X31 Off-Road and Protection Package, (Z6A) Gooseneck / 5th Wheel Prep Package or (PDU) SLE Value Package. Not available with (ZW9) pickup bed delete. Available with Ship Thru code (SQE) or (TCH), not available with any other Ship Thru code.) 0.00 lbs 0.00 lbs $545.00 DWI Mirrors, outside power-adjustable vertical trailering with heated and auto-dimming upper glass lower convex mirrors, turn signal indicators, puddle lamps, (U12) perimeter lighting, auxiliary lighting, power folding/manual extending (extends 3.31" [84.25mm]), Black (Requires (PCQ) SLE Convenience Package. Includes Perimeter Lighting and (DD8) auto-dimming rearview mirror.) 0.00 lbs 0.00 lbs $515.00 T3U Fog lamps, LED (Included and only available with (PCQ) SLE Convenience Package.) 0.00 lbs 0.00 lbs Inc. U01 Lamps, Smoked Amber roof marker, (LED) (Standard with dual rear wheels. Not available with (YF5) California state emissions requirements on single rear wheels. Included and only available with (PCQ) SLE Convenience Package.) 0.00 lbs 0.00 lbs Inc. Page 129 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 7 ADDITIONAL EQUIPMENT - INTERIOR CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP 9L7 Upfitter switch kit, (5) Provides 3-30 amp and 2-20 amp configurable circuits to facilitate installation of aftermarket electrical accessories. Kit with all required parts will be shipped loose with the truck for installation by the dealer or upfitter at customer expense. Installation instructions and technical assistance available at www.gmupfitter.com. 0.00 lbs 0.00 lbs $150.00 A2X Seat adjuster, driver 10-way power including lumbar (Included and only available with (PCQ) SLE Convenience Package.) 0.00 lbs 0.00 lbs Inc. BTV Remote vehicle starter system (Included and only available with (B59) Remote Start Package.) 0.00 lbs 0.00 lbs Inc. C49 Defogger, rear-window electric (Included with (B59) Remote Start Package or (PDU) SLE Value Package.) 0.00 lbs 0.00 lbs Inc. CJ2 Air conditioning, dual-zone automatic climate control (Included and only available with (PCQ) SLE Convenience Package.) 0.00 lbs 0.00 lbs Inc. DD8 Mirror, inside rearview auto-dimming (Included and only available with (DWI) trailer mirrors.) 0.00 lbs 0.00 lbs Inc. N37 Steering column, manual Tilt-Wheel and telescoping (Included and only available with (PCQ) SLE Convenience Package.) 0.00 lbs 0.00 lbs Inc. UET In-Vehicle Trailering App System, includes checklist, trailer maintenance reminders, trailer security alerts, trailer mileage, tow/haul reminder, trailer electrical diagnostics and Trailer Tire Pressure Monitor System module (Included and only available with (PED) Sierra HD Pro Safety Plus Package or (PDQ) Preferred Package. Includes trailer tire pressure monitoring alert when (PTT) trailer tire pressure monitor sensors are installed.) 0.00 lbs 0.00 lbs Inc. UTJ Theft-deterrent system, unauthorized entry (Included and only available with (B59) Remote Start Package.) 0.00 lbs 0.00 lbs Inc. Page 130 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 8 ADDITIONAL EQUIPMENT - SAFETY-INTERIOR CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP TRG Trailer Camera Provisions and trailer viewing software (Included and only available with (PED) Sierra HD Pro Safety Plus Package. Not available on Regular Cab models.) 0.00 lbs 0.00 lbs Inc. UD5 Front and Rear Park Assist, ultrasonic (Included and only available with (PED) Sierra HD Pro Safety Plus Package. Not available with (ZW9) Pickup bed delete.) 0.00 lbs 0.00 lbs Inc. UFG Rear Cross Traffic Alert (Included and only available with (PED) Sierra HD Pro Safety Plus Package.) 0.00 lbs 0.00 lbs Inc. UKV Trailer Side Blind Zone Alert (Included and only available with (PED) Sierra HD Pro Safety Plus Package) 0.00 lbs 0.00 lbs Inc. UV2 HD Surround Vision provides the driver with an overhead view of the scene around the vehicle on a center stack display. Includes front camera washer. (Included and only available with (PED) Sierra HD Pro Safety Plus Package. Not available on Regular Cab models.) 0.00 lbs 0.00 lbs Inc. UVN Bed View Camera camera in the CHMSL to show a view of the cargo bed, display located in infotainment screen, includes Two Trailer Camera Provisions (Included and only available with (PED) Sierra HD Pro Safety Plus Package. Not available on Regular Cab models or with (ZW9) pickup bed delete.) 0.00 lbs 0.00 lbs Inc. ADDITIONAL EQUIPMENT - LPO CODE DESCRIPTION FRONT WEIGHT REAR WEIGHT MSRP PDR LPO, Assist step and floor liner package includes (RIA) All-weather floor liner, LPO and choice of assist step (VXH) 6" Chrome rectangular tubular assist step, LPO or (VXJ) 4" Chrome round tubular assist step, LPO (Not available with (PDH) LPO, GMC Protection Package.) 0.00 lbs 0.00 lbs $895.00 RIA LPO, All-weather floor liner, 1st and 2nd rows (dealer-installed) (Included with (RFX) X31 Off-Road and Protection Package, (PDH) GMC Interior Protection Package, LPO or (PDR) Assist step and floor liner package, LPO. Replaces factory floor mats.) 0.00 lbs 0.00 lbs Inc. VXH LPO, Assist steps, chromed tubular, 6" rectangular (dealer- installed) (Included with (PDR) Assist step and floor liner package, LPO. Not available with any other RPO or LPO assist step.) 0.00 lbs 0.00 lbs Inc. Options Total 0.00 lbs 0.00 lbs $6,015.00 Price Summary Page 131 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 9 PRICE SUMMARY MSRP Base Price $58,300.00 Total Options $6,015.00 Vehicle Subtotal $64,315.00 Destination Charge $2,195.00 Grand Total $66,510.00 Page 132 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 10 Standard Equipment Package Sierra HD Pro Safety includes (UEU) Forward Collision Alert, (UE4) Following Distance Indicator, (UKJ) Front Pedestrian Braking, (TQ5) IntelliBeam, (UFL) Lane Departure Warning, (T8Z) Buckle to Drive and (UHY) Automatic Emergency Braking Trailering Package includes trailer hitch, 7-pin and 4-pin connectors and (CTT) Hitch Guidance (Deleted when (ZW9) pickup bed delete is ordered.) Mechanical Pickup bed includes bed assist step (Deleted when (ZW9) pickup bed delete is ordered.) Engine, 6.6L V8 with Direct Injection and Variable Valve Timing, gasoline (401 hp [299 kW] @ 5200 rpm, 464 lb- ft of torque [629 N-m] @ 4000 rpm) (STD) Transmission, Allison 10-Speed automatic (STD) Rear axle, 3.73 ratio (Requires (L8T) 6.6L V8 gas engine.) GVWR, 11,550 lbs. (5239 kg) with single rear wheels (STD) (Included and only available with TK30743 model and (L8T) 6.6L V8 gas engine. Requires single rear wheels.) Push Button Start Air filter, heavy-duty Air filtration monitoring Transfer case, two-speed electronic shift with push button controls (Requires 4WD models.) Auto-locking rear differential Four wheel drive Cooling, external engine oil cooler Cooling, auxiliary external transmission oil cooler Battery, heavy-duty 720 cold-cranking amps/80 Amp-hr maintenance-free with rundown protection and retained accessory power (Included and only available with (L8T) 6.6L V8 gas engine.) Alternator, 170 amps (Requires (L8T) 6.6L V8 gas engine.) Trailer brake controller, integrated Recovery hooks, front, frame-mounted, Black Frame, fully-boxed, hydroformed front section and a fully-boxed stamped rear section Suspension Package (Not available with (X31) Off-Road Package.) Steering, Recirculating Ball with smart flow power steering system Brakes, 4-wheel antilock, 4-wheel disc with DURALIFE rotors Brake lining wear indicator Page 133 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 11 Mechanical Capless Fuel Fill (Requires (L8T) 6.6L gas V8 engine. Not included with (ZW9) pickup bed delete.) Exterior Single Rear Wheels Wheels, 18" (45.7 cm) machined aluminum wheel with Dark Grey metallic accents (STD) (Requires single rear wheels. Included with (RFX) X31 Off-Road and Protection Package.) Tires, LT275/70R18E all-terrain, blackwall (STD) (Requires single rear wheels. Included with (RFX) X31 Off- Road and Protection Package.) Tire, spare LT275/70R18 all-terrain, blackwall (Included and only available with (QF6) LT275/70R18E all-terrain, blackwall tires or (QF9) LT275/65R20 all-terrain, blackwall tires with (E63) pickup bed models. Available to order when (ZW9) pickup bed delete and (QF6) LT275/70R18E all-terrain, blackwall tires are ordered.) Tire carrier lock keyed cylinder lock that utilizes same key as ignition and door Bumper, front chrome lower Bumper, rear chrome with bumper CornerSteps CornerStep, rear bumper Bed Step, Black integrated on forward portion of bed on driver and passenger side (Not available with (ZW9) pickup bed delete.) Moldings, beltline, stainless steel Cargo tie downs (12), fixed, rated at 500 lbs per corner Grille, Chrome surround with chrome insert bars Headlamps, Animated LED projectors, LED turn signals and Daytime Running Lamps IntelliBeam, automatic high beam on/off (Included and only available with (PDI) Sierra HD Pro Safety.) Taillamps, LED Signature Tail, Incandescent Brake, Turn & Reverse Lamps Lamps, cargo area, cab mounted integrated with center high mount stop lamp, with switch in bank on left side of steering wheel Mirrors, outside power-adjustable vertical trailering with heated upper glass lower convex mirrors, integrated turn signals, manual folding/extending (extends 3.31" [84.25mm]), Black Glass, deep-tinted Door handles, body-color Tailgate, standard (Deleted with (ZW9) pickup bed delete.) Tailgate and bed rail protection caps, top (Deleted with (ZW9) pickup bed delete.) Tailgate, gate function manual with EZ Lift includes power lock and release, includes hitch area light (Deleted with (ZW9) pickup bed delete.) Page 134 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 12 Entertainment Audio System, 13.4" diagonal Premium GMC Infotainment System with Google built in apps such as navigation and voice assistance, includes color touch-screen, multi-touch display, AM/FM stereo, Bluetooth streaming audio for music and most phones; featuring wireless Android Auto and Apple CarPlay capability for compatible phones. (STD) SiriusXM SiriusXM with 360L Trial Subscription. SiriusXM with 360L transforms your customers' ride with our most extensive and personalized radio experience on the road. (IMPORTANT: The SiriusXM trial subscription is not provided on vehicles that are ordered for Fleet Daily Rental ("FDR") use. Trial subscription is subject to the SiriusXM Customer Agreement and privacy policy, visit www.siriusxm.com which includes full terms and how to cancel. All fees, content, features, and availability are subject to change. Some features require GM connected vehicle services.) Audio system feature, 6-speaker system (Requires Crew Cab or Double Cab model.) Bluetooth for phone connectivity to vehicle infotainment system Wireless Phone Projection for Apple CarPlay and Android Auto Wi-Fi Hotspot capable (Terms and limitations apply. See onstar.com or dealer for details.) Interior Seats, front 40/20/40 split-bench with covered armrest storage and under-seat storage (lockable) (STD) Seat trim, Cloth Seat adjuster, driver 4-way manual Seat adjuster, passenger 4-way manual Seat, rear 60/40 folding bench (folds up), 3-passenger (includes child seat top tether anchor) (Not available with Regular Cab model.) Floor covering, color-keyed carpeting Floor mats, rubberized-vinyl front (Included and only available with (B30) color-keyed carpeting. Deleted when LPO floor liners are ordered.) Floor mats, rubberized-vinyl rear (Requires Crew Cab or Double Cab model. Included and only available with (B30) color-keyed carpeting. Deleted when LPO floor liners are ordered.) Steering wheel, wrapped Steering column, Tilt-Wheel, manual with wheel locking security feature Steering wheel audio controls Driver Information Center, enhanced, 12.3" diagonal reconfigurable multicolor digital display GMC Premium information Display- 13.4" diagonal Multicolor touch screen Exterior Temperature Display located in radio display Compass, located in instrument cluster Page 135 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 13 Interior Window, power front, drivers express up/down Window, power front, passenger express down Windows, power rear, express down (Not available on Regular Cab models.) Door locks, power Keyless Open and Start includes remote keyless entry Cruise control, steering wheel-mounted Power outlet, instrument panel, 120-volt (400 watts shared with (KC9) bed mounted power outlet) USB Ports, 2, Charge/Data ports located on instrument panel USB ports, (2) charge-only, rear Power outlet, bed mounted, 120-volt (400 watts shared with (KI4) instrument panel mounted power outlet) (Deleted with (ZW9) pickup bed delete.) Air conditioning, single-zone Air vents, rear (Not available with Regular Cab model.) Mirror, inside rearview, manual tilt Assist handles, front A-pillar mounted for driver and passenger, rear B-pillar mounted Safety-Mechanical Automatic Emergency Braking (Included and only available with (PDI) Sierra HD Pro Safety.) StabiliTrak, stability control system with Proactive Roll Avoidance and traction control includes electronic trailer sway control and hill start assist Safety-Exterior Daytime Running Lamps LED signature lighting LED Signature DRL's Safety-Interior Airbags, Dual-stage frontal airbags for driver and front outboard passenger; Seat-mounted side-impact airbags for driver and front outboard passenger; Head-curtain airbags for front and rear outboard seating positions; Includes front outboard Passenger Sensing System for frontal outboard passenger airbag (Always use seat belts and child restraints. Children are safer when properly secured in a rear seat in the appropriate child restraint. See the Owner's Manual for more information.) OnStar Services capable (See onstar.com for details and limitations. Services vary by model. Service plan required.) HD Rear Vision Camera (Not available with (ZW9) pickup bed delete. Removed with (UV2) HD Surround Vision or (ZW9) pickup bed delete. Not available with (Z6A) Gooseneck / 5th Wheel Prep Package.) Page 136 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 14 Safety-Interior Hitch Guidance dynamic single line to aid in truck trailer alignment for hitching (Deleted with (ZW9) pickup bed delete.) Lane Departure Warning (Included and only available with (PDI) Sierra HD Pro Safety.) Following Distance Indicator (Included and only available with (PDI) Sierra HD Pro Safety.) Forward Collision Alert (Included and only available with (PDI) Sierra HD Pro Safety.) Front Pedestrian Braking (Included and only available with (PDI) Sierra HD Pro Safety.) Rear Seat Reminder (Requires Crew Cab or Double Cab model.) Teen Driver a configurable feature that lets you activate customizable vehicle settings associated with a key fob, to help encourage safe driving behavior. It can limit certain available vehicle features, and it prevents certain safety systems from being turned off. An in-vehicle report card gives you information on driving habits and helps you to continue to coach your new driver Seat Belt Adjustable Guide Loops, front row only (Included and only available on Crew Cab and Double Cab models. Not available with (ZW9) pickup bed delete.) Indicator-Seat Belt WARNING, Rear Seat (Requires Crew Cab or Double Cab model.) Buckle to Drive prevents vehicle from being shifted out of Park until driver seat belt is fastened; times out after 20 seconds and encourages seat belt use (Included and only available with (PDI) Sierra HD Pro Safety) Tire Pressure Monitoring System auto learn, includes Tire Fill Alert (does not apply to spare tire) OnStar Basics (OnStar Fleet Basics for Fleet) Drive confidently with core OnStar services including remote commands, built-in voice assistance, real-time traffic and navigation, and Automatic Crash Response to help if you're in need. (OnStar Basics includes remote commands, Navigation, Voice Assistance, and Automatic Crash Response, for eligible vehicles with compatible software. For MY25 vehicles, OnStar Basics is standard for 8 years; OnStar plan, working electrical system, cell reception and GPS signal required. OnStar links to emergency services. Service coverage varies with conditions and location. Service availability, features and functionality vary by device and software version. See onstar.com for details and limitations.) Processing-Other Trailering Information Label provides max trailer ratings for tongue weight, conventional, gooseneck and 5th wheel trailering (Not available with (ZW9) pickup bed delete.) Page 137 of 899 NORTH COUNTY GM BOB OHARA` | 218-349-8955 | rwohara01@aol.com Vehicle: [Fleet] 2025 GMC Sierra 3500HD (TK30743) 4WD Crew Cab 159" SLE ( Complete ) This document contains information considered Confidential between GM and its Clients uniquely. The information provided is not intended for public disclosure. Prices, specifications, and availability are subject to change without notice, and do not include certain fees, taxes and charges that may be required by law or vary by manufacturer or region. Performance figures are guidelines only, and actual performance may vary. Photos may not represent actual vehicles or exact configurations. Content based on report preparer’s input is subject to the accuracy of the input provided. Data Version: 25451. Data Updated: May 13, 2025 6:47:00 PM PDT. May 14, 2025 Page 15 WARRANTY Warranty Note: <<< Preliminary 2025 Warranty >>> Basic Years: 3 Basic Miles/km: 36,000 Drivetrain Years: 5 Drivetrain Miles/km: 60,000 Drivetrain Note: 3.0L & 6.0L Duramax® Turbo-Diesel engines, and certain commercial, government, and qualified fleet vehicles: 5 years/100,000 miles Corrosion Years (Rust-Through): 6 Corrosion Years: 3 Corrosion Miles/km (Rust-Through): 100,000 Corrosion Miles/km: 36,000 Roadside Assistance Years: 5 Roadside Assistance Miles/km: 60,000 Roadside Assistance Note: 3.0L & 6.0L Duramax® Turbo-Diesel engines, and certain commercial, government, and qualified fleet vehicles: 5 years/100,000 miles Maintenance Note: First Visit: 12 Months/12,000 Miles Page 138 of 899 PROPOSAL 62192-003 8/19/2025Date: Proposal No: Tariff Update: If any component pricing is impacted by tariffs between the time of this Proposal and the completion of the project, we reserve the right to pass on increases. receipt of Signed Order) 98-112 Est. Lead Time (afterInstalled Ship Via: 01/31/2026This Quote is valid through Bob MachRequested by: rmach@lakevillemn.govEmail:(952)985-2750Phone:Bob MachContact: Lakeville, MN 55044Lakeville, MN 55044 20195 Holyoke Avenue20195 Holyoke Avenue City of LakevilleShip To:City of LakevillePrepared for: John HolmanSales Rep: EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $0.00EA/$0.001VEHICLEVEHICLE OPTIONS: MODEL YEAR 2026 CHEVROLET 3500 GAS CREW CAB BOX LENGTH 6.5' (78.8") BOX DELETE = NO SINGLE REAR WHEEL VIN: TBA Stock #: TBA PICKUP & DELIVERY = CUSTOMER EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $9,320.00EA/$9,320.001SPACEKAP COMPAK 6 MONOCOQUE/40/60 REAR DOORS W/ SIDE DOORS01-1602 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $3,680.00EA/$1,840.002ALUMINUM DIAMOND PLATE CABINET/15" (2) W/ EXTRA LED LIGHT91-0055 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $3,836.00EA/$3,836.001DUAL SLIDING TRAY, 75% EXTEND,/1000LB. CAPACITY EACH, 6.5'BED32-0041 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. 1 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 139 of 899 $3,578.00EA/$1,789.002ALUMINUM TOOL BOARD, 36" X 78"50521904896 NCI EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $234.12EA/$234.121RELOCATION KIT, 2019-2024 GM/FIXEDCS-GMTR-19RF EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $1,413.30EA/$1,413.301ITEMIZER DRAWER UNIT, 2,/49X12X12326-3 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $209.00EA/$209.001MEDICAL CABINET, 13X16X5.5CFSE745ANSISK NCI EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $378.96EA/$126.323COLEMAN CABLE 4-OUTLET GFCI/POWER STRIP, 15-AMP, 6-FOOT04644 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $199.95EA/$199.951TOOL MOUNTING ASSORTMENT/KIT, QUICK FISTS, 42 PCS90099 NCI EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $459.00EA/$459.001INSTALLATION KIT A (FITS FORD,/NISSAN, GM, RAM 1500 TRUCKS)70-0189 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $10,655.00EA/$10,655.001SNOWEX 8' TO 10' POWER PLOW/ WITH SCRAPE MAXX8100PP EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $576.00EA/$576.001OPTION - LED LIGHT KIT UPGRADE72525 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $525.00EA/$525.001OPTION - DEFLECTOR KIT, 810084519 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $2,800.00EA/$2,800.001WECANX LIBERTY II DUO LIGHTBAR/54", DUAL COLOR RED/GREEN/BLUEBJ2LNLN RED/GREEN DRIVER'S SIDE CORNERS DRIVER'S SIDE HALF IS RED/GREEN BLUE/GREEN PASSENGER'S SIDE CORNERS PASSENGER'S SIDE HALF IS BLUE/GREEN EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. 2 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 140 of 899 $58.00EA/$58.001LIGHTBAR MOUNT KIT, 2020-26 GM/2500/3500, FOR 54" LIGHTBARMKEZ101 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $324.22EA/$324.221TWO SUPER-LED TAKE-DOWN LIGHTS/AND A STROBE, CENTER MOUNT BARIJ500ST MOUNTED INSIDE LIGHTBAR, CENTER FRONT EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $818.38EA/$818.381CENCOM CORE WECANX CONTROL/SYSTEMC399 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $274.34EA/$274.341WECANX CONTROL HEAD,/MECHANICAL SIREN TONECCTL6 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $109.62EA/$109.621OBDII CANPORT KIT 2020-26 GM/2500/3500HDC399SP EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $215.18EA/$215.181VEHICLE TO VEHICLE MODULECV2V EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $238.96EA/$238.961SA315 SERIES SPEAKER, NYLON/COMPOSITESA315P BEHIND GRILLE EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $30.74EA/$30.741UNIVERSAL SPEAKER MOUNTING/BRACKETSAK1 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $438.48EA/$438.481SIREN AMPLIFIER WITH ONE SPEAK/ER, INCLUDES UNIV. MOUNT BRCKTCHWLUNI EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $124.12EA/$124.121SUPER-LED LIGHTHEAD, REDLINZ6R DRIVER'S SIDE GRILLE EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $124.12EA/$124.121SUPER-LED LIGHTHEAD, BLUELINZ6B PASSENGER'S SIDE GRILLE EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $133.40EA/$133.401SUPER-LED LIGHTHEAD, RED/WHITELINZ6D DRIVER'S SIDE FRONT BUMPER 3 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 141 of 899 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $133.40EA/$133.401SUPER-LED LIGHTHEAD BLUE/WHITELINZ6E PASSENGER'S SIDE FRONT BUMPER EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $99.76EA/$99.761T-SERIES LINEAR SUPER-LED/LIGHTHEAD, SOLO, REDTLIR DRIVER'S SIDE FOG LIGHT AREA EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $99.76EA/$99.761T-SERIES LINEAR SUPER-LED/LIGHTHEAD, SOLO, BLUETLIB PASSENGER'S SIDE FOG LIGHT AREA EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $197.20EA/$197.201ION V-SERIES UNIVERSAL MOUNT W/COMBO 180 WARNING/TAKEDOWN-REDIONV3R UNDER DRIVER'S SIDE MIRROR EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $197.20EA/$197.201ION V-SERIES UNIVERSAL MOUNT W/COMBO 180 WARNING/TAKEDOWN-BLUIONV3B UNDER PASSENGER'S SIDE MIRROR EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $183.28EA/$91.642MINI T-SERIES LIGHT, SURFACE/MOUNT, DUO, RED/AMBERTLMI2K LOWER REAR SIDE CORNERS OF KAP, L & R EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $183.28EA/$91.642MINI T-SERIES LIGHT, SURFACE/MOUNT, DUO, RED/WHITETLMI2D DRIVER'S SIDE OF KAP, AT TOP, FRONT & REAR EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $183.28EA/$91.642MINI T-SERIES LIGHT, SURFACE/MOUNT, DUO, BLUE/WHITETLMI2E PASSENGER'S SIDE OF KAP, AT TOP, FRONT & REAR EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $366.56EA/$91.644MINI T-SERIES LIGHT, SURFACE/MOUNT, SOLO, REDTLMIR REAR OF KAP, TOP & BOTTOM, L & R EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $307.40EA/$153.702PERIMETER ENHANCEMENT LIGHT,/WHITE, STEADY, CHROME FLANGEPEL2C MOUNT JUST INSIDE REAR DOORS, L & R SEPARATE SWITCH AT DOOR EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. 4 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 142 of 899 $276.08EA/$138.042STRIP-LITE PLUS SEQUENCING LIG/HTHEAD, AMBER, TRAFFIC DIRECTPSSEQACR MOUNT ON BRACKETS ABOVE REAR DOORS EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $684.87EA/$684.871FLAT CONSOLE, 26"L X 12.5"W,/2020-26 GM 2500/3500HDC-VSW-2600-SILV EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $24.75EA/$24.751MOUNTING BRACKET, 2.5”, FOR/MOTOROLA RADIOC-EB25-MMT-1P EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $27.75EA/$27.751MOUNTING BRACKET, 4", FOR/WHELEN CENCOM CONTROLC-EB40-CCS-1P EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $50.25EA/$50.251DOUBLE CUP HOLDER, 4”CUP2-1001 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $38.25EA/$38.251ACCESSORY BOX, 3", INTERNAL/MOUNT, 2.5" DEEPC-AP-0325-1 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $161.25EA/$161.251ACCESSORY POCKET, INTERNAL MNT/W/HINGED LID & LOCK, 9”L X 4.5C-AP-0945-L EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $9.75EA/$9.7512” FILLER PLATEC-FP-2 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $70.50EA/$70.501SIDE MOUNT ARMRESTC-ARM-102 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $117.75EA/$117.751MAP LIGHT, 12" GOOSENECK, TOP/MOUNT, RED & WHITE LEDC-MAP-T-LED EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $172.50EA/$172.501TITAN TELESCOPING POLE WITH/SHORT HANDLE, SIDE MOUNT, 8.5"C-HDM-204 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $275.25EA/$275.25111" SLIDEOUT LOCKING SWING ARM/W/ LOW PROFILE MOTION ADAPTERC-MD-119 5 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 143 of 899 EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $204.99EA/$204.991NOVA STROBE PREEMPTION DASH/LIGHTNOVA-PRE NCI MOUNT AT TOP OF WINDSHIELD EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $48.96EA/$48.961FLASHBACK ALTERNATING TAILLIGH/FLASHER, SOLID STATE - 2.4 FPSETFBSSN-P EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $45.12EA/$45.121SELECT-A-PATTERN HEADLIGHT/FLASHER, SOLID STATEETHFSS-SP EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $105.14EA/$105.141SOUTHCO ELECTRONIC LATCHEM-10-11-310 NCI FOR C-AP-0945-L POCKET W/ HINGED LID EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $395.00EA/$395.001KUSSMAUL SUPER 20 AUTO EJECT/SHORE POWER PORT, WHITE091-55-20-120-WH NCI FOR POWER OUTLET STRIP, INSTALL ON PASSENGER'S SIDE REAR CORNER EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $315.54EA/$315.541KUSSMAUL LPC 7 CHARGER -/ 5" X 8.5" X 2.5"445-4290-5 NCI TO MAINTAIN UNDER-HOOD STARTER BATTE EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $98.00EA/$49.002DUAL USB CHARGER & 20A 12V/RECEPTACL11070 NCI INSTALL IN CONSOLE EXT. PRICEPRICEQTYDESCRIPTIONITEM NO. $21,350.00EA/$175.00122INSTALLATIONLABOR-SB INCLUDES INSTALLATION OF CLIENT-SUPPLIE - MOTOROLA RADIO - PEPWAVE ROUTER - ANTENNAS - ANTENNA CABLES - WECAN GATEWAY - CLOUD-SPECIFIC COMPONENTS 6 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 144 of 899 ACCEPTED DATE: _____________________________ACCEPTED BY: ______________________________ ALL ITEMS ARE ON MN STATE CONTRACTS 170214, 264953, OR 264963 UNLESS MARKED "NCI" (NON-CONTRACT ITEM) PROJECT TOTAL (BEFORE TAX):$67,176.71 THE PARTIES AGREE THAT THE TERMS AND CONDITIONS ATTACHED HERETO OR ON THE BACK SIDE OF THIS ORDER ARE INCORPORATED HEREIN AND A PART OF THIS ORDER. TERMS AND CONDITIONS 13.SUITABILITY DISCLAIMER.The performance of the Products depends on a variety of parameters which are beyond the control of the Company.Performance of the Products may vary considerably from one application to the next.THE COMPANY MAKES NO CLAIM,REPRESENTATION OR WARRANTY CONCERNING THE PERFORMANCE OR SUITABILITY OF THE PRODUCTS FOR OR IN BUYER’S APPLICATION.The assessment of usefulness and suitability of the Products for each application rests solely with the Buyer. 14.WARRANTY.The Company warrants its workmanship to be free from defects for a period of twelve (12)months from shipment,unless a different period is otherwise quoted in writing by the Company to the original Buyer.The only exception to this is paint issues,which are warranted for a period of ninety (90) days.If an issue arises during the warranty period,the original Buyer shall notify the Company and request a return or re-work authorization.Only after the authorization from the Company has been received can the work to repair the deficiency proceed.The foregoing warranty shall not apply to defects resulting from (i)improper or inadequate maintenance by Buyer;(ii)Buyer-supplied equipment,(iii) unauthorized modifications,misuse or accidents,(iv)operation outside of the environmental specifications of the Product.All Services shall be performed in professional manner,in conformity with industry standards.THIS WARRANTY IS IN LIEU OF ALL OTHER WARRANTIES,EXPRESS OR IMPLIED,INCLUDING WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE. 15.COMPANY INDEMNIFICATION.The Company shall defend any claim,suit,or proceeding brought against Buyer by a third party (“Claim”)insofar as such Claim is based upon an assertion that the use or transfer of any Product delivered hereunder constitutes infringement of a US patent or registered copyright,provided Buyer (i)notifies the Company promptly in writing as to any such Claim,(ii)grants the Company sole control over the defense and settlement thereof,and (iii)reasonably cooperates in response to a Company request for assistance.Should any Product become,or in the Company’s opinion be likely to become,the subject of a Claim,the Company may,at its sole discretion and expense, (a)obtain for Buyer the right to make continued use of such Product,(b)replace or modify such Product so that the Product is no longer infringing,or (c)request return and upon receipt thereof refund to Buyer the residual value thereof,calculated using straight depreciation over a five (5)year useful life.The Company shall have no liability if the alleged infringement is based on (1)combination with non-Company products;(2)use for a purpose or in a manner for which the Product was not designed;(3)use of any older version when use of a newer Company revision would have avoided the infringement;(4)any modification not made with the Company’s written approval;(5)any modifications made by the Company pursuant to Buyer’s specific instructions;or (6)any intellectual property right owned or licensed by Buyer or any of its affiliates.Notwithstanding the foregoing,in no event shall the Company’s liability to Buyer under this Section exceed the amount paid by Buyer to the Company for any allegedly infringing Product. THIS SECTION STATES BUYER’S SOLE AND EXCLUSIVE REMEDY AND THE COMPANY’S ENTIRE LIABILITY TO BUYER FOR THIRD PARTY INFRINGEMENT CLAIMS. 16.BUYER IDEMNIFICATION.Buyer shall defend,indemnify and hold harmless the Company against any and all losses claims,demands,actions,damages,attorney’s fees and costs,however characterized, including but not limited to those involving personal injury,wrongful death,property damage or diminution of value,business damage or diminution of value,patent or copyright infringement,or any other liabilities of any nature as a result of the Company’s goods,materials,representations (both implicit and explicit) and/or Services,if,and only if,Buyer is at least partially at fault for said liabilities.Buyer’s indemnification of the Company for patent and copyright infringement under this section shall also apply where Buyer (a) modified,altered,or combined the Product with any equipment not supplied by the Company,or (b)used the Product in a manner for which it was not designed. 17.ENTIRE AGREEMENT.In the absence of a separate,duly executed volume purchase or similar agreement between the Company and Buyer,BUYER’S PURCHASE OF THE COMPANY PRODUCTS HEREUNDER REPRESENTS ACCEPTANCE OF THE TERMS AND CONDITIONS HEREIN,WHICH CONSTITUTE THE ENTIRE AGREEMENT BETWEEN THE PARTIES AND SUPERSEDE ANY PRIOR OR CONTEMPORANEOUS COMMUNICATIONS,REPRESENTATIONS,UNDERSTANDINGS OR AGREEMENTS BY EITHER PARTY,WHETHER VERBAL OR WRITTEN,CONCERNING THE SUBJECT MATTER HEREOF.The terms and conditions contained herein take precedence over Buyer’s additional or different terms and conditions,to which notice of objection is hereby given.Neither the Company’s commencement of performance nor delivery shall be deemed or construed as acceptance of Buyer’s additional or different terms and conditions.No waiver,change,or modification to the terms and condition herein shall be valid or binding unless in writing and signed by authorized representatives of both parties. 18.ASSIGNMENT.This Agreement may not be assigned by Buyer without prior written consent from a duly authorized representative of the Company.This Agreement shall be binding upon the Buyer’s permitted successors and assigns. 19.SURVIVABILITY.If any provision of this Agreement shall be invalid or unenforceable under any applicable law,such provisions shall not apply in such instance,but the remaining provisions shall be given their full effect in accordance with their terms. 20.MISCELLANEOUS.Except as prohibited by US bankruptcy laws,in the event of Buyer’s insolvency or inability to pay debts due,or voluntary or involuntary bankruptcy proceeding by or against Buyer,or appointment of a receiver or assignee for the benefit of Buyer’s creditors,the Company may elect to cancel any unfulfilled obligations to Buyer hereunder.The Company shall have all rights and remedies of a secured creditor under the Uniform Commercial Code (UCC)and all other applicable laws.Buyer agrees to execute such financing statements and other documents as the Company may request in order to protect its security interest.If Buyer fails to execute such financing statements and other documents within fourteen (14)days of written request by the Company,then Buyer hereby grants the Company full power and authority to execute and file such financing statement and other documents on Buyer’s behalf. 21.CHOICE OF LAW AND JURISDICTION.The parties agree that any dispute regarding interpretation or validity of these terms and conditions or relating in any manner to Products or Services sold hereunder shall be governed by the laws,and subject to the jurisdiction of courts,of Minnesota,USA,with any dispute or Claim venued or heard in the State of Minnesota. 22.NOTICE.Any notice required under this Agreement shall be valid upon either hand delivery or delivery via United States Mail,postage prepaid,to the parties at the addresses set forth in this Agreement,and if mailed via United States Mail,postage prepaid,be deemed delivered within three (3) days following the date of mailing. 1.PRICING.All price quotations are valid for fifteen (15)days unless otherwise noted. 2.PAYMENT.Unless otherwise quoted by the Company,agreed to in writing or expressly stated on the face of this document,terms of payment shall be as follows: a.For new Buyers or those without open account the terms are Prepay. b.For Buyers with open account the terms are:Net ten (10)days unless otherwise stated. c.A 50%down payment will be required for projects requiring significant engineering and design work,or projects with non-standard components provided or manufactured to the Buyer’s requirements,or projects over a certain value as required in the Proposal Terms.Balance due as per a.or b.above. d.A convenience fee of 3%will be added to all credit card payments.This applies to the full amount of the invoice. e.The Company may alter or suspend credit whenever the payment history or financial condition of Buyer warrants such action. f.Overdue payments will be subject to a 1.5%monthly interest rate. g.Buyer shall be liable for all costs,expenses and attorney’s fees incurred by the Company in the collection of delinquent accounts. 3.CUSTOMER VEHICLES IN OUR CARE,CUSTODY AND CONTROL.The Company is not responsible for damage to Buyer vehicles while in its care,custody,and control. 4.CUSTOMER VEHICLE STORAGE.Buyer vehicles not picked up within 10 business days of completion will be assessed a storage fee of ten dollars ($10.00)per day. 5.TAXES AND DUTIES.Prices for Products and Services do not include applicable federal,state or local taxes,now or hereafter enacted,which tax or taxes (i)will be added by the Company to the sales price whenever the Company has the legal obligation to collect same,and (ii)shall be paid by Buyer unless Buyer provides the Company with an appropriate tax-exemption certificate.Except as otherwise agreed to in writing or provided on the face hereof,for sales to points outside the United States all export duties, taxes,licenses,and fees,including customs,are in addition to the quoted prices and shall be Buyer’s responsibility,and any such cost incurred by the Company will be passed on to Buyer. 6.FREIGHT AND SHIPMENTS.All shipments for domestic sales are F.O.B.the Company manufacturing facility.The Company shall have satisfied all delivery obligations and,subject to the limitations set forth herein,possession of and title to all goods sold hereunder shall be deemed to pass to Buyer upon delivery to the carrier at point of shipment,whereupon Buyer assumes all risk of loss or damage to the goods and responsibility for shipping and insurance costs,regardless of any insurance that may have been secured by the Company at Buyer’s request.Any freight and delivery charges paid by the Company in connection with shipments to Buyer will be passed on to Buyer.Buyer shall notify the Company in writing relative to any shipment shortage or damage within two (2)days of receipt of shipment.The Company shall not be liable for delays in delivery or failure to manufacture due to causes beyond its reasonable control.In the event of any such delay or failure,the Company shall be entitled to extend the delivery date by a commensurate period of days.The Company shall have the right to cancel any order or to refuse or delay shipment if Buyer fails to meet payment terms or if there is any materially adverse change in Buyer’s financial status. Export of the Company Products or Services outside the United States of America is subject to the latest U.S.Export Regulation issued by the U.S.Department of Commerce,adherence to which is a Buyer’s responsibility after initial shipment by the Company. 7.ORDER CANCELLATION.If an order is canceled prior to the scheduled ship date,Buyer will be subject to the following cancellation charges:Buyer will be responsible for all costs incurred by the Company prior to the date of cancellation and any further costs incurred in the termination of the project.Cancellation of the order will not relieve the Buyer’s liability for payment as specified herein. 8.CHANGE ORDERS.Change orders include any deviation from the last design reviewed and agreed upon at the time the purchase order was issued.Buyer directed change orders are subject to additional fees.Depending on the scope of the change order,the Company reserves the right to collect all costs incurred to date.The added cost of the change order will be quoted by the Company and the Buyer can choose to (i)issue a second purchase order to cover the cost of the change order,or,(ii)add the additional charges to the original purchase order. 9.SCHEDULE CHANGES.Any delays in installation due to change orders,customer readiness,and/or reasons uncontrollable by the Company,may be subject to partial invoicing for all labor and materials incurred to date by the Company. 10.PROPRIETARY RIGHTS.The parties acknowledge that the Company may possess certain proprietary inventions,discoveries,Patents,Trademarks,or other intellectual properties in its products and designs and that the Company retains all right,title,ownership,copyright and/or other intellectual property rights in such.All such intellectual property incorporated shall remain the sole and exclusive property of the Company. 11.CONFIDENTIAL INFORMATION.The parties agree that except for the written consent of the other party,each party shall keep confidential and not disclose to any person not affiliated with such party,any of the other party’s confidential information and business secrets.The term “confidential information”shall include each party’s respective financial,marketing,product,process,customer,dealer,accounting,sales, manufacturing,employment and related information,including such other information that a party treats or otherwise deems as confidential.Confidential information shall also include the Company Creations, Services and payment under this Agreement. 12.LIMITATION OF LIABILITY.NOT WITHSTANDING ANY OTHER PROVISIONS OF THIS ORDER,IN NO EVENT SHALL THE COMPANY BE LIABLE FOR ANY INCIDENTAL,INDIRECT,SPECIAL,PUNITIVE OR CONSEQUENTIAL DAMAGES ARISING IN ANY MANNER OUT OF ANY BREACH OF WARRANTY OR OUT OF OR CONNECTED WITH THE SALE,LICENSE,LEASE,USE OR ANTICIPATED USE OF THE PRODUCTS,SERVICES,INCLUDING,BUT NOT LIMITED TO,ANY INTERRUPTION OF SERVICE, LOSS OF BUSINESS OR ANTICIPATORY PROFITS RESULTING FROM THE USE OR OPERATION OF THE PRODUCTS OR PROVISION OF SERVICES.NOTWITHSTANDING THE FOREGOING,THE COMPANY’S TOTAL CUMULATIVE LIABILITY UNDER THIS ORDER SHALL NOT EXCEED THE AMOUNT PAID BY BUYER FOR THE PARTICULAR PRODUCTS OR SERVICES INVOLVED. 7 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 145 of 899 13.SUITABILITY DISCLAIMER.The performance of the Products depends on a variety of parameterswhicharebeyondthecontroloftheCompany.Performance of the Products may vary considerably fromoneapplicationtothenext.THE COMPANY MAKES NO CLAIM,REPRESENTATION OR WARRANTYCONCERNINGTHEPERFORMANCEORSUITABILITYOFTHEPRODUCTSFORORINBUYER’SAPPLICATION.The assessment of usefulness and suitability of the Products for each application restssolelywiththeBuyer.14.WARRANTY.The Company warrants its workmanship to be free from defects for a period of twelve(12)months from shipment,unless a different period is otherwise quoted in writing by the Company to theoriginalBuyer.The only exception to this is paint issues,which are warranted for a period of ninety (90)days.If an issue arises during the warranty period,the original Buyer shall notify the Company andrequestareturnorre-work authorization.Only after the authorization from the Company has beenreceivedcantheworktorepairthedeficiencyproceed.The foregoing warranty shall not apply to defectsresultingfrom(i)improper or inadequate maintenance by Buyer;(ii)Buyer-supplied equipment,(iii)unauthorized modifications,misuse or accidents,(iv)operation outside of the environmentalspecificationsoftheProduct.All Services shall be performed in professional manner,in conformity withindustrystandards.THIS WARRANTY IS IN LIEU OF ALL OTHER WARRANTIES,EXPRESS ORIMPLIED,INCLUDING WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULARPURPOSE.15.COMPANY INDEMNIFICATION.The Company shall defend any claim,suit,or proceeding broughtagainstBuyerbyathirdparty(“Claim”)insofar as such Claim is based upon an assertion that the use ortransferofanyProductdeliveredhereunderconstitutesinfringementofaUSpatentorregisteredcopyright,provided Buyer (i)notifies the Company promptly in writing as to any such Claim,(ii)grants theCompanysolecontroloverthedefenseandsettlementthereof,and (iii)reasonably cooperates inresponsetoaCompanyrequestforassistance.Should any Product become,or in the Company’sopinionbelikelytobecome,the subject of a Claim,the Company may,at its sole discretion and expense,(a)obtain for Buyer the right to make continued use of such Product,(b)replace or modify such ProductsothattheProductisnolongerinfringing,or (c)request return and upon receipt thereof refund to Buyertheresidualvaluethereof,calculated using straight depreciation over a five (5)year useful life.TheCompanyshallhavenoliabilityiftheallegedinfringementisbasedon(1)combination with non-Companyproducts;(2)use for a purpose or in a manner for which the Product was not designed;(3)use of anyolderversionwhenuseofanewerCompanyrevisionwouldhaveavoidedtheinfringement;(4)anymodificationnotmadewiththeCompany’s written approval;(5)any modifications made by the CompanypursuanttoBuyer’s specific instructions;or (6)any intellectual property right owned or licensed by Buyeroranyofitsaffiliates.Notwithstanding the foregoing,in no event shall the Company’s liability to BuyerunderthisSectionexceedtheamountpaidbyBuyertotheCompanyforanyallegedlyinfringingProduct.THIS SECTION STATES BUYER’S SOLE AND EXCLUSIVE REMEDY AND THE COMPANY’S ENTIRELIABILITYTOBUYERFORTHIRDPARTYINFRINGEMENTCLAIMS.16.BUYER IDEMNIFICATION.Buyer shall defend,indemnify and hold harmless the Company againstanyandalllossesclaims,demands,actions,damages,attorney’s fees and costs,however characterized,including but not limited to those involving personal injury,wrongful death,property damage or diminutionofvalue,business damage or diminution of value,patent or copyright infringement,or any other liabilitiesofanynatureasaresultoftheCompany’s goods,materials,representations (both implicit and explicit)and/or Services,if,and only if,Buyer is at least partially at fault for said liabilities.Buyer’s indemnificationoftheCompanyforpatentandcopyrightinfringementunderthissectionshallalsoapplywhereBuyer(a)modified,altered,or combined the Product with any equipment not supplied by the Company,or (b)usedtheProductinamannerforwhichitwasnotdesigned.17.ENTIRE AGREEMENT.In the absence of a separate,duly executed volume purchase or similaragreementbetweentheCompanyandBuyer,BUYER’S PURCHASE OF THE COMPANY PRODUCTSHEREUNDERREPRESENTSACCEPTANCEOFTHETERMSANDCONDITIONSHEREIN,WHICHCONSTITUTETHEENTIREAGREEMENTBETWEENTHEPARTIESANDSUPERSEDEANYPRIORORCONTEMPORANEOUSCOMMUNICATIONS,REPRESENTATIONS,UNDERSTANDINGS ORAGREEMENTSBYEITHERPARTY,WHETHER VERBAL OR WRITTEN,CONCERNING THESUBJECTMATTERHEREOF.The terms and conditions contained herein take precedence over Buyer’sadditionalordifferenttermsandconditions,to which notice of objection is hereby given.Neither theCompany’s commencement of performance nor delivery shall be deemed or construed as acceptance ofBuyer’s additional or different terms and conditions.No waiver,change,or modification to the terms andconditionhereinshallbevalidorbindingunlessinwritingandsignedbyauthorizedrepresentativesofbothparties.18.ASSIGNMENT.This Agreement may not be assigned by Buyer without prior written consent from adulyauthorizedrepresentativeoftheCompany.This Agreement shall be binding upon the Buyer’spermittedsuccessorsandassigns.19.SURVIVABILITY.If any provision of this Agreement shall be invalid or unenforceable under anyapplicablelaw,such provisions shall not apply in such instance,but the remaining provisions shall begiventheirfulleffectinaccordancewiththeirterms.20.MISCELLANEOUS.Except as prohibited by US bankruptcy laws,in the event of Buyer’s insolvencyorinabilitytopaydebtsdue,or voluntary or involuntary bankruptcy proceeding by or against Buyer,orappointmentofareceiverorassigneeforthebenefitofBuyer’s creditors,the Company may elect tocancelanyunfulfilledobligationstoBuyerhereunder.The Company shall have all rights and remedies ofasecuredcreditorundertheUniformCommercialCode(UCC)and all other applicable laws.BuyeragreestoexecutesuchfinancingstatementsandotherdocumentsastheCompanymayrequestinordertoprotectitssecurityinterest.If Buyer fails to execute such financing statements and other documentswithinfourteen(14)days of written request by the Company,then Buyer hereby grants the Company fullpowerandauthoritytoexecuteandfilesuchfinancingstatementandotherdocumentsonBuyer’s behalf.21.CHOICE OF LAW AND JURISDICTION.The parties agree that any dispute regarding interpretationorvalidityofthesetermsandconditionsorrelatinginanymannertoProductsorServicessoldhereundershallbegovernedbythelaws,and subject to the jurisdiction of courts,of Minnesota,USA,with anydisputeorClaimvenuedorheardintheStateofMinnesota.22.NOTICE.Any notice required under this Agreement shall be valid upon either hand delivery ordeliveryviaUnitedStatesMail,postage prepaid,to the parties at the addresses set forth in this Agreement,and if mailed via United States Mail,postage prepaid,be deemed delivered within three (3) days following the date of mailing. 1.PRICING.All price quotations are valid for fifteen (15)days unless otherwise noted.2.PAYMENT.Unless otherwise quoted by the Company,agreed to in writing or expressly stated on thefaceofthisdocument,terms of payment shall be as follows: a.For new Buyers or those without open account the terms are Prepay. b.For Buyers with open account the terms are:Net ten (10)days unless otherwise stated. c.A 50%down payment will be required for projects requiring significant engineering and design work,orprojectswithnon-standard components provided or manufactured to the Buyer’s requirements,or projectsoveracertainvalueasrequiredintheProposalTerms.Balance due as per a.or b.above. d.A convenience fee of 3%will be added to all credit card payments.This applies to the full amount oftheinvoice. e.The Company may alter or suspend credit whenever the payment history or financial condition ofBuyerwarrantssuchaction. f.Overdue payments will be subject to a 1.5%monthly interest rate. g.Buyer shall be liable for all costs,expenses and attorney’s fees incurred by the Company in thecollectionofdelinquentaccounts.3.CUSTOMER VEHICLES IN OUR CARE,CUSTODY AND CONTROL.The Company is not responsiblefordamagetoBuyervehicleswhileinitscare,custody,and control.4.CUSTOMER VEHICLE STORAGE.Buyer vehicles not picked up within 10 business days of completionwillbeassessedastoragefeeoftendollars($10.00)per day.5.TAXES AND DUTIES.Prices for Products and Services do not include applicable federal,state or localtaxes,now or hereafter enacted,which tax or taxes (i)will be added by the Company to the sales pricewhenevertheCompanyhasthelegalobligationtocollectsame,and (ii)shall be paid by Buyer unlessBuyerprovidestheCompanywithanappropriatetax-exemption certificate.Except as otherwise agreed toinwritingorprovidedonthefacehereof,for sales to points outside the United States all export duties,taxes,licenses,and fees,including customs,are in addition to the quoted prices and shall be Buyer’sresponsibility,and any such cost incurred by the Company will be passed on to Buyer.6.FREIGHT AND SHIPMENTS.All shipments for domestic sales are F.O.B.the Company manufacturingfacility.The Company shall have satisfied all delivery obligations and,subject to the limitations set forthherein,possession of and title to all goods sold hereunder shall be deemed to pass to Buyer upon deliverytothecarrieratpointofshipment,whereupon Buyer assumes all risk of loss or damage to the goods andresponsibilityforshippingandinsurancecosts,regardless of any insurance that may have been secured bytheCompanyatBuyer’s request.Any freight and delivery charges paid by the Company in connection withshipmentstoBuyerwillbepassedontoBuyer.Buyer shall notify the Company in writing relative to anyshipmentshortageordamagewithintwo(2)days of receipt of shipment.The Company shall not be liablefordelaysindeliveryorfailuretomanufactureduetocausesbeyonditsreasonablecontrol.In the event ofanysuchdelayorfailure,the Company shall be entitled to extend the delivery date by a commensurateperiodofdays.The Company shall have the right to cancel any order or to refuse or delay shipment ifBuyerfailstomeetpaymenttermsorifthereisanymateriallyadversechangeinBuyer’s financial status.Export of the Company Products or Services outside the United States of America is subject to the latestU.S.Export Regulation issued by the U.S.Department of Commerce,adherence to which is a Buyer’sresponsibilityafterinitialshipmentbytheCompany.7.ORDER CANCELLATION.If an order is canceled prior to the scheduled ship date,Buyer will be subjecttothefollowingcancellationcharges:Buyer will be responsible for all costs incurred by the Company priortothedateofcancellationandanyfurthercostsincurredintheterminationoftheproject.Cancellation oftheorderwillnotrelievetheBuyer’s liability for payment as specified herein.8.CHANGE ORDERS.Change orders include any deviation from the last design reviewed and agreeduponatthetimethepurchaseorderwasissued.Buyer directed change orders are subject to additionalfees.Depending on the scope of the change order,the Company reserves the right to collect all costsincurredtodate.The added cost of the change order will be quoted by the Company and the Buyer canchooseto(i)issue a second purchase order to cover the cost of the change order,or,(ii)add the additionalchargestotheoriginalpurchaseorder.9.SCHEDULE CHANGES.Any delays in installation due to change orders,customer readiness,and/orreasonsuncontrollablebytheCompany,may be subject to partial invoicing for all labor and materialsincurredtodatebytheCompany.10.PROPRIETARY RIGHTS.The parties acknowledge that the Company may possess certain proprietaryinventions,discoveries,Patents,Trademarks,or other intellectual properties in its products and designsandthattheCompanyretainsallright,title,ownership,copyright and/or other intellectual property rights insuch.All such intellectual property incorporated shall remain the sole and exclusive property of theCompany.11.CONFIDENTIAL INFORMATION.The parties agree that except for the written consent of the otherparty,each party shall keep confidential and not disclose to any person not affiliated with such party,any oftheotherparty’s confidential information and business secrets.The term “confidential information”shallincludeeachparty’s respective financial,marketing,product,process,customer,dealer,accounting,sales,manufacturing,employment and related information,including such other information that a party treats orotherwisedeemsasconfidential.Confidential information shall also include the Company Creations,Services and payment under this Agreement.12.LIMITATION OF LIABILITY.NOT WITHSTANDING ANY OTHER PROVISIONS OF THIS ORDER,INNOEVENTSHALLTHECOMPANYBELIABLEFORANYINCIDENTAL,INDIRECT,SPECIAL,PUNITIVEORCONSEQUENTIALDAMAGESARISINGINANYMANNEROUTOFANYBREACHOFWARRANTYOROUTOFORCONNECTEDWITHTHESALE,LICENSE,LEASE,USE OR ANTICIPATED USE OFTHEPRODUCTS,SERVICES,INCLUDING,BUT NOT LIMITED TO,ANY INTERRUPTION OF SERVICE,LOSS OF BUSINESS OR ANTICIPATORY PROFITS RESULTING FROM THE USE OR OPERATION OFTHEPRODUCTSORPROVISIONOFSERVICES.NOTWITHSTANDING THE FOREGOING,THECOMPANY’S TOTAL CUMULATIVE LIABILITY UNDER THIS ORDER SHALL NOT EXCEED THEAMOUNTPAIDBYBUYERFORTHEPARTICULARPRODUCTSORSERVICESINVOLVED. 8 // (952) 224.4440 //15100 BUSINESS PARKWAY, ROSEMOUNT, MN 55068 //Page 146 of 899 City of Lakeville Fire Department Memorandum To: Mayor and City Council Members Justin Miller, City Administrator From: Michael Meyer, Fire Chief Copy: Date: 10/01/2025 Subject: Consent to Purchase – Rescue Truck Background The Fire Department continually evaluates its fleet to ensure that apparatus meet the operational and service delivery needs of our growing community. Traditionally, fire engines are staffed and respond to a wide variety of fire and rescue calls. However, a review of call data shows that a significant percentage of the department’s responses are medical in nature, often requiring fewer personnel and less apparatus capacity than a full engine. To better align with current and future service demands, staff is recommending the purchase of a rescue truck in lieu of a replacement fire engine that was scheduled for replacement in 2025. Proposal The rescue truck will: • Respond to two-person medical calls, reducing the wear and mileage placed on larger fire engines. • Be equipped with emergency medical response capabilities to support patient care and transport assistance. • Include a plow attachment, enabling the vehicle to clear fire station aprons, access routes, and even emergency paths during severe snow events. This will ensure timely access for larger apparatus, ambulances, and mutual aid partners. This approach provides a more versatile, cost-effective solution compared to adding another full fire engine to the fleet. Fiscal Impact The rescue truck purchase cost will be $134,506, which is less than the cost of a new fire engine ($845,000–$925,000 range). Recommendation Page 147 of 899 Staff recommends approval of the purchase of a rescue truck in place of a replacement fire engine. This purchase will enhance operational efficiency, reduce long-term maintenance costs, and improve response capabilities during both medical calls and snow emergencies. Page 148 of 899 Date: 10/6/2025 Resolution Appointing Members to the Youth Advisory Commission Proposed Action Staff recommends adoption of the following motion: Approve a resolution that adopts the Youth Advisory Commission roster for the 2025/2026 term. Overview All members of the roster have been interviewed and selected by the Council to serve on this Commission. These members are leaders in their community and help Council gain an understanding of how Lakeville's youth view the community and the challenges and issues that impact them. The roster consists of eight members who represent four high schools in the Lakeville community. Supporting Information 1. Council Resolution Appointing Members Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Taylor Snider Page 149 of 899 CITY OF LAKEVILLE RESOLUTION NO. ____ Resolution Appointing Members to the Lakeville Youth Advisory Commission WHEREAS, the City Council has established a City of Lakeville Youth Advisory Commission, and WHEREAS, candidates were interviewed by the City Council, and WHEREAS, according to the approved by-laws, members are appointed to a two-year term beginning October 1, 2025 NOW, THEREFORE, BE IT RESOLVED that the following are appointed to the City of Lakeville Youth Advisory Commission: Name Term Expiration Faisal Ali 9/30/2026 Imran Ali 9/30/2026 Addison Johnson 9/30/2026 Zavieanna Johnson 9/30/2027 Faadumo Mohamed 9/30/2026 Olivia Schmidt 9/30/2027 Katie Sheehan 9/30/2026 Savannah Smalley 9/30/2027 ADOPTED by the Lakeville City Council this 6th day of October 2025 ______________________________ Luke Hellier, Mayor _________________________________ Ann Orlofsky, City Clerk Page 150 of 899 Date: 10/6/2025 Change Order for Highview Ave Trail Repair and Laigle Ave Cul-de-sac Installation Proposed Action Staff recommends adoption of the following motion: Move to approve a change order with Northwest Asphalt Inc. for Highview Ave Trail Repairs and the Laigle Ave Cul-de-sac Installation. Overview On August 22, 2025, a watermain break occurred along the east side of Highview Avenue between 168th Street and Hearthside Way. The adjacent trail sustained significant damage and has been closed to the public since the incident. Staff solicited multiple quotes for the trail repairs, which ranged from $21,994 to $27,280, to complete the work prior to winter. This is a heavily used trail that is plowed and maintained year-round. City staff reviewed all quotes and recommends approving the low quote from Northwest Asphalt, Inc. in the amount of $21,994. Funding for this work will come from the Water Operating Fund. Laigle Avenue is a gravel road located in the northwestern quadrant of the City. Currently, there is no cul-de-sac or turnaround for garbage trucks, plow trucks, or emergency vehicles. Staff has been working with the property owners at the southern end of the road to facilitate the project and has designed and solicited quotes to construct a cul-de-sac within City right-of-way. The City received three quotes ranging from $21,902.72 to $37,035. Northwest Asphalt, Inc. submitted the low quote. City staff reviewed all quotes and recommends approval of the low quote to Northwest Asphalt, Inc. Funding for this work will come from the Pavement Management Fund. The work is proposed to be added to a contract the City currently has with Northwest Asphalt. Supporting Information 1. Change Order 2. NWA quote for Highview Trail Repair 3. McNamara quote for Highview Trail Repair 4. NWA quote for Laigle CDS 5. GMH quote for Laigle Ave CDS 6. McNamara quote for Laigle CDS Financial Impact: $43,896.72 Budgeted: Yes Source: Multiple Sources Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Steve Ferraro, Public Works Coordinator Page 151 of 899 Page 152 of 899 Page 153 of 899 Page 154 of 899 To:Contact:City Of LakevilleHighview Trail Watermain BreakProject Name:Bid Number:Fax:Address:Lakeville, MN 55044Phone:Project Location:Bid Date:9/30/2025Addendum #:-Total PriceUnit PriceUnitItem DescriptionItem #Estimated Quantity11.00 LS $2,500.00 $2,500.00MOBLIZATION2200.00 SY $30.00 $6,000.00REMOVE BITUMINOUS TRAIL350.00 CY $70.00 $3,500.00COMMON EXCAVATION436.00TON$105.00 $3,780.00AGGREGATE BASE CLASS 5 (RECYCLE)5200.00 SY $40.00 $8,000.003" BITUMINOUS TRAIL PAVEMENT (SPWEA240B(R))61.00 LS $3,500.00 $3,500.00TRAFFIC CONTROLTotal Bid Price:$27,280.00Notes:•The above pricing is for line items as described at quantities provided by the city. Project to be billed based on actual quantity installed as measured in the field.• Bond is included at 0.15%• Additional work or work not within scope of line items to be billed as T&M pricing.• Quote assumes fully loaded 4 and/or 5 axle dump trucks will have access to all areas of our work. Further, this quote assumes that said fullyloaded trucks will not be detrimental (cause rutting and/or deflection) to the material we are installing bituminous on top of.• We reserve the right to negotiate the terms of any binding contract. This includes, but is not limited to, requiring that this quote and notes areincluded in said contract.Payment Terms:Payment due within 10 days after payment is made by Owner or within 30 days of invoice; whichever is soonerACCEPTED:The above prices, specifications and conditions are satisfactory and are hereby accepted.Buyer:Signature:Date of Acceptance:CONFIRMED:McNamara Contracting, Inc.Authorized Signature:Estimator:Lucas Henry612-655-3695 lucash@mcnamaracontracting.com9/30/2025 2:57:36 PMPage 1 of 1Page 155 of 899 Page 156 of 899 9/26/2025 1:14:16PM LAKEVILLE-LAIGLE AVE CUL-DE-SAC CHASKA, MN 55318 9180 LAKETOWN ROAD GMH ASPHALT CORPORATION DAVID SWANSON 952-442-5288 estimating@gmhasphalt.com Contact: Phone: Email: Addendums:Quote To:STEVE FERRARO Date on Plans: Company:Revision Date:CITY OF LAKEVILLE No Bond Union 49 Contractor AMOUNTITEM DESCRIPTION QUANTITY UNIT UNIT PRICE MOBILIZATION LS1.00 10 5,000.00 5,000.00 COMMON EXCAVATION CY67.00 20 124.97 8,372.99 CLASS 5 - 12''TN114.00 30 102.81 11,720.34 HAUL OUT STUMP EA1.00 40 876.39 876.39 GRAND TOTAL $25,969.72 NOTES: ITEMS NOT INCLUDED IN QUOTE: Bond, topsoil or seeding, traffic control, saw cutting, removals, testing, sweeping, manhole/gate valve adjusts, permits, incidental bituminous wedge curb protection, leaf blowing, any special insurances. Page 1 of 1 Page 157 of 899 To:Contact:City Of LakevilleLaigle Ave Cul-de-sacProject Name:Bid Number:Fax:Address:Lakeville, MN 55044Phone:Project Location:Bid Date:7/25/2025Addendum #:-Total PriceUnit PriceUnitItem DescriptionItem #Estimated Quantity11.00 LS $8,600.00 $8,600.00Mobilization267.00 CY $135.00 $9,045.00Common Excavation3114.00TON$135.00 $15,390.00Class 5 Recycle41.00 EACH $4,000.00 $4,000.00GrubTotal Bid Price: $37,035.00Notes:•The above pricing is per quantities provided by the city for the scope as described. To be billed at unit price based on actual quantity installed.• Bond is included at 0.15%• We reserve the right to approve the area we will be paving prior to mobilizing to the job. This may include, but is not limited to, being present fortest rolling, string lining, and/or any other density and/or grade tests prior to mobilizing for our work.• Quote assumes fully loaded 4 and/or 5 axle dump trucks will have access to all areas of our work. Further, this quote assumes that said fullyloaded trucks will not be detrimental (cause rutting and/or deflection) to the material we are installing bituminous on top of.• We reserve the right to negotiate the terms of any binding contract. This includes, but is not limited to, requiring that this quote and notes areincluded in said contract.Payment Terms:Payment due within 10 days after payment is made by Owner or within 30 days of invoice; whichever is soonerACCEPTED:The above prices, specifications and conditions are satisfactory and are hereby accepted.Buyer:Signature:Date of Acceptance:CONFIRMED:McNamara Contracting, Inc.Authorized Signature:Estimator:Lucas Henry612-655-3695 lucash@mcnamaracontracting.com9/15/2025 12:32:16 PMPage 1 of 1Page 158 of 899 Date: 10/6/2025 DNR License for Utility to Cross Public Waters Proposed Action Staff recommends adoption of the following motion: Move to approve a DNR License for a fiber optic utility to cross public waters for Grand Prairie Park. Overview Fiber optic cable is required to support communications at the new Grand Prairie Park. The fiber optic contractor plans to extend the cable along Cedar Avenue to the park and will need to cross a DNR protected waterway south of 181st Street. A license agreement is necessary to allow construction, maintenance, and operation of the fiber optic cable at this crossing. Supporting Information 1. DNR Utility Public Waters Crossing License 2. DNR License Letter Financial Impact: $124.00 Budgeted: Yes Source: Park Fund, 4721.6280 Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Paul Oehme, Public Works Director Page 159 of 899 Page 1 of 4 License Number UWAT014338 MINNESOTA DEPARTMENT OF NATURAL RESOURCES LICENSE NUMBER UWAT014338 COMPANY PROJECT NO: 32961 - LOGIS LICENSE FOR UTILITY TO CROSS PUBLIC WATERS This license is issued by the State of Minnesota, acting by and through its commissioner of natural resources, and hereafter called the “State”, under authority and subject to Minnesota Statutes, section 84.415, and Minnesota Rules Chapter 6135 and other applicable law, to the Licensee as named and for the fee and term as specified below. Name and Address of Licensee: City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 License Fee: One hundred twenty-four and NO/100 Dollars ($124.00) Term (years): 50 Years Effective Date: October 1, 2025 Expiration Date: September 30, 2075 Purpose of License: Construction, maintenance and operation of a fiber optic communication line under water under the covenants and agreements of the Licensee to use the following described waters: That part of the following descriptions as shown on the attached application and map, all of which are made a part hereof by reference. Unnamed Stream in NW ¼ NW ¼ in Section 15, Township 114 North, Range 20 West, in Dakota County This license is granted subject to the following provisions: 1.Use of premises. A.This license is subject to the provisions of Minnesota Statutes, section 84.415 and Minnesota Rules Chapter 6135. All standards of Chapter 6135 are incorporated as terms and conditions of this license, except such variations as are identified and approved by the State in the license applications, plans and specifications which are attached and made part of the terms and conditions of this license. The Licensee is bound by the crossing location and installation method as detailed in the application and approved by the State. The Licensee shall not deviate from the terms and conditions of this license or the application as approved by the State unless it has first obtained written permission from the State. B.When the installation occurs more than six months after the issuance of the license, the Licensee shall contact the State 20 days prior to installation. C.No merchantable timber shall be cut, used, removed or destroyed without first paying the State the timber value in the sum stated above as determined by the State. Slash material on state water crossings must be disposed of within 30 days of clearing activities. D.For overhead crossings of state waters, lines shall have a minimum clearance of 25 feet above the water, unless otherwise approved by the State. E.When directed by the State as a condition of the license, flight diverters shall be placed on overhead utility lines. F.Any cable or conduit located at a shoreline shall be sufficiently buried so that it does not become exposed. G.When directed by the State as a condition of the license, underwater crossings shall be marked by permanent signs on the banks at the points where the line enters and leaves the public waters. H.To protect fish spawning activities, the State may prohibit work in the public water or within a specified distance of the public water during the spawning season. 2.State’s rights and reservations. The use of these waters by the Licensee in constructing or maintaining the lines for which this license is granted shall be subject to the use, sale, or leasing for mineral or other legal purposes. The Page 160 of 899 Page 2 of 4 License Number UWAT014338 Licensee will not cause any unnecessary hindrance to the activities of the State and shall allow access across the license area by the State when needed. 3.Erosion and Revegetation. A.Erosion control measures shall be adequately designed for site characteristics. They shall be installed prior to commencement of construction and maintained for as long as needed. All erosion control measures installed next to a water body shall run parallel to the contours. B.All disturbed areas shall be restored to original contours and elevations and stabilized as soon as possible following construction. Areas of subsidence and crowning shall be repaired. Topsoil shall be reserved on site and used to re-dress disturbed areas. C.All disturbed areas shall be revegetated using state approved seed mixes. All seed and plant materials shall be certified weed-free. Weed-free straw or hay shall be used for mulching and erosion control. Native species plants should be used, whenever possible, to revegetate disturbed areas. This revegetation should occur as early in the season as possible to permit adequate regrowth. D.The Licensee shall monitor revegetation at state water crossings until the site is stabilized and the vegetation is self-sustaining. Where severe or repeated damage is occurring or where measures have not been successful, preventative and corrective actions shall be taken by the Licensee, including construction of appropriate barriers, installation of warning signs, and other methods in consultation with the State. E.The Licensee shall routinely inspect for erosion that may develop during the term of the license. Areas of erosion shall be stabilized by the Licensee. F.If a disturbed area cannot be stabilized with vegetation before September 15 in the year that the utility was installed, the Licensee shall submit a written site stabilization plan to the State for approval. This plan shall describe erosion control, mulching, dormant seeding and monitoring. Seeding shall occur as soon as soil conditions are suitable. G.Excavated materials shall not be deposited or stored alongside public water in a manner where the materials can be redeposited into the public water by reasonably expected high water or storm run-off. 4.Herbicides and Pesticides. A.The Licensee must request and obtain written permission to apply herbicides or pesticides to state waters from the State prior to treatment. This request shall consist of (1) a map identifying proposed treatment areas and (2)a description of the proposed treatment plan, including target species, herbicide or pesticide name, rate of application, a description of application method, and beginning and end dates. All applications must be according to label regulations and as otherwise specified by the State. The Licensee shall not apply pesticides that are restricted for use on certified state forest land administered by the State. B.The Licensee must submit annual reports detailing herbicide or pesticide application on areas covered under the license. The report must include the dates, acres, location expressed as quarter-quarter section, township and range, herbicide or pesticide used, target species, and such other information as may be reasonably required by the State for the purpose of verifying herbicide or pesticide use. C.The Licensee shall post all places commonly used by the public for access along the utility corridors treated with herbicides or pesticides. 5.Invasive Species. A.The Licensee shall inspect all state water crossings for the presence of invasive species and noxious weeds prior to commencing clearing activities and take action to prevent their spread. For installation of the utility line, the State will identify on a map the known infested sites to be avoided. For maintenance and operation, the Licensee is responsible for obtaining updated information on known infested sites. B.If the State or the Licensee discover additional invasive species infestation areas on state water crossings during construction, the Licensee shall immediately take action to prevent spread from the newly discovered infested area and then consult with the State on a resolution. C.The Licensee shall prevent invasive species from entering into or spreading within state water crossing by cleaning equipment and clothing prior to arriving at the license area. The Licensee shall legally dispose of material cleaned from equipment and clothing at a location offsite and the materials must be secured prior to transport to avoid dispersal. D.Whenever possible, parking, staging areas and travel routes shall not be within known infested sites. Where there are multiple state water crossings and at least one contains invasive species, the Licensee shall to the extent practicable start work at the site with the fewest number of invasive plants, leaving the most heavily Page 161 of 899 Page 3 of 4 License Number UWAT014338 infested sites to last. The Licensee shall make every effort to schedule operations and site visits to avoid the spread of weed seed. E.The Licensee shall continue to control invasive species on state water crossings for the terms of the license using methods approved by the State. 6.Crossing of State Trail. A.The location of any crossing of a state trail must be approved in advance by the State. The State may provide written instructions as to specific construction standards to be followed for the crossing of the state trail. B.Utility installation and maintenance activities shall be conducted in a manner so as to minimize disturbance of state trail use and to separate the public from work areas. The Licensee must provide signs to warn state trail users of construction hazards. C.The Licensee is responsible for repairing any damage to the state trail in a manner satisfactory to the State. D.For maintenance and operations, prior approval must be obtained from the State for the cutting or trimming of trees within the state trail right-of-way. E.The Licensee may not close the state trail right-of-way without the prior written approval of the State. 7.Maintenance, operations and repairs. A.The Licensee must keep the premises in a neat and orderly condition, and shall remove all refuse and debris that may accumulate thereon. B.After initial installation, no merchantable timber shall be cut, used, removed or destroyed by the Licensee without first contacting the State at least 60 days in advance to determine if a timber payment is needed. Slash material on state water crossings must be disposed of within 30 days of maintenance activities. C.Emergency repairs and replacements may be made without prior notification to the State by the Licensee according to conditions and standards prescribed by Minnesota Rules, Chapter 6135 and the method of installation identified in this license. The Licensee shall notify the State of this activity as soon as practicable. D.The Licensee shall employ appropriate erosion and sedimentation measures at the site during any emergency repairs. The State must approve plans for restoration of the site after the emergency repairs are conducted. E.Other than the herbicide or pesticide application reporting as provided in paragraph 4, the Licensee shall notify the State of the extent and method of any routine maintenance and the proposed schedule. The notification must be in writing and must be provided either annually or at least 20 days prior to commencing any routine maintenance work on state water crossings subject to this license. The Licensee shall include a specific description of the proposed maintenance activities including location, clearing methods, erosion and sedimentation control measures, removal of merchantable timber, revegetation plans, and plans for preventing the spread of invasive species. The Licensee may commence any routine maintenance work unless notified to the contrary by the State within 20 days after the State’s receipt of the maintenance plan. The State may require the Licensee to adjust its maintenance plans due to natural resource management concerns. 8.State inspection. The project hereunder shall at all times during and after construction be subject to inspection by the State and for that purpose the Licensee shall grant access to the premises at all reasonable times. 9.Compliance with laws. The Licensee shall comply with all federal, state and local laws and regulations, including municipal ordinances, affecting said lands or the area in which they are situated. 10.Taxes and assessments. The Licensee will pay when due all taxes and assessments levied against said waters or any improvements owned, used, or controlled by the Licensee, provided that the taxes or assessments are imposed due to this license. 11.Enforcement. No delay by the State in enforcing any of the conditions of this license shall operate as a waiver of any of its rights. 12.Liability. This license is permissive only. No liability shall be imposed upon or incurred by the State of Minnesota or any of its officers, agents, or employees, officially or personally, on account of the granting of the license or on account of any damage to any person or property resulting from any act or omission of the Licensee or any of its agents, employees, or contractors relating to any license matter. This license shall not be construed as estopping or limiting any legal claims or right of action of any person against the Licensee, its agents, employees, or contractors for any damage or injury resulting from any such act or omission, or as estopping or limiting any legal claim or right of action of the State against the Licensee, its agents, employees, or contractors, for violation of or failure to comply with the provisions of the license or applicable provisions of law. The Licensee shall indemnify and hold Page 162 of 899 Page 4 of 4 License Number UWAT014338 harmless the State from all claims arising out of the Licensee's use of the above described lands whether such claims are asserted by civil action or otherwise. 13.Termination and cancellation. A.At the end of the license period and if both parties wish to renew, the renewal fee will be determined by the State. B.This license shall be cancelable upon reasonable notice by the State for violation of any of its terms, or if at any time its continuance will conflict with a public use of the land over or upon which it is granted, or for any other reason. Licensee shall ensure that Licensee's employees, agents and contractors have received and thoroughly understand all conditions of this license. C.Unless otherwise authorized by the State, upon the surrender, expiration or cancellation of this license, the Licensee shall remove from the above described lands all the utility lines and related structures owned by it. If Licensee does not remove such lines or related structures, all such lines or structures remaining shall become the property of the State, to be used or disposed of as the State elects. If the State requires the Licensee to remove utility lines and related structures and Licensee fails to do so, the Licensee agrees to pay the State for the costs of removing and disposing of such lines or structures. 14.Assignment or transfer. The Licensee shall not without the State's prior written consent: a) assign, convey or otherwise transfer this license or any interest under it; b) sublet the license corridor or any part thereof; or c) permit the use or occupancy of the license corridor or any part thereof by anyone other than the Licensee. This license shall extend to, and bind the successors, heirs, legal representatives and assigns of the Licensee, if any. The State may require a party who has requested to sublet, use or occupy the license corridor to obtain a separate license from the State prior to occupying or using the license corridor. 15.Reports. The Licensee must submit reports on herbicide and pesticide use as provided in paragraph 4 and maintenance and repair work as provided in paragraph 7. 16.Contacts. The contact for the State is the Regional Lands and Minerals Manager, who is at the time of license issuance Joe Rokala at 218-328-8923. Any questions about this license shall be directed to the Regional Lands and Minerals Manager. The Regional Lands and Minerals Manager may direct the Licensee to contact additional State staff for reviews and approvals. 17.Special provisions. This license is subject to the SPECIAL PROVISIONS attached hereto. None. ACCEPTED AND ACKNOWLEDGED CITY OF LAKEVILLE Licensee By ________________________________________ Name ______________________________________ Title _______________________________________ Date _______________________________________ Form approved by Lands and Minerals Division, DNR, March 5, 2015. STATE OF MINNESOTA DEPARTMENT OF NATURAL RESOURCES By ____________________________________________ Regional Manager Lands and Minerals Division Date ___________________________________________ Page 163 of 899 Minnesota Department of Natural Resources • Central Region • Division of Lands and Minerals 1200 Warner Rd, St Paul, MN 55106 Central Region Division of Lands and Minerals 1200 Warner Rd St Paul, MN 55106 September 23, 2025 Paul Oeheme City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 RE: License # UWAT014338 Legal Description: Covering certain public water in Dakota County Company Project No. 32961 - LOGIS Dear Licensee: Attached is a copy of the above license for execution by your company. The application is not included in this mailing but will be made a part of the final license when completed. The license is for a 50-year period commencing on October 1, 2025. A fee of $124.00 is payable upon return of this license. You are required to comply with the terms of the license including certain construction procedures. Please have the license signed by an officer of your company, with the officer’s title listed beneath his or her signature. If it is signed by a person who is not an officer of the company, please provide a copy of the power of attorney or board resolution which authorized this person to sign on behalf of the company. You can sign with a certified digital or wet signature and email or mail it to me at our office for execution by the State. Do not write on the license or alter it in any way. Issuance of this license to cross Public Waters does not imply authorization to cross State Lands. A separate license must be obtained to cross State Lands. Please mail your check directly to our office at Minnesota Department of Natural Resources, attention Lands and Minerals, 1200 Warner Road, St. Paul, MN 55106. Enclose payment of $124.00 made payable to the Department of Natural Resources. Payment is for the term of the license. The executed license with application and attachments will be sent to you for your files within 2-3 weeks. Please contact me 10 days prior to installation and within 10 days following completion of licensed work. Once construction is completed, please send me the “as-built survey,” if one is available, for the crossings incorporated under this license. If you have any questions, please contact me at 507-233-1254 or Stacy.Bratsch@state.mn.us. Thank you. Sincerely, Stacy Bratsch Realty Specialist Attachment(s) cc: Army Corps of Engineers cc: Kaitlyn Henderson, I&S Group, 115 East Hickory Street, Suite 300, Mankato, MN 56001 Page 164 of 899 Date: 10/6/2025 Amend the 2025 General Fund and Building Fund Budgets Proposed Action Staff recommends adoption of the following motion: Move to approve the Resolution Amending the 2025 General Fund and Building Fund Budgets. Overview The City’s October 2024 software transition to BS&A enabled staff to better categorize revenue items by department and identify areas where expenditure accounts required adjustment. As a result, many of the budget amendments outlined in Exhibit A are reclassifications that net to zero and serve to clean up and align the budget more accurately. Additionally, the use of remaining 2023 Public Safety funds – totaling $1,850,000 – for the purchase of land for the new Fire Station #5 was approved by Council on June 2, 2025 (Resolution 25-082). This amendment reflects the transfer of those funds from the General Fund to the Building Fund. The actual State Aid amounts for Fire and Police were received on October 1, 2025. Budget amendments have been made to reflect the increased revenues and expenditures accordingly. These amendments ensure continued compliance with the City's financial policies and provide a more accurate representation of operating revenues and expenditures. Supporting Information 1. Resolution Amending 2025 General-Building Fund Budgets 2. 2025 Budget Amendment Rpt_Exhibit A Financial Impact: $ 80,240 Budgeted: No Source: Various Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Julie Stahl, Finance Director Page 165 of 899 CITY OF LAKEVILLE RESOLUTION NO. ________ Resolution Amending the 2025 General Fund and Building Fund Budgets BE IT RESOLVED by the City Council of the City of Lakeville, Minnesota as follows: 1. The 2025 budgets for the General Fund and Building Fund are hereby amended for the fiscal year ending December 31, 2025 as per Exhibit A, as attached hereto. ADOPTED by the Lakeville City Council this 6th day of October, 2025. ________________________________ Luke M. Hellier, Mayor ________________________________ Ann Orlofsky, City Clerk Page 166 of 899 09/30/2025 BUDGET AMENDMENT REPORT FOR CITY OF LAKEVILLE EXHIBIT A CHANGE POST TO BUDGET GL Number Category DATE REF #DESCRIPTION INCRS(DECRS) 1000.1000.4256 Rev - Intergovt'l 7/1/2025 00002398 FEDERAL TRAFFIC SAFETY GRANT- TO PD (15,000) 1000.1220.4256 Rev - Intergovt'l 7/1/2025 00002398 FEDERAL TRAFFIC SAFETY GRANT- TO PD 15,000 1000.1000.4256 Rev - Intergovt'l 7/1/2025 00002398 FEDERAL SAFER GRANT- TO FD (1,515,436) 1000.1310.4256 Rev - Intergovt'l 7/1/2025 00002398 FEDERAL SAFER GRANT- TO FD 1,515,436 1000.1000.4256 Rev - Intergovt'l 7/1/2025 00002398 FEDERAL DOJ VEST GRANT- TO PD (6,000) 1000.1220.4256 Rev - Intergovt'l 7/1/2025 00002398 FEDERAL DOJ VEST GRANT- TO PD 6,000 1000.1000.4256 Rev - Intergovt'l 7/1/2025 00002398 CDBG- DARTS SENIOR BUSING SERVICES TO CD (35,000) 1000.1105.4256 Rev - Intergovt'l 7/1/2025 00002398 CDBG- DARTS SENIOR BUSING SERVICES TO CD 35,000 1000.1000.4256 Rev - Intergovt'l 7/1/2025 00002398 CDBG- SENIOR CHORES TO CD (5,000) 1000.1105.4256 Rev - Intergovt'l 7/1/2025 00002398 CDBG- SENIOR CHORES TO CD 5,000 1000.1000.4256 Rev - Intergovt'l 7/1/2025 00002398 CDBG- DOWNTOWN DEV GRANT TO CD (15,000) 1000.1105.4256 Rev - Intergovt'l 7/1/2025 00002398 CDBG- DOWNTOWN DEV GRANT TO CD 15,000 1000.1000.4280 Rev - Intergovt'l 7/1/2025 00002398 STATE FIRE TRAINING GRANT- TO FD (25,000) 1000.1300.4280 Rev - Intergovt'l 7/1/2025 00002398 STATE FIRE TRAINING GRANT- TO FD 25,000 1000.1000.4280 Rev - Intergovt'l 7/1/2025 00002398 FORESTRY-SHADE TREE GRANT- TO 1455 (113,000) 1000.1455.4230 Rev - Intergovt'l 7/1/2025 00002398 FORESTRY-SHADE TREE GRANT- TO 1455 113,000 1000.1200.4259 Rev - Intergovt'l 7/1/2025 00002398 CADET OFFICER ICPOET GRANT- TO PD (100,000) 1000.1244.4259 Rev - Intergovt'l 7/1/2025 00002398 CADET OFFICER ICPOET GRANT- TO PD 100,000 BA # 2398 Subtotal 0 1000.1000.5020 Rev - Misc 7/1/2025 00002399 MANUFACTURER EVENT DONATIONS- TO 1105 (2,000) 1000.1000.5020 Rev - Misc 7/1/2025 00002399 COMM. ENGAGEMENT DONATIONS TO 1200 (20,000) 1000.1000.5020 Rev - Misc 7/1/2025 00002399 FIRE RESCUE EQUIPMENT/OTHER- TO 1300 (5,000) 1000.1105.5020 Rev - Misc 7/1/2025 00002399 MANUFACTURER EVENT DONATIONS- TO 1105 2,000 1000.1200.5020 Rev - Misc 7/1/2025 00002399 COMM. ENGAGEMENT DONATIONS TO 1200 20,000 1000.1300.5020 Rev - Misc 7/1/2025 00002399 FIRE RESCUE EQUIPMENT/OTHER- TO 1300 5,000 BA # 2399 Subtotal 0 1000.1005.6310 Exp - Other Chrgs 1/1/2025 00002454 BUDGET AMENDS RECLASS W/SAME DEPT (4,300) 1000.1005.6352 Exp - Other Chrgs 1/1/2025 00002454 BUDGET AMENDS RECLASS W/SAME DEPT 750 1000.1005.6353 Exp - Other Chrgs 1/1/2025 00002454 BUDGET AMENDS RECLASS W/SAME DEPT 750 1000.1005.6354 Exp - Other Chrgs 1/1/2025 00002454 BUDGET AMENDS RECLASS W/SAME DEPT 750 1000.1005.6355 Exp - Other Chrgs 1/1/2025 00002454 BUDGET AMENDS RECLASS W/SAME DEPT 1,300 1000.1005.6357 Exp - Other Chrgs 1/1/2025 00002454 BUDGET AMENDS RECLASS W/SAME DEPT 750 BA # 2454 Subtotal 0 1000.1000.7413 Exp (Gen) Trsfr Out 6/2/2025 00002588 RES 25-082 CP25-18 ROW 2025-06-02 1,850,000 4000.4025.5410 Rev (Bldg) Trsfr In 6/2/2025 00002588 RES 25-082 CP25-18 ROW 2025-06-02 (1,850,000)* BA # 2588 Subtotal 0 1000.1090.6210 Exp - Other Chrgs 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS 4,988 1000.1050.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (105) 1000.1070.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (35) 1000.1080.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (280) 1000.1085.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (140) 1000.1090.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (175) 1000.1105.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (210) 1000.1120.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (408) 1000.1130.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (105) 1000.1200.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (105) Page 167 of 899 1000.1210.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (385) 1000.1222.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (35) 1000.1225.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (70) 1000.1300.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (578) 1000.1310.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (234) 1000.1400.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (175) 1000.1410.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (105) 1000.1440.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (175) 1000.1455.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (70) 1000.1590.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (863) 1000.1690.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (630) 1000.1700.6057 Exp - Personnel 9/29/2025 00002820 2025 FSA PLAN TO HR PROF SVCS (105) BA # 2820-A Subtotal 0 1000.1200.4231 Rev - Intergovt'l 9/29/2025 00002820 UPDATE FIRE & PD STATE AID (96,176)* 1000.1305.4233 Rev - Intergovt'l 9/29/2025 00002820 UPDATE FIRE & PD STATE AID (99,370)* 1000.1305.6045 Exp - FRA Contrb 9/29/2025 00002820 UPDATE FIRE & PD STATE AID 113,906 1000.1305.6210 Exp - Other Chrgs 9/29/2025 00002820 UPDATE FIRE & PD STATE AID 1,400 BA # 2820-B Subtotal (80,240) * Note - these are Increases to the budget line items Page 168 of 899 Date: 10/6/2025 Resolution Authorizing Temporary Closing of City Streets for the Downtown Lakeville Boo (DLBoo) Event Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution authorizing the temporary closing of city streets for DLBoo. Overview The Downtown Lakeville Business Association has partnered with Lakeville Parks & Recreation to host a trick-or-treating event at the local downtown businesses along Holyoke. The resolution authorizes temporarily closing Holyoke Avenue between 207th Street to 209th Street in downtown Lakeville. See the attached location map. No parking signs will be placed on Friday, October 24, 2025, so that cars are not parked on Holyoke when the barricades go up. Supporting Information 1. Exhibit A -2025 DLBoo Street Closure Resolution 2. DLBoo Map Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: A Sense of Community and Belonging Report Completed by: Ann Orlofsky, City Clerk Page 169 of 899 CITY OF LAKEVILLE RESOLUTION NO._________ RESOLUTION AUTHORIZING TEMPORARY CLOSING OF CITY STREETS FOR THE DOWNTOWN LAKEVILLE BOO (DLBOO) EVENT BE IT RESOLVED that the city streets listed on the attached Exhibit A shall be temporarily closed by the Lakeville Street and Police Departments for the DLBoo event on Saturday, October 25, 2025; and BE IT FURTHER RESOLVED that the Police Chief or his designee has the authority to temporarily close city streets not listed on the attached exhibit if necessary. APPROVED this 6th day of October 2025. CITY OF LAKEVILLE: _________________________ Luke M Hellier, Mayor ATTEST: _________________________ Ann Orlofsky, City Clerk Page 170 of 899 Exhibit A STREET CLOSURE: DATE: TIME: DLBoo Event: HOLYOKE AVENUE Upper 207th St to 209th St October 24, 2025 (Friday) – October 25,2025 (Saturday)) 5:00 p.m. until 5:00 p.m. Trick-or-Treating on Holyoke Avenue Page 171 of 899 DLBoo Event Map XXX Barricades Closure of Holyoke Ave XXX XXX XX XX XX XX XX Page 172 of 899 Date: 10/6/2025 Master Agreement with Lakeville Lacrosse for Facility Use Proposed Action Staff recommends adoption of the following motion: Move to approve Master Agreement with Lakeville Lacrosse Association (LAA) for Facility Use. Overview The construction of Grand Prairie Park was approved as part of the November 2021 Park Bond Referendum. The future park was identified as a potential spot for LAA to have consistent access to fields for their usage. During the planning and design phase, staff consulted with representatives of their organization to incorporate amenities at Grand Prairie Park that would meet their usage needs. In addition to the multi-purpose athletic decks, a 12’ by 32’ practice wall and 10’ by 20’ storage garage will be located at the park for LAA usage. LAA agreed to donate $61,000 towards the construction and installation of these amenities that will be paid over the course of the next five years. While this master agreement will apply to all aspects of LAA's usage of Grand Prairie Park, it will also encompass the usage of Aronson, Cedar Crossing, Quigley-Sime, and Spyglass Parks. Representatives from LAA and city staff have met to discuss the attached agreement and recognize the mutual benefit of repealing any past agreements and executing an all- encompassing agreement for LAA’s usage of city park fields and facilities. Supporting Information 1. Master Agreement with Lakeville Lacrosse Association Financial Impact: $61,000 Budgeted: No Source: Donations Envision Lakeville Community Values: Access to a Multitude of Natural Amenities and Recreational Opportunities Report Completed by: Susan Johnson, Recreation Manager Page 173 of 899 Page 174 of 899 Page 175 of 899 Page 176 of 899 Page 177 of 899 Page 178 of 899 Page 179 of 899 Page 180 of 899 Page 181 of 899 Date: 10/6/2025 Contract with Action Target to Supply Tactical Wall System for the FiRST Center Proposed Action Staff recommends adoption of the following motion: Move to approve a contract with Action Target to supply the tactical wall system for the FiRST Center. Overview The FiRST Center includes training space for the installation of a tactical wall system for use by public safety personnel. The tactical wall system includes movable walls and partitions that can be used to create multiple scenarios for training in various situations depending on the needs of the user. The city, with the help of LAD Architects and RJM Construction, prepared plans and specifications that were sent out to several vendors to obtain bids to supply the tactical wall panel system. Action Target and Mobile Police Training Structures submitted bids in response to the request. Action Target was the only respondent to provide a complete bid bond and responsible contractor form as required by the RFP. Action Target’s bid also included a 3-year warranty and a full day of training in how to install and modify their system as needed. Staff recommends approval of a contract with Action Target to supply the tactical wall system for the FiRST Center at a cost of $177,525. Supporting Information 1. (1) Action Target Proposal 2. (2) Action Target Contract Financial Impact: $177,525 Budgeted: Yes Source: FiRST Center Project Fund Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Allyn Kuennen, Assistant City Administrator Page 182 of 899 Page 183 of 899 Page 184 of 899 Page 185 of 899 Page 186 of 899 Page 187 of 899 Page 188 of 899 Page 189 of 899 Page 190 of 899 Page 191 of 899 Page 192 of 899 Action Target Inc. 3411 S Mountain Vista Parkway Provo, UT 84606 Company Experience: Action Target Inc is a privately owned business headquartered about 40 miles south of Salt Lake City in Provo, Utah. As a world leader in indoor and outdoor shooting range technology, live fire shoot houses, and range target systems, Action Target has installed thousands of shooting ranges across the United States and in more than 40 other countries around the world. Currently, Action Target sells 4,000 different products and owns more than 40 patents on the systems it designs and manufacturers. Our primary concern is not just selling you range equipment, but making sure you get the right equipment for your needs. The right equipment must be well engineered, it must be installed properly, and it must function dependably under the harshest conditions. To make sure you get what you need, Action Target works with you every step of the way as your partner. From the initial consultation and design to the final installation, our goal is for you to have the facilities you need to be a successful business owner and/or continue the critical work of firearms training. Now in its 39th year, Action Target has grown into the largest company of its kind in the world and one of the few companies that engineers, manufactures, and installs all its own products. Because Action Target is so far ahead when it comes to innovation,our products have helped determine the course of modern firearms training and shooting range development. In fact, nearly every major police department and commercial shooting range across the country now trains on Action Target equipment, including the FBI academy, the Los Angeles Police Department, the Orlando Police Department, FBI Fort Dix, the Federal Law Enforcement Training Centers, Frisco Gun Club, Lotus Gun Works, Scottsdale Gun Club, and hundreds of other police departments, commercial/public shooting ranges, and military bases around the world. Aside from being the number one choice in law enforcement, military, and commercial shooting ranges, Action Target also offers a wide variety of portable steel targets for commercial and professional use including dueling trees, static targets, pepper poppers, torsos, .22 rimfire targets and a whole array of reactive targets. All of Action Target’s steel targets are made of through-hardened AR500 or AR550 steel and are engineered to withstand direct hit after direct hit. With unique designs that contain and redirect splatter, Action Target’s portable steel targets are designed with the safety of the shooter in mind and guaranteed to last for years. As the needs of its clients and customers have expanded, Action Target has worked to exceed expectations with the acquisitions of industry leading companies like Mancom and Law Enforcement Targets. With the combined expertise of the best in the business, Action Target promises ingenuity, dependability and innovation going into the future. Page 193 of 899 Our People Make the Difference. There is no substitute for passionate, knowledgeable, and skilled people. That’s why we’ve built Action Target around a team of proven executives, skilled engineers and machinists, dedicated sales representatives, and tireless customer service technicians. Our team has the creativity and drive to develop innovative new firearms training technology, the experience to properly apply that technology, and the dedication to provide the best ongoing service and support in the industry. Even when the project is complete, our relationship continues . Our job is not finished just because your range project is complete. We want to hear from you the following week, or the following year, or anytime you have a question or concern about your range. Our customer service department is always on-call and ready to help you with warranty issues, damaged parts, and anything else you need to keep your range running efficiently and effectively. We stand behind our work, and we stand behind you. Page 194 of 899 Projects of Similar Scope North Metro Regional Training Facility- Maple Grove, MN Al Freng 763-494-6150 Afreng@maplegrovemn.gov •Tac House Kit #2 (builds up to 800 total sq/ft.) •Tac House Kit #3 (builds up to 1,000 total sq.) Original Completion Date: May 02, 2023 Original Contract Amount: $174,995 Actual Completion Date: May 02, 2023 Actual Contract Amount: $174,995 Scottsdale Police Department- Scottsdale, AZ Dan Serbalik 518-701-3389 Dserbalik@scottsdale.gov • Tac House Kit #3 (builds up to 1,000 total sq/ft.) Original Completion Date: February 07, 2025 Original Contract Amount: $117,450 Actual Completion Date: February 07, 2025 Actual Contract Amount: $117,450 Boca Raton Police Department- Boca Raton, FL Michael Porter 561-239-1071 Mporter@mboca.us • Tac House Kit#4 (builds up to 1,600+ total sq/ft.) Original Completion Date: Dec. 01, 2024 Original Contract Amount: $206,000 Actual Completion Date: Dec. 01, 2024 Actual Contract Amount: $206,000 Pasadena Police Department- Pasadena, TX Mike Huffman 832-250-0781 Mrhuffman@pasadenatx.gov • Tac House Kit #3 (builds up to 1,000 sq/ft.) • Tac House Kit #4 (builds up to 1,600 sq/ft.) Original Completion Date: July 01, 2024 Original Contract Amount: $311,400 Actual Completion Date: July 01, 2024 Actual Contract Amount: $311,400 Page 195 of 899 2. Proposed Staff Experience PRIMARY CONTACTS: Wyatt Davis- wdavis@actiontarget.com Brian Sanders- brians@actiontarget.com CONTRACTING: Scott Wright (CFO)- swright@actiontarget.com ACTION TARGET DESIGN TEAM: WYATT DAVIS, RANGE CONSULTANT - wdavis@actiontarget.com Wyatt is Action Target's range consultant for the Midwestern United States. He assists the team by evaluating shooting range needs and providing detailed building requirements, range drawings, and precise budgets for range equipment. Wyatt joined Action Target in 2017 and completes an average of 15 range projects per year. An NRA-certified range safety officer with a LE background. He is a competitive shooter and firearms aficionado. Action Target, OnTarget award recipient. BRIAN SANDERS, PROJECT MANAGER – brians@actiontarget.com Brian has managed more than 350 projects representing over $100 million in revenue during his four-year employment at Action Target. His duties as project manager include overseeing the scope, costs, quality, schedule and installation for each project. Several projects that Brian has managed include ranges installed for the U.S. Military, such as those at the Virginia Military Institute (located in Lexington, VA), Moody AFB (located in Valdosta, GA) and Patrick AFB (located in Cocoa Beach. FL). Each of abovementioned projects were completed on-time, and at or under expected budget costs. Successful management of 350+ projects over 15 years at Action Target. Managed over $100+ million in project revenues over same time period. Earned awards for top performance (Top Gun, On Target). Proven leadership skills, reliable, team player NICK KOZENKO, INSTALL MANAGER – nkozenko@actiontarget.com Nick brings a wealth of experience in overseeing complex projects from conception to completion. With a strong background in construction management and a meticulous attention to detail. He excels in coordinating logistics, managing budgets, and ensuring adherence to safety standards. His leadership skills shine through his ability to motivate teams, solve problems efficiently, and communicate effectively with stakeholders at all levels. Nick is dedicated to delivering high-quality results on time and within budget, making me a valuable asset in the field of firing range installation and management. Page 196 of 899 Action Target Selected Recent Law Enforcement Project Referral List Includes Action Target estimated contract amounts Gilbert PD ($4m) Gilbert, AZ Ivan Gelo 480-635-7422 Ivan.gelo@gilbertaz.com Denton PD ($2.9m) Denton, TX Ofc. Allen Zant 940.349.7979 Allen.zant@cityofdenton.com St. Petersburg PD ($1.4m) St. Petersburg, FL Sgt. Daniel Cruz 727.893.4964 Daniel.cruz@stpete.org Sioux Falls PD($1.9m) Sioux Falls, SD Sgt. Nate Warren 605-978-6865 Nathan.warren@siouxfalls.gov FASTC - Foreign Security Training Center ($8.8m) Blackstone, VA Chris Graham 434-298-3318 GrahamCS2@state.gov Portland PD ($2.1m) Portland, OR Josh Faris 503-823-0399 Joshua.faris@portlandoregon.gov Broward County SO ($3.3m) Fort Lauderdale, FL Lt. Joe Etter 954.831.8145 Joseph_etter@sheriff.org Smith and Wesson ($1.8m) Testing and Training Division Maryville, TN John Pliska 413-297-2394 jpliska@smith-wesson.com Spokane County SO ($2.9m) Newman Lake, WA Rick Johnson, Range MGR 509.481.8686 rkjohnson@spokanesheriff.org Monroe County SO ($1m) Key West, FL Sgt Tom Hill 305-292-7010 THill@keysso.net Fort Worth PD ($5m) Fort Worth, TX Jaimie Malone 817-683-3337 Jaime.malone@fortworthtexas.gov Goodyear PD ($1.6m) Goodyear, AZ Curtis Mott 623-882-7719 cmott@goodyearaz.gov Palm Beach Gardens PD ($1.8m) Palm Beach Gardens, FL Sgt Glenn Wright 561-799-4529 GWright@pbgfl.com Indianapolis PD ($2m) Indianapolis, IN Chad Gray 317-560-8171 chad.gray@indy.gov San Mateo CSO ($4m) San Mateo, CA Cpt Mark Duri 650-743-0428 MDuri@smcgov.org Los Angeles PD ($2.5m) Los Angeles, CA Lt Ray Puettmann 818-832-3712 31519@lapd.online Washington CSO ($2m) Hillsboro, OR Daniel Muehleck 503-793-0612 daniel_muehleck@co.washington.or.us Altoona PD ($1.4m) Altoona, IA Cpt Tony Chambers 515.720.4535 TChambers@Altoonapd.com Page 197 of 899 Chester County Emergency Services ($2.4m) Coatesville, PA Pat Davis 610-344-4619 jpdavis@chesco.org Prince George County PD ($6.5m) Brandywine, MD Wayne McBride 240-832-0715 wmcbride@co.pg.md.us Metro Tech Training Center ($2m) Oklahoma City, OK James Weedn 405-990-5502 sojamwee@oklahomacounty.org Royal Canadian Mounted Police ($6m) Chilliwack & Regina Eric Dyck 604-703-4250 dyck@chilliwack.com Vortex Edge Training Center ($3.5m) Barnevald, WI Tom Fargo 608-662-4849 tfargo@vortexoptics.com Coming Soon! -Alamance Community College, NC ($1.3m) -Port St Lucie PD, FL ($3m) -Cape Coral PD, FL ($1.6m) -Fort Lauderdale PD, FL ($1.5m) -PA State Police, PA ($3.5m) -Kentucky DOCJT ($3m) -Scottsdale PD, AZ ($1.5m) -Cochise College, AZ ($1.5m) -Blackhawk Tech College, WI ($1.4m) -Orland Park PD, IL ($1.4m) -San Pablo PD, CA ($1.4m) Charlotte Mecklenburg PD ($1.5m) Charlotte, NC Steve Winterhalter 704-618-3472 swinterhalter@cmpd.org Michigan State Police ($2m) Lansing, MI Tim Olsen 517-322-1200 Olson5@michigan.gov Moore Norman Tech Training Center ($3m) Norman, OK Jerry McConnell 405-801-5751 Jerry.mcconnell@mntc.edu Page 198 of 899 3. Project Approach At Action Target Inc, internal coordination among our departments is fundamental to our success in delivering top-quality shooting range solutions. Our approach begins with close collaboration between our design, engineering, and manufacturing teams. Designers work closely with engineers to ensure that our products not only meet but exceed industry standards for safety and functionality. Once designs are finalized, our manufacturing team takes over, leveraging their expertise to produce high-quality equipment using state-of-the-art processes and materials. Installation teams are integral to our process, working together with project managers to ensure seamless execution on-site. Coordination with logistics and supply chain departments ensures that materials and equipment are delivered on time and in optimal condition, streamlining the installation process. Throughout every project phase, our team remains actively engaged, providing ongoing support to clients and addressing any questions or concerns promptly. This integrated approach allows us to maintain high levels of customer satisfaction and ensures that our shooting ranges perform reliably for years to come. We also emphasize seamless coordination with external trades to ensure that all aspects of the shooting range installation align smoothly and efficiently. This collaborative effort guarantees that our clients receive a comprehensive solution that meets their operational needs while adhering to project timelines and budgetary considerations. By fostering strong internal departmental coordination and communication, Action Target continues to lead the industry in innovation, reliability, and customer service, reinforcing our commitment to excellence in every aspect of our operations. Page 199 of 899 4. Schedule Performance 5. Change Order Percentage on Recent Projects North Metro Regional Training Facility- Maple Grove, MN Al Freng 763-494-6150 Afreng@maplegrovemn.gov •Tac House Kit #2 (builds up to 800 total sq/ft.) •Tac House Kit #3 (builds up to 1,000 total sq.) Original Completion Date: May 02, 2023 Original Contract Amount: $174,995 Actual Completion Date: May 02, 2023 Actual Contract Amount: $174,995 Scottsdale Police Department- Scottsdale, AZ Dan Serbalik 518-701-3389 Dserbalik@scottsdale.gov • Tac House Kit #3 (builds up to 1,000 total sq/ft.) Original Completion Date: February 07, 2025 Original Contract Amount: $117,450 Actual Completion Date: February 07, 2025 Actual Contract Amount: $117,450 Boca Raton Police Department- Boca Raton, FL Michael Porter 561-239-1071 Mporter@mboca.us • Tac House Kit#4 (builds up to 1,600+ total sq/ft.) Original Completion Date: Dec. 01, 2024 Original Contract Amount: $206,000 Actual Completion Date: Dec. 01, 2024 Actual Contract Amount: $206,000 Pasadena Police Department- Pasadena, TX Mike Huffman 832-250-0781 Mrhuffman@pasadenatx.gov • Tac House Kit #3 (builds up to 1,000 sq/ft.) • Tac House Kit #4 (builds up to 1,600 sq/ft.) Original Completion Date: July 01, 2024 Original Contract Amount: $311,400 Actual Completion Date: July 01, 2024 Actual Contract Amount: $311,400 Page 200 of 899 6. Safety Narrative: Action Target recognizes that our people drive the business. As the most critical resource, employees will be safeguarded through training, provision of appropriate work surroundings, and procedures that foster protection of health and safety. All work conducted by Action Target ’s employees will consider the intent and severity of this policy. No duty, no matter what its perceived result will be deemed more important than employee’s health and safety. Action Target is committed to the safety of our employees. We will do everything possible to prevent workplace accidents and we are committed to providing a safe working environment for all employees. We value our employees not only as employees but also as human beings critical of the success of their family, the local community, and Action Target. Employees are encouraged to report any unsafe work practices or safety hazards encountered on the job. All accidents/incidents (no matter how slight) are to be immediately reported to the supervisor on duty. A key factor in implementing this policy will be strict compliance with all applicable federal, state, local, and company policies and procedures. Failure to comply with these policies may result in disciplinary actions. With respect to this, Action Target will make every reasonable effort to provide a safe and healthy workplace that is free from any recognized or known potential hazards. Additionally, Action Target subscribes to these principles: 1. All accidents are preventable through implementation of effective Safety and Health Control policies and programs. 2. Safety and Health controls are a part of our work every day. 3. Accident prevention is good business. It minimizes human suffering, promotes better working conditions for everyone, holds Action Target to a higher standard for our customers, and increases productivity. Therefore, Action Target will comply with all safety and health regulations which apply to the course and scope of operations. 4. The Safety Manager is responsible for providing the safest possible workplace for all Action Target employees and is committed to allocating and providing all the resources needed to promote and effectively implement this safety policy. 5. Employees are responsible for following safe work practices and company rules, and for preventing accidents and injuries. Management will establish lines of communication to solicit and receive comments, information, suggestions, and assistance from employees where safety and health are concerned. 6. Management and supervisors of Action Target will set an exemplary example with good attitudes and strong commitment to safety and health in the workplace. 7. Management and supervisors will monitor the company’s safety and health performance, working environment and conditions to ensure that program objectives are achieved. 8. Our safety program applies to all employees and people affected or associated in any way by the scope of this business. Everyone’s goal must be to constantly improve safety awareness and to prevent accidents and injuries. Everyone at Action Target must be involved and committed to safety. This must be a team effort. Together, we can prevent accidents and injuries, and we can create a safe and healthy work environment. Company EMR: 2024: .75 2023: .77 2022: .63 Action Target is happy to supply full report upon request. Page 201 of 899 ACTION TARGET PROPOSAL 3411 Mountain Vista Pkwy, Provo Ut 84606 ActionTarget.com | 888.377.8033 Lakeville- TAC House KIt Quotation Number: 153236 Prepared by: Wyatt Davis Page 202 of 899 PRICING TABLES COMPLETE SHOOTING RANGE EQUIPMENT PACKAGE Price TAC House Kit • 100 Wall Panels • 4 Window Panel • 7 Right Swing Door Panels • 7 Left Swing Door Panels • 4 Open Door Panels • 120 Posts • All, Joints & Attachment Hardware • Configurable Layout Ground Freight Tax Service Rep onsite for 1 day training Exclusions: Offloading material onsite, Installation $177,525.00 Trusted Partner 3-Year Warranty - Comprehensive Trusted Partner Warranty covers both parts and labor due to manufacturing or product defects. $0.00 Total $177,525.00 Page 203 of 899 FEATURES TAC HOUSE™ RECONFIGURABLE FORCE-ON-FORCE TRAINING The Training Ammunition Combat (TAC) House is a non-ballistic training tool for adaptive urban assault, building search and clearing and force-on-force training. Designed for use with simulated ammunition rounds, marking cartridges, or blanks, teams can train with their own converted duty weapons. The TAC House provides a true-to-life training environment with solid walls and real doors. The modular design of the TAC House gives trainers the ability to convert any outdoor or indoor space into a realistic tactical training facility. Interlocking panels provide maximum stability and a precise fit and finish. An outdoor panel option can withstand rain, humidity, and winds up to 40 mph. LEARN MORE ActionTarget.com/Products/Tac_House §Rated for Simulated Ammunition §Modular §Reconfigurable §Robust Design Train with Purpose Ideal for low light, force on force, active shooter, urban assault, mission planning, and walk-through scenarios. Your personnel will be prepared for any challenges they may encounter. Precise Fit and Finish Every panel is built to assemble with flush connections and a flat, stable base. This creates a structure that is forgiving on uneven surfaces and withstands heavy wind and intense wall impacts during training. Easy to Reconfigure Each structure kit comes with all the necessary components for assembling multiple layouts and floor plans. §Fast Assembly: In only a few hours you can create a new and unique training environment. §Easy Setup: Only a 5/16” hex head wrench is required. Easy to Deploy All kits ship on standard double pallets to fit in any container or commercial truck and only require two people for assembly and take down. Robust Design The Tac House panels are precisely manufactured from wood and feature a laminated finish for wear protection and long life. Dynamic Design The TAC House includes multiple panel designs, including windows and doors, making it easy to setup unique room and house configurations. Page 204 of 899 TRUSTED PARTNER WARRANTY ™ 3-YEAR COMPREHENSIVE COVERAGE Action Target’s 3-year Trusted Partner Warranty is peace of mind for gun ranges. It is uninterrupted training for those that serve. It is a resounding pledge from Action Target to its customer’s success as the Trusted Partner at Every Level™. LEARN MORE ActionTarget.com/TrustedPartnerWarranty CORE PRODUCTS COVERED §Genesis™ Target Retriever §Pilot™ Target Retriever §SmartRange Axis™ Range control §Vortex™ Steel Trap §Baffles and Deflectors §Turning targets §DRM Pro™ §Auto Targets™ §Shooting Stalls §Rubber Berm Trap §Line of Fire™ §MATCH™ §TAC House™ Our Promise The comprehensive Trusted Partner Warranty covers both parts and labor due to manufacturing or product defects. Customer Support 24/7 Support |Remote Access | Inventory | Nation-Wide Reps | 3-Year Warranty Action Target is always on call to help with warranty issues. Many items are remotely accessible, allowing us to quickly trouble shoot. We also maintain inventory to minimize service time. Page 205 of 899 Page 206 of 899 Page 207 of 899 Page 208 of 899 Page 209 of 899 Page 210 of 899 Page 211 of 899 Page 212 of 899 Page 213 of 899 Page 214 of 899 Page 215 of 899 Page 216 of 899 Page 217 of 899 Page 218 of 899 Page 219 of 899 Page 220 of 899 Page 221 of 899 Page 222 of 899 Page 223 of 899 Page 224 of 899 Page 225 of 899 Page 226 of 899 Page 227 of 899 Page 228 of 899 Page 229 of 899 Page 230 of 899 Page 231 of 899 Page 232 of 899 Page 233 of 899 Page 234 of 899 Page 235 of 899 Page 236 of 899 Page 237 of 899 Page 238 of 899 Page 239 of 899 Page 240 of 899 Page 241 of 899 Page 242 of 899 RJM Construction CITY OF LAKEVILLE FiRST CENTER Golden Valley, Minnesota LAKEVILLE, MN Work Sequence and Bid & Quote Categories 011150 Bid Package #3 BID CATEGORY 11B: TACTICAL WALLS – Action Target, $177,525 • Specification Sections Included: DIVISION 00 – PROCUREMENT AND CONTRACTING REQUIREMENTS DIVISION 01 – GENERAL REQUIREMENTS 10 22 23 TACTICAL PORTABLE NON-BALLISTIC WALL PARTITIONS LABOR AND MATERIAL • Work to be complete per the City of Lakeville plans and specifications dated 12/13/24. This work shall include all labor, material, equipment, fasteners, protection, shoring, cleanup, openings, supervision, attachments, and ancillary requirements necessary to provide a complete, functioning system for the specification section(s) listed above. In addition, the scope of work shall include, but is not limited to: BASE BID: • Responsibility of this contractor to review the plans and specs in their entirety including but not limited to: General Plans, Civil Plans, Landscaping Plans, Architectural Plans, Interior Plans, Structural Plans, Mechanical Plans, Plumbing Plans, Electrical Plans, Audiovisual Plans, Telecom Plans All Keynotes, and All Specifications to ensure the entire scope of work is captured. If there are discrepancies in quantities, materials, or equipment, this contractor shall carry the scope that includes the most coverage. • Remove all your debris, cardboard or other materials to General Contractor’s dumpster daily. Recycling of all recyclable construction debris will be required throughout the project and follow the project’s Waste Management Plan. Contractor will be responsible for ensuring that their company will be compliant with this plan. • Smoking and Tobacco use (including e-cigarettes) will not be allowed to be used at any time within the building or project site. • All submittals, shop drawings, engineering, and delegated design for this scope of work. • Include all necessary shoring as well as engineered drawings, calculations if required by engineer/City as pertaining to your scope of work. • Include necessary monitoring and equipment for proper ventilation during the use of heavy equipment. Contractor to include an evacuation plan in the event the Carbon Dioxide levels are outside permissible exposure limits. • Change order requests must be approved by RJM Construction’s Project Manager prior to proceeding. Extra requests submitted without prior written approval will NOT be accepted. The superintendent cannot approve additional costs. • Coordinate all deliveries with RJM Construction at least 48 hours in advance. • Provie all material hoisting for this scope of work • Field Verification • Coordination of access and street or sidewalk closures with the city, and all necessary permits. Includes necessary barricading and all other means, methods, and safety requirements. • Meeting attendance by foreman or project managers is mandatory during this trade’s activity on site. Failure to attend and be a part of the planning process will result in monetary penalties as a result of rework and coordination issues. • Maximum mark-up accepted on change orders is 10 percent including all Overhead and Profit • Parking and transportation of all employees to and from the site. • Provide SDS sheets for all materials used on the jobsite. • Provide OSHA approved equipment for all employees use while on the jobsite. Page 243 of 899 RJM Construction CITY OF LAKEVILLE FiRST CENTER Golden Valley, Minnesota LAKEVILLE, MN Work Sequence and Bid & Quote Categories 011150 Bid Package #3 • All Building rules, including security and space access, must be fully adhered to by all on site personnel. • Provide all access necessary to perform work i.e. hoisting, lifts, scaffolding, ladders, platforms, etc. • RJM Construction holds the right to seek monetary reimbursement for schedule delays that affect subsequent trades. • Coordination with other trades and shop drawings review of other trades as necessary is included • All submittals, shop drawings, and samples shall be submitted in a timely manner with adequate review period to not delay the work of the contractor or any other contractor • Billings to be submitted through GC Pay • Contractor is responsible to staff the project with the required amount of manpower to meet schedule • Specific Items to be included, but not limited to: • Work associated with BID CATEGORY 11B – TACTICAL WALLS • Include an allowance of $2,500 to be used at the discretion of the Construction Manager. This will include either labor or materials. No profit or overhead will be allowed to be added to the cost of the work approved. Provide the Construction Manager a summary of costs of approved work to date, and credit the full amount of allowance not used. • Plan Sheet AE002, AE003 – TAC – Training Room Options are provided for potential layouts of the Training Room Spaces. Quantities and panel types to follow specification 10 22 23 Tactical Portable Non-Ballistic Wall Partitions • This Work Category is to provide As Built Plans with a minimum of 3 layouts for training setups with the Tactical Wall Partition System based off the available layout of the finished space. • The Owner will request which of the available layouts to install and any remaining panels will be stored in the designated storage location in a manner to protect the stored panels from damage until they are ready to be utilized. • Work Category includes general building works including, but not limited to, • Scope includes receipt and inventory of all anchors, bolts, fasteners, screws, and associated hardware for installation of the work of this Work Category, Work Category 11B shall notify the Construction Manager in writing, within 3 days of delivery of material, as to any quantities that are insufficient. The Construction Manager will only be responsible for obtaining the quantities of insufficient materials listed and will NOT be responsible for obtaining additional material not listed in writing per the requirements. Work category 11B shall be responsible for obtaining any additional material not placed in writing to the Construction Manager. • Labor and/or equipment to unload and move all materials listed in this section, whether supplied by this Contractor or by other trades providing materials for Contractor to install under the Scope of Work. This would include unloading, transport, and staging as needed. • Cleanup. Page 244 of 899 Page 245 of 899 Page 246 of 899 Page 247 of 899 Page 248 of 899 Page 249 of 899 Page 1 of 14 Rev. 01.01.2025 Exhibit D - RJM’s General Project Requirements RJM’s GENERAL PROJECT REQUIREMENTS (updated Jan. 2025) 1. BIDDING REQUIREMENTS 1.1 Bid Proposals a) Delivery - Written or electronic (email) proposals for this scope of work will be received at the Main Office of RJM Construction located at 830 Boone Ave. N, Golden Valley, MN. Bids shall be submitted in writing. Telephone or verbal quotations will not be accepted. Late or incomplete quotations will not be accepted. b) Deviations - Bids shall state the bid is per the bid documents. Any proposed deviation must be clearly identified as such. If deviations are not identified clearly the bid documents shall prevail. c) Questions during the Bid Period - All questions during the bid period requiring a technical answer shall be presented in writing and emailed to RJM. No direct communication with the architect, engineer or other consultants shall take place without the presence of an RJM representative unless this requirement is specifically waived. Should this take place and result in any cost impact, the cost will be borne by the potential subcontractor. d) Form and Duration of Proposal - Proposal shall be valid and binding upon the Bidder and irrevocable for ninety (90) days. Proposals shall be signed by a person so authorized, and their title or position shall be clearly indicated. e) Acceptance of Bids - RJM reserves the right to waive any informality in any bid. RJM reserves the right to reject any or all bids. Initial acceptance of this bid may be made verbally and, if confirmed in writing within (5) five business days, shall be effective as of the date of the verbal acceptance. f) Acknowledgment of Addenda/Amendments - Bidders shall acknowledge the Request for Bid Proposal and all Addenda or Amendments. It is the Bidder's responsibility to ascertain the existence of any Addenda and/or Amendments prior to submitting a bid. Addenda are revisions to the plans and specifications generated by the Architect/Engineer. Amendments are modifications to the Instructions to Bidders generated by RJM. g) Exclusions - In the event the Bidder chooses to exclude an item of work as a part of their work as described in the Specifications, the Request for Bid Proposal, or any other of the Bid Documents, the Bidder agrees to accept RJM’s evaluation of the cost of the missing item for the purpose of comparing bids. h) Sales Taxes - All proposals shall include all applicable sales taxes, unless the Project Requirements stipulate Tax-Exempt Material Only Status. i) Bonding - As defined within the Project Specific requirements. j) ICRA - As defined within the Project Specific requirements. k) OCIP - As defined within the Project Specific requirements l) Union Affiliation - RJM is only signatory to the Carpenter’s, Laborer’s, and Operator’s unions. Any trade affiliated with any of these three unions must provide pricing based on union Page 250 of 899 Page 2 of 14 Rev. 01.01.2025 installations. Non-union installations for any scopes not affiliated with these three unions will be entertained. All subcontractor’s must be fully aware that both union and non- union subcontracts can and will be contracted to perform work at the same time and shall extend full professional courtesy to all parties at all times. m) Liquidated Damages - As defined within the Project Specific requirements. n) Subcontract Terms - A sample copy of RJM’s Standard Subcontract Agreement has been included with the Bid Documents. It is understood that all Bid Proposals fully acknowledge receipt and inclusion of all terms stated within RJM’s Standard Subcontract Agreement even if not directly referenced within the Bid Proposal. o) Insurance Requirements - A sample copy of RJM’s Standard Insurance Requirements has been included with the Bid Documents. Subcontractors shall qualify their proposals if any of these limits cannot be met or will require additional fees above their base bid. p) Equal Employment Opportunity (EEO) Policy - A sample copy of RJM’s Equal Employment Opportunity has been included with the Bid Documents. It is understood that all Bid Proposals fully acknowledge adherence to this Policy even if not directly referenced within the Bid Proposal. 1.2 Responsibilities Upon Award a) Subcontract - The successful bidder shall enter into an RJM standard subcontract agreement. A sample copy of this Subcontract has been included with the Bid Documents. b) General Insurance Requirements - Within one week of contract award, Subcontractor shall submit Certificates of Insurance (in accordance with the subcontract terms) for all independent entities associated with the subcontract that will have personnel or equipment on the project site. Work will not be allowed to begin without proper insurance; therefore, the associated crews will be sent home if this is not taken care of prior to commencing work. Certificates of insurance shall provide evidence of coverage and additionally insured entities as defined by the individual project requirements. c) Subcontractor’s Schedule - Within two (2) weeks of contract award subcontractor is required to provide a detailed schedule that is in conformance with the overall RJM project schedule. Subcontractor’s schedule will show: (i) length of time to complete all design work and obtain necessary permits (ii) length of time to procure all materials (iii) length of time required to fabricate assemblies (iv) earliest possible installation date (v) time allotted for submittal approval (vi) overall minimum time frame needed for a complete installation d) Project Confidentiality - The subcontractor agrees to maintain in confidence and not to use or disclose to any third party, without the express written consent of the Owner, any information regarding Owner’s facilities. Subcontractor agrees to take all necessary and reasonable precautions to prevent the disclosure of such confidential information to any unauthorized persons and Subcontractor shall advise its employees, subcontractors/suppliers/vendors and agents of the confidentiality of such information and shall instruct them to take all necessary and reasonable precautions to prevent its unauthorized disclosure. Page 251 of 899 Page 3 of 14 Rev. 01.01.2025 e) Schedule of Values - Within one (1) week from the issuance of the Notice of Award, the successful Subcontractor must submit their written Schedule of Values for which their monthly invoicing will be based upon. Schedule of Values must include separate line items for each scope of work provided under the Subcontract Agreement and shall be further subject to RJM’s approval. 1.3 Electronic / Digital Models a) RJM will provide a complete set of contract drawings, and one complete set of any subsequent owner requested change drawings to the subcontractor in electronic PDF format only. Any additional hard copy sets must be purchased by the subcontractor. b) The subcontractor CANNOT assume, nor state within their bid proposal that CAD Files will be made available for their use. While these files may be requested, it will be up to the sole discretion of the architect or engineering firm’s policy for CAD file distribution. RJM makes no claim that CAD files will be readily available, nor will they accept any additional cost implications should CAD files not be made available to the subcontractor. c) Subcontractor understands and acknowledges that any Electronic Design file or Digital model file (“Digital Models”) provided by RJM Construction are provided as a convenience to the subcontractor and are not Contract Documents. d) Subcontractor understands and acknowledges that there are risks inherent with any use of the Digital Models and that the use of the Digital Model files may not result in the detection of all potential conflicts between elements during actual construction of a project that may cause damage or loss to the subcontractor. e) Subcontractor acknowledges that the Digital Model files are a work in progress for the above- described Project. The signed and sealed original plans, specifications and other documents constitute the Contract Documents for the Project from the Architect & Engineers. The Digital Model Files are not Contract Documents. General Contractor cannot verify that the Digital Model Files accurately or completely reflect field conditions. The Subcontractor and each other user must satisfy themselves as to the level of accuracy and completeness of the Digital Model Files for their needs. In addition, the Subcontractor understands that the changes made during design, bidding, negotiations and construction may not be incorporated in the Digital Model Files. f) Sub acknowledges that the transfer of Digital Model Files shall not constitute the sale of goods; and Owner, Architect, RJM Construction LLC and its consultants make NO WARRANTY, EXPRESS OR IMPLIED, INCLUDING WARRANTIES OF MERCHANTABILITY OR FITNESS FOR ANY PURPOSES, INCLUDING “SPEARIN” TYPE WARRANTIES, IN CONNECTION WITH THE SERVICE OF PROVIDING DIGITAL MODEL FILES, OR THAT THE DIGITAL MODEL FILES WILL BE USEABLE OR ACCURATE, WHICH WARANTES AND REPRESENTATIONS ARE EXPRESSLY DISCLAIMED. g) By accepting Digital Models, the Subcontractor agrees not to sue; will hold harmless RJM Construction, LLC Owner, Architect and its consultants from any costs (including reasonable attorneys' fees), from claims or causes of action be it tort, breach of contract or otherwise that result from the use of the Digital Models; and waives all claims for consequential and/or liquidated damages against RJM Construction, LLC , Owner and Architect, and its consultants arising out of the use of the Digital Model Files. h) Subcontractor may not copy, transmit or distribute Digital Model files without written consent and any recipient of the Digital Models agree to abide by the terms listed above. 2. JOBSITE REQUIREMENTS Page 252 of 899 Page 4 of 14 Rev. 01.01.2025 2.1 Project Temporary Utility Service Provisions i. Power - 110 and 220-volt temporary power will be provided for Subcontractors use at the Project Site. Distribution of power from those locations is the responsibility of each subcontractor. Power for steel and miscellaneous iron welding will not be provided. ii. Potable Water - Potable supply of drinking water will be provided at an onsite source for use by subcontractors. Each subcontractor is responsible to provide drinking water containers, cups, and distribution of same for their employees. RJM will not supply ice for subcontractor’s drinking water. iii. Toilets - Toilets will be provided in accordance with OSHA requirements. 2.2 Communications / Meetings i. Project Communications - All subcontractor communication on the project shall be routed through the RJM project manager. Where applicable and at RJM’s discretion, RJM project manager may direct subcontractor to send and/or submit communications directly with other project team members to expedite progress while copying RJM project manager on the correspondence. ii. Subcontractor Meetings – See also sections 2.3 and 2.4 below regarding safety and quality assurance meetings. (i) Pre-Construction Schedule Meeting - Subcontractor is required to attend a preconstruction sequence and schedule meeting (“Pull-Planning Meeting”). MEP subcontractors may be required to attend additional coordination meetings). Subcontractor shall have their project manager/estimator and the project onsite foreman attend to submit information on; (1) List of work activities/tasks, Subcontractor crew size(s), Work activity/task time duration (2) Preliminary staging and work plan. (3) Identified coordination items needed for installation with RJM and other project subcontractor(s) work. (4) Constraint items with dates required to meet published schedule. (ii) Preinstallation Meetings - Subcontractor is required to meet with RJM’s jobsite superintendent and project manager a minimum of three (3) weeks prior to scheduled start of subcontractor’s work in field. Subcontractor shall have their onsite foreman attend the meeting to review the following items: (1) All required Safety information & site-specific safety plans. (2) Quality Assurance & Quality Control Plans. (3) All submittals, shop drawings, and field use drawings. (4) Manufacturer representatives (if requested by RJM). (5) Testing requirements and plan (if requested by RJM). (6) Finalized work plan, crew size, and staging plan. (7) Outstanding constraint items with dates required to meet schedule. Page 253 of 899 Page 5 of 14 Rev. 01.01.2025 (iii) Weekly Jobsite Foreman Meeting(s) - Onsite Foreman attendance is required for subcontractors two (2) weeks before mobilizing onsite and those currently working onsite. Subcontractor project managers may attend or requested to attend by RJM. The onsite weekly meetings will be held at RJM’s Field Office. Meetings will discuss safety, project weekly work plan schedule, document updates, and outstanding constraints and issues. (iv) Project Meeting Attendance - Each subcontractor’s superintendent/foreman will be required to attend weekly foreman coordination meetings held at RJM’s field office. Each subcontractor’s project manager will also be required to attend weekly Subcontractor Coordination Meetings. These meetings will be held as often as required to arrange for satisfactory coordination of all building trades so as not to impede the job’s progress. Subcontractors failing to abide by these provisions will be held responsible for any delays and/or expenses incurred due to coordination difficulties with their work. In addition, repeated failure to attend weekly meetings may result in fines being levied after notice, in an amount not to exceed $1,000 for each meeting missed. 2.3 Safety a) Safety Manual / AWAIR Program - Every subcontractor will be required to deliver an electronic copy of their company’s Safety Manual to RJM prior to conducting any work onsite. i. SDS Documentation - Every Subcontractor will be required to deliver electronic or printed copies of Safety Data Sheets (SDS) for all products used onsite prior to conducting work. ii. Site Specific Safety Plans (SSSP) - Every Subcontractor will be required to plan and perform their work to recognize and avoid potential hazards of the specific work site, along with all policies, controls and work practices selected to minimize those hazards. The SSSP must address provisions for fall protection in any situation above 6-foot, demolition, excavations and trenching, confined space work, material handling, equipment operation and inspection, hazard communication, silica exposure, lockout tagout, PPE, emergency response and rescue, training, and implementation of the plan as is related to their scope of work. SSSPs must identify the Subcontractor’s onsite Competent Person responsible for implementing and managing the plan. iii. Weekly Toolbox Talks - Every subcontractor will be required to turn over sign-in sheets for their weekly toolbox talks. Sign-in sheets should be given to RJM’s onsite superintendent on a weekly basis. iv. Current Laws - The subcontractor shall conform to and abide by all applicable federal, state, county and municipal building, sanitary, health and safety statutes, laws, rules, regulations and ordinances (collectively the “Construction Laws”). To the best knowledge and belief of the Subcontractor, the contract documents now contain no provision that is contrary to the Construction Laws. b) Subcontractor is required to perform its work in a safe and reasonable manner. Subcontractor shall, at its own cost and expense, protect its own employees, employees of RJM, and all other persons from risk or death, injury or bodily harm arising out of or in any way connected with the work to be performed hereunder. Subcontractor shall strictly comply with all safety laws, orders, rules, regulations, requirements, standards or statutes of all federal, state, and local government agencies affecting or relating to this agreement or its performance, including but not limited to, the federal and state OSHA Regulations, the handling and storage of hazardous materials, accident prevention, safety equipment and practices including the accident prevention and safety program, policies and rules of RJM. Subcontractor shall conduct inspections to determine that safe working conditions exist and shall establish its own safety program implementing the appropriate safety measures, policies and standards. Page 254 of 899 Page 6 of 14 Rev. 01.01.2025 c) Subcontractor shall indemnify, defend and hold RJM harmless from liability, loss, cost, damage, or expense including attorneys’ fees, which RJM may suffer or incur as a result of any cause of action, proceeding, citation or work stoppage arising out of or in any way connected with the alleged violation by subcontractor of any such safety order, rule, regulation, or requirement, whether such violation is ultimately proved or not. If subcontractor or its personnel do not comply with all safety requirements applicable to the project, subcontractor shall promptly stop any part of its work that the contractor deems unsafe until corrective measures satisfactory to RJM shall have been taken. RJM’s failure to stop the subcontractor’s unsafe practices shall not relieve the subcontractor or the responsibility, therefore. d) Subcontractors and their tiered subcontractors shall observe and enforce safety requirements and any employee who fails to follow those requirements shall be subject to the following disciplinary actions: Non-Serious – Safety infractions of a less serious nature will be handled as follows: First Offense Verbal Warning(documented in safety assessment) Second Offense Written Warning. Removal from the project for the rest of the day. Third Offense Written Warning. Removal from the job for the rest of the day and the following. Fourth Offense/Serious Written Warning. Removal of employee from RJM jobs for one year. Serious – One which could result in serious injury or loss of life or serious loss of property, may be subject to three-day suspension or immediate removal from the site. Fall Protection – An employee who is found not tied off in an area that requires fall protection is subject to immediate removal from the site. Supervisor Accountability – If two or more employees working for the same supervisor are found in serious infraction as described above, that subcontractor supervisor is also subject to disciplinary action up to and including immediate removal from the site. e) Documentation - Notice of safety hazards (written) shall be given to the employee, and a copy sent to the company Project Mange/Safety Director. f) Weekly safety inspections - Subcontractor is required to conduct a documented weekly safety inspection of their work. Copies of these inspections are to be delivered to the onsite RJM Superintendent g) Weekly safety inspections - Subcontractor is required to conduct a documented weekly safety inspection of their work. Copies of these inspections are to be delivered to the onsite RJM Superintendent. h) Jobsite Conduct - RJM will not tolerate any jobsite behavior, whether it is physical, verbal, or suggestive in nature that would be deemed in any light to create an intimidating, hostile, or offensive work environment. Any Subcontractor, or Subcontractor’s employee, supplier, or sub- tier vendor who may witness to such behavior should report any such instance to RJM’s onsite superintendent. If continued or repeated behavior continues after a claim has been made and addressed to all parties involved, RJM may, if deemed necessary, require the immediate dismissal and/or replacement of the party creating the unfavorable worksite atmosphere. Any Page 255 of 899 Page 7 of 14 Rev. 01.01.2025 subsequent costs associated with the dismissal, and/or additional costs to make up for the lost hours will be borne entirely by the Subcontractor. i) Visitor Conduct - Complete courtesy and respect will be given to any site visitors at all times. Rude behavior, and/or excessive language towards or around these people will be grounds for immediate removal of the responsible individual. j) Jobsite Supervision - No Subcontractor shall be allowed on site, or perform work on site, without a representative from RJM being present. k) Daily Check-In - Any employee and/or representative of a company subcontracting with, or providing materials to, RJM must check in with RJM’s onsite personnel on a daily basis. This includes all subcontractors’ sub-tier contractors. l) Fall Protection – A fall protection plan is required for all elevated work at heights. Employees exposed to a fall of 6-feet or more must be protected by Personal Fall Arrest Systems, Fall Restraint Systems, complete guardrail, or compliant netting, flagging or warning line systems – regardless of exceptions made by OSHA. The use of “Safety Monitors” is not allowed on RJM projects. There is a presumption that it is feasible and will not create a greater hazard to implement at least one of the above-listed fall protection systems through training, pre-planning, and the sequencing of work to avoid creating situations where fall protection becomes infeasible. This expectation applies to all rooftop work, structural steel activities, demolition, leading edges, scaffold erection and dismantling, crane and equipment assembly and disassembly. m) Flagman / Pedestrian Safety Provisions - For all deliveries, and/or material movement, the Subcontractor is responsible for providing their own certified flagman and / or safety provisions according to OSHA and MNDOT Standards n) Jobsite Deliveries / Staging - Forty-eight (48) hour notice will be required for all deliveries to the jobsite. Notice must be coordinated through the onsite RJM superintendent. Any deliveries not coordinated in accordance with these guidelines will be sent away, at no additional charge to RJM. RJM also reserves the right to request relocation of any and all Subcontractor owned items (at the expense of the subcontractor) as deemed necessary by RJM’s onsite superintendent as construction progresses. o) Material Delivery - Subcontractors receiving materials must have a receiving staff on-site at the scheduled delivery times. RJM will not be responsible for receiving subcontractor’s material deliveries. p) Parking - Subcontractors will be responsible for procuring any parking accommodations for their workers. q) Storage - Subcontractor is hereby notified that facilities for storage or stockpiling of equipment and materials may not be available either at the jobsite or within the building proper. It is the responsibility for the subcontractor to make whatever arrangements may be necessary for storage offsite to ensure proper supply of materials to the job to meet progress requirements. All jobsite storage locations must have the prior approval of RJM. Upon request by RJM, the Subcontractor will relocate, at its own expense, its on-site material and equipment as required to facilitate progress of the work. r) Smoking - Smoking, chewing tobacco, electronic cigarettes and/or vaping will not be allowed on the project or anywhere on the premises. s) Eating / Drinking - Eating or drinking onsite must take place within designated and confined locations as defined by RJM’s onsite Superintendent. Breaks and lunch period shall be taken in these designated areas and the subcontractors shall be responsible for the daily clean up all associated debris and waste. This shall include all aluminum, glass, or plastic beverage bottles as well casual eating such as, “sunflower seeds” that may cause a nuisance and have potential for bacterial growth if not immediately cleaned up. Page 256 of 899 Page 8 of 14 Rev. 01.01.2025 t) Radios / Headphones - Private radios, headphones, earbuds, private cell phone use, etc. are not allowed on the project site. RJM reserves the right to remove any personnel who are found in violation of this rule. Any costs resulting from lost time or labor will be borne on the subcontractor(s) found in violation of this rule. u) Supervision - The subcontractor will maintain a superintendent/foreman on the jobsite who is experienced and competent during all phases of the work. v) Crane Pick Plans - At least ten (10) business days before a crane is mobilized to a job site the Subcontractor responsible for the crane pick must submit a pick plan to RJM which includes the following information: · Information on the crane, crane configuration, operator, rigger, and competent persons, including all applicable training, certifications, inspections and evaluations · Information on the load, the capacity of the crane's configuration, and rigging · Crane company COI (if equipment does not belong to the subcontractor) · JHA involving ground and overhead conditions, proximity to powerlines, fall prevention, and other material handling considerations w) Safety Helmets - Each Subcontractor will provide to their employees Type 2 Helmets that meet the requirements of ANSI/ISEA Z89.1-2014 (R2019) - providing protection against impacts to the top, side, and back of the head, along with retention to prevent displacement from the head. Helmet labels must display an ANSI/ISEA Z89.1-2014 designation indicating a Type 2 variety with Class C (vented), or Class G or E if exposed to respective electrical hazards. Type 2 Helmets must be worn and maintained as described by ANSI and the manufacturer. x) Safety Consultation Programs - All Subcontractors are required to attend and participate in safety consultation efforts related to the project including MNOSHA's MNSHARP Consultation Program, AGC-CHASE Project Partnerships, and RJM Site Safety Walks. Companies actively involved with work on the project will participate through the attendance of a crew supervisor, company safety representative, or project manager who have the ability to correct safety concerns in a timely manner. 2.4 Quality Assurance Program Requirements The Quality Assurance Program Requirements set forth in this Exhibit D are designed to further the goals of performing the Work correctly the first time, planning and coordinating the Work, eliminating errors, eliminating rework, maintaining efficient trade flow, and avoiding unnecessary delays. Accordingly, the Quality Assurance Program Requirements necessarily require close coordination with RJM. a) Subcontractor shall designate a quality representative (the “Quality Representative”) with responsibility to manage on behalf of Subcontractor all aspects of the quality process described in this Exhibit D. b) Subcontractor shall participate in a preconstruction meeting with RJM at a time scheduled by RJM. The Quality Representative, among other Subcontractor personnel, shall attend the preconstruction meeting, as one of the purposes of the meeting will be to review the quality requirements for the Work under the Contract Documents. c) A Definable Feature of the Work (sometimes referred to as a DFW) is defined as a task which is separate and distinct from other tasks and has the same control requirements and work crews. For purposes of this Subcontract the Definable Features of the Work are identified in the scope exhibit attached as Exhibit B to the Subcontract, or as subsequently identified by RJM. Page 257 of 899 Page 9 of 14 Rev. 01.01.2025 d) Subcontractor shall, within thirty (30) calendar days after execution of the Subcontract (unless required earlier by the construction schedule), submit to RJM a site-specific Quality Management Plan covering all of the Work, including Work to be performed by subcontractors and suppliers at any tier to Subcontractor. The plan shall include the following: i. An organizational chart of Subcontractor personnel assigned to the Project with roles and responsibilities, including the identity of the Quality Representative. ii. Identification of individuals responsible for performance of inspection of various aspects of the Work. iii. The name, qualifications, duties and responsibilities of each person assigned to a quality control function. iv. A description of subcontractor's procedure for ensuring that the most current drawing updates, specification updates, requests for information, changes to the Contract Documents, and requirements of approved shop drawings will be processed, tracked and communicated to both office and field team members and will be incorporated into the as-built documents. v. A log to identify and track all testing required by the Contract Documents and applicable codes. vi. A complete list of closeout deliverables required under the Contract Documents, including operation and maintenance manuals, owner training(s), warranties, guarantees, and extra stock materials. vii. Checklists for all inspections required by the Quality Management Plan. If RJM provides comments on the Quality Management Plan, Subcontractor shall address RJM's comments and resubmit the Quality Management Plan to RJM. e) If scheduled by RJM, Subcontractor shall participate in one or more Pull-Planning Meetings with RJM and other subcontractors for the purpose of determining appropriate trade flow and further development of schedule details. f) In collaboration with RJM, Subcontractor shall develop an integrated work plan for each Definable Feature of the Work describing how the Work (including Work performed by its subcontractors and suppliers at any tier to Subcontractor) will be installed. The integrated work plan shall outline requirements for the following: 1) Safety 2) Quality 3) Site utilization and access 4) Schedule and work sequences (including where the work will start and what direction the work will proceed) 5) Manpower and other resources 6) Utilities needed for performance of the Work 7) Equipment needed for performance of the Work 8) Establishing conformity of materials with the Contract Documents and approved shop drawings 9) Material handling 10) Industry standards, references and best practices 11) Installation processes. g) For each Definable Feature of the Work, Subcontractor shall participate in a preinstallation coordination meeting (the “Preinstall Meeting”) to be scheduled by RJM prior to commencement of the applicable Work. The Quality Representative and the foreman or superintendent directly responsible for the installation of the applicable Work shall participate in Page 258 of 899 Page 10 of 14 Rev. 01.01.2025 the Preinstall Meeting. The purpose of the Preinstall Meeting will be to review the following in order to determine whether the installation is ready to proceed: 1) requirements of the drawings and specifications; 2) verification that all submittals have been submitted and approved; 3) required inspections and testing; 4) the Integrated Work Plan; 5) status of completion of predecessor activities; 6) Delivery status of required materials and availability of required labor; and 7) other matters related to the installation of the Work. h) The Integrated Work Plan (IWP”) for each Definable Feature of the Work shall be submitted to RJM at least one week prior to the Preinstall Meeting. If RJM provides comments on the IWP, Subcontractor shall address RJM's comments and resubmit the IWP to RJM. Subcontractor shall train its installation crews on the content of the IWP and perform the Work in accordance with the IWP. If any modifications to the IWP are required as a result of changed or unforeseen conditions, a revised IWP shall be submitted to and reviewed with RJM prior to commencement of the Work affected by the changed or unforeseen conditions, unless otherwise directed by RJM in writing. i) The Integrated Work Plan (IWP”) for each Definable Feature of the Work shall be submitted to RJM at least one week prior to the Preinstall Meeting. If RJM provides comments on the IWP, Subcontractor shall address RJM's comments and resubmit the IWP to RJM. Subcontractor shall train its installation crews on the content of the IWP and perform the Work in accordance with the IWP. If any modifications to the IWP are required as a result of changed or unforeseen conditions, a revised IWP shall be submitted to and reviewed with RJM prior to commencement of the Work affected by the changed or unforeseen conditions, unless otherwise directed by RJM in writing. j) Subcontractor shall schedule the preparation and submission of all submittals related to each Definable Feature of the Work to allow approval of such submittals prior to the Preinstall Meeting. k) If during the Preinstall Meeting it is determined that Subcontractor is not ready to proceed with the installation of the DFW, Subcontractor shall participate in additional Preparatory Meetings until it is determined that Subcontractor is adequately prepared to commence with the applicable Work. l) Subcontractor shall participate in and/or perform the following quality inspections of the Work (which may be at the Project site or at another location), at a minimum: m) An inspection of each mock-up that may be required by the Subcontract or Contract Documents. n) For each Definable Feature of the Work, an initial inspection (the "Initial Inspection") shall be conducted jointly by RJM and Subcontractor upon the completion of the installation of the first portion of the Work. The purpose of the Initial Inspection is to verify that the installation process is consistent with the requirements of the integrated work plan and that the Work conforms to the Contract Documents. If the installation process is not consistent with the integrated work plan, Subcontractor shall modify its installation process to conform to the integrated work plan or appropriately modify its integrated work plan. If the Work does not conform to the requirements of the Contract Documents, Subcontractor shall correct the Work immediately and in all cases before performing any additional Work. Page 259 of 899 Page 11 of 14 Rev. 01.01.2025 o) If any modifications are required to be made to the to the IWP as a result of the Initial Inspection, Subcontractor shall submit the modified plan to RJM for RJM’s review and comment prior to continuing with the installation. p) Follow up inspections, to be performed by Subcontractor for each Definable Feature of Work as follows: i. An inspection upon receipt of each delivery of equipment or materials that will be incorporated into the Work to ensure that the equipment or materials conform to the requirements of the Contract Documents. ii. On-going inspections shall be performed periodically as the Work progresses, at least in definable areas determined by RJM (for example, by room, area, elevation, or other) or at a frequency determined by RJM. iii. Cover-up inspections, before any in-wall work is covered up and made inaccessible by the successor trades. Cover-up Inspections shall be conducted and all work identified as deficient shall be corrected before the Work is made inaccessible. iv. A pre-final inspection, when Subcontractor believes that all Work is complete. v. A final inspection, after all non-conforming work previously identified has been corrected and Subcontractor believes the Work is complete, in order to verify that the Work is complete and acceptable. vi. For each inspection described above, Subcontractor shall use checklists and other quality control documents that may be required in the integrated work plan or the Contract Documents or that are jointly developed by Subcontractor and RJM. q) Supervision - The subcontractor will maintain a superintendent/foreman on the jobsite who is experienced and competent during all phases of the work. It is the Subcontractor’s responsibility to ensure that the superintendent has an adequate and up-to-date set of plans and any other information required to perform the work. r) Subcontractor shall maintain at the Project site and make available to RJM upon request any industry references, standards, best practices, or installation guidelines that are referenced by the Contract Documents or that directly pertain to the installation or acceptance of the Work. s) Subcontractor shall maintain current as-built drawings (and building information models if such models are used by Subcontractor) as the Work progresses, and shall, at any time upon request, make them available for review by RJM or submit them to RJM. t) Contiguous Work - Subcontractor will be responsible to review contiguous work and coordinate its work accordingly. This may include out of sequence installation or comeback operations when necessary. u) Daily Reports - At the discretion of the RJM Site Superintendent, the Subcontractor will furnish to RJM on a daily basis, a Daily Work Report, which will include, the total number of workers employed on the job, description of the work performed, and a breakdown of workers by craft. Daily work reports are required to be turned into RJM by the end of each work shift for that same day’s work. v) Pre-installation Inspection of Materials – Subcontractor is responsible for inspecting all materials prior to installation to determine that they meet specifications or other contractual requirements prior to installation. If included in the Subcontractor’s scope of work, Subcontractor shall arrange and pay for inspection of long lead items by a third party prior to shipment from the manufacturer to the job site. A copy of such inspection report shall be provided to Contractor before shipment of the materials. In addition, Contractor reserves the right, but is also under no obligations, to conduct its own inspection of any materials prior or after delivery of such materials for the sole benefit of Owner and Contractor. None of the Page 260 of 899 Page 12 of 14 Rev. 01.01.2025 inspections noted above shall affect or modify Subcontractor’s obligation to supply materials which comply with the Contract documents or any liability associated therewith. w) Inspections of Completed Work - Each subcontractor is responsible for scheduling and attending all required inspections related to their work. Subcontractors shall provide access for inspection of the work to RJM and the inspectors. The subcontractor shall notify RJM of all scheduled inspections. x) Cleanup - Subcontractor will be required to cleanup all Subcontractor generated debris from site on a daily basis. Concrete debris must be removed by the subcontractor on a daily basis. All other Subcontractor generated debris shall be sorted and placed within the recycling and debris bins provided by RJM at locations designated by RJM. Subcontractor must also remove any combustible debris on a daily basis. Should the Subcontractor fail to perform their cleanup responsibilities, RJM may give Subcontractor advanced notice of an intention to back charge for this work, however commensurate with the urgency, nature, and scope of the back charge , such advance notice shall not be a prerequisite for making such back charges against the Subcontractor. y) Nothing in this Exhibit D shall be deemed to diminish in any way Subcontractor’s responsibility for its means and methods, the quality and safety of the Work, performance of the Work as required by the construction schedule, or Subcontractor’s compliance in all respects with the Contract Documents. Subcontractor retains sole responsibility for all such matters. 3. BILLING REQUIREMENTS 3.1 Allowances a) Contract Allowance Work - If an allowance for a time and material scope of work is included within a contract, then it is assumed that all field supervision, office supervision and other overhead type costs are already included within the base bid amount. RJM will only approve field related direct costs for completing the work related to the allowance. These costs may include: journeyman labor, materials, subcontract costs and equipment costs. 3.2 Overtime / Additional Work a) Overtime Work: Subcontractors are to include any and all overtime required to complete their scope of work in accordance with the schedule set forth by RJM during the Bid Period. Any overtime work, above and beyond a forty (40) hour work week, required of the subcontractor to complete their work in accordance with RJM’s Construction Schedule shall be specifically quantified (broken out by number of weekday overtime hours required and number of weekend overtime hours required) by the subcontractor in their bid proposal to RJM. Any overtime work required of the subcontractor to complete their scope of work in accordance with the schedule set forth by RJM during the Bid Period, beyond what was quantified in the subcontractor’s bid proposal, shall be the subcontractor’s cost responsibility. Furthermore, all costs associated with RJM’s onsite supervision of such overtime work shall be the responsibility of the subcontractor. b) Extra Work - Quoted Scope: Requests for extra work will only be considered by RJM if the subcontractor submits a quotation to RJM in writing within three (3) calendar days of receipt of revised plans, addenda, or other change instruction. NOTE: Extra work shall not be performed by the subcontractor unless the full scope of work is approved in writing by RJM's project management team, prior to the start of the extra work. The onsite RJM superintendent cannot authorize extra work. Allowable overhead and profit on Change Requests shall be limited to a maximum of ten (10%) on Subcontractor self -performed work and five (5%) on sub-subcontract work. Unit costs for labor, material, equipment, etc. will be used to Page 261 of 899 Page 13 of 14 Rev. 01.01.2025 determine the direct cost of extra work and shall be in accordance with the mutually agreed upon unit costs which will be included in the subcontract documents. c) Extra Work - Field Directed: When schedule constraints dictate otherwise, RJM’s office may direct field work in advance of receiving a formal quotation. For these instances, any field work requested by RJM shall be performed by the subcontractor on a time and material basis. All labor, equipment, materials, etc. used shall be verified by RJM’s field superintendent in writing on an RJM Work Order on a daily basis. NOTE: Work performed without this written verification and without RJM’s field superintendent’s signature will not be approved by RJM. Unit costs for labor, material, equipment, etc. will be used to determine the direct cost of field work and shall be in accordance with the mutually agreed upon unit costs which will be included in the subcontract documents. Requests for change order(s) for all field work performed on a T&M basis must be submitted to RJM within three (3) calendar days following completion of the field work performed or they will not be approved by RJM 3.3 Invoicing a) Subcontractor Accounting: Subcontractors must submit monthly invoices broken out by the agreed upon schedule of values. b) Billing: Billing must be received at the RJM office by the 25th of each month if the subcontractor wishes to be paid on time. Billing for labor and equipment will only be allowed for work done between the time of the last invoice and the 25th of the current month. c) Payment for Materials - Billing for materials will be allowed once the material has been delivered to the site (note that it does not necessarily have to be installed) or special arrangements for stored materials may be made. Such invoicing shall be accompanied by a properly completed “Subcontractor/Storage Affidavit” along with photographic evidence of the material being claimed for storage. Additional Certificates of Insurance, naming RJM Construction as the Policy Holder, for an amount greater than or equal to the valuation of the Stored Materials will also be required. d) Lien Releases: Proper lien releases will be required prior to release of progress and final payments. RJM will require a conditional lien release from each subcontractor and unconditional lien releases from any lower tier vendors who have filed prelien notices. RJM reserves the right to issue joint checks payable to both the subcontractor and lower tier vendor. This policy applies to final payment as well. e) Retention: A retention of five percent (5%) of the total contract amount will be held until all of the contracted work is completed to the satisfaction of RJM, and all warranties, guarantees, and closeout documentation has been received by RJM. f) Pay Application Submission Criteria: RJM will require that all Applications for Payment and all supporting documents from Subcontractors and their sub-tier subcontractors and suppliers, be in electronic format and submitted on the RJM Pay Application and Continuation Sheets. g) Special Application for Payment Criteria / GCPay: Depending on the Project-specific set- up, submissions may be handled via standard AIA-type Application and Certificate for Payment Forms or through the GCPay payment management system. Should RJM mandate the use of GC Pay, Subcontractor shall be responsible for the fees and costs associated with the subcontractor’s use of this system. h) Certificates of Insurance: Subcontractors are required submit certificate of insurance to Billy, another third party vendor, or email to vendor_compliance@rjmconstruction.com as directed by RJM. Page 262 of 899 Page 14 of 14 Rev. 01.01.2025 4 WARRANTY/CLOSEOUT REQUIREMENTS 4.1 Warranties a) Warranties - All guaranties and warranties of materials used or incorporated into the work shall be assigned and delivered to RJM for transmittal to the Owner. The warranties in the contract documents or assigned to Owner (See exemption below): 1. shall not be deemed exclusive of any other warranty or guaranty, whether expressed or implied. 2. shall survive the completion of the work and/or termination of the contract. 3. and shall inure to the benefit of the Owner’s successors and assigns. b) Tax-Exemption Clause for Materials Only - In situations where the Project stipulates Tax- Exempt material purchases, the Subcontractor is still responsible for the documentation and transfer of the material warranties from the manufacturer/supplier to the Owner. c) Punchlist - Subcontractor shall complete or correct all punchlist items within five (5) working days after receipt of a punchlist. d) Closeout Documentation - All closeout documentation shall be submitted to the RJM Office within two (2) weeks of completion of the Subcontract Scope of Work in the format and quantities specified for the given Project. e) Retention Withholdings - RJM shall withhold all retention payments until receipt of an approved and complete closeout package is received by RJM’s office staff. Page 263 of 899 IDTask ModeTask Name Duration Start Finish Predecessors1Lakeville FiRST Center Schedule 1.9.25380 daysTue 12/31/24Mon 6/15/262Preconstruction94 daysTue 12/31/24Fri 5/9/253Bidding23 daysTue 12/31/24Thu 1/30/254Bid Opening 1 dayThu 1/30/25Thu 1/30/253FF5Award Contracts6 daysFri 1/31/25Fri 2/7/2546Permitting42 daysThu 1/9/25Fri 3/7/257Submittals65 daysMon 2/10/25Fri 5/9/2558Demo15 daysMon 3/17/25Fri 4/4/259Hazardous Waste Disposal3 daysMon 3/17/25Wed 3/19/256FS+5 days10Utilities Disconnects5 daysMon 3/17/25Fri 3/21/259SS11Building Demo10 daysMon 3/24/25Fri 4/4/259,1012Earthwork and Utilities108 daysMon 3/17/25Wed 8/13/2513Tree and Site Grubbing3 daysMon 3/17/25Wed 3/19/259SS14Site Clearing and Removal5 daysMon 4/7/25Fri 4/11/251115Soil Correction 15 daysMon 4/14/25Fri 5/2/251416Below Grade Utilities5 daysMon 5/5/25Fri 5/9/251517Temp Access Road3 daysMon 5/12/25Wed 5/14/251618Storm Sewer15 daysMon 5/5/25Fri 5/23/251519Site Electrical5 daysMon 5/5/25Fri 5/9/251520Footings Excavation15 daysMon 5/12/25Fri 5/30/251621Foundation Insullation 4 daysThu 6/19/25Tue 6/24/2535FS-2 days22Backfill To Top of Footing4 daysFri 6/20/25Wed 6/25/2521FS-3 days23Crane Road2 daysFri 6/27/25Mon 6/30/253824Curbs and Gutters5 daysMon 7/28/25Fri 8/1/254625Light Pole Bases3 daysMon 8/4/25Wed 8/6/252426Asphalt Sub Base3 daysThu 8/7/25Mon 8/11/252527Asphalt 1st lift1 dayTue 8/12/25Tue 8/12/252628Temporary Soil Stabilization1 dayWed 8/13/25Wed 8/13/252729Concrete & Masonry160 daysTue 5/13/25Mon 12/22/2530Form & Pour Strip Footings - Area B9 daysTue 5/13/25Fri 5/23/2520SS+1 day31MEP Sleeves - Area B3 daysWed 5/14/25Fri 5/16/2530SS+1 day32Form & Pour Foundation Walls - Area B9 daysMon 5/26/25Thu 6/5/253033Block Foundation Walls - Area B7 daysWed 5/28/25Thu 6/5/2532FF34Form & Pour Pad Footings - Area B5 daysMon 7/7/25Fri 7/11/2533,4235Form & Pour Strip Footings - Area A11 daysFri 6/6/25Fri 6/20/253336MEP Sleeves - Area A4 daysTue 6/10/25Fri 6/13/2535SS+2 days37Form & Pour Pad Footings - Area A5 daysMon 6/23/25Fri 6/27/253538Form & Pour Strip Footings - Warehouse4 daysMon 6/23/25Thu 6/26/253539Form & Pour Stoops15 daysMon 6/30/25Fri 7/18/253740Interior Above Grade Masonry15 daysTue 12/2/25Mon 12/22/2578SS+7 daysBidding4Bid Opening 5Award Contracts6Permitting7Submittals9Hazardous Waste Disposal10Utilities Disconnects11Building Demo13Tree and Site Grubbing14Site Clearing and Removal15Soil Correction 16Below Grade Utilities17Temp Access Road18Storm Sewer19Site Electrical20Footings Excavation21Foundation Insullation 22Backfill To Top of Footing23Crane Road24Curbs and Gutters25Light Pole Bases26Asphalt Sub Base27Asphalt 1st lift28Temporary Soil Stabilization30Form & Pour Strip Footings - Area B31MEP Sleeves - Area B32Form & Pour Foundation Walls - Area B33Block Foundation Walls - Area B34Form & Pour Pad Footings - Area B35Form & Pour Strip Footings - Area A36MEP Sleeves - Area A37Form & Pour Pad Footings - Area A38Form & Pour Strip Footings - Warehouse39Form & Pour Stoops40Interior Above Grade MasonryJanFebMarAprMayJunJulAugSepOctNovDecJanFebMarAprMayJunQtr 1, 2025Qtr 2, 2025Qtr 3, 2025Qtr 4, 2025Qtr 1, 2026Qtr 2, 2026Lakeville FiRST Center - Contract SchedulePage 1Page 264 of 899 IDTask ModeTask Name Duration Start Finish Predecessors41Precast135 daysTue 7/1/25Mon 1/5/2642Precast Erection - Area B4 daysTue 7/1/25Fri 7/4/252343Precast Erection - Area A6 daysMon 7/7/25Mon 7/14/254244Precast Welding and Detailing10 daysMon 7/7/25Fri 7/18/254245Below Grade Caulking4 daysTue 7/15/25Fri 7/18/254346Earthwork Backfill5 daysMon 7/21/25Fri 7/25/2545,4447Above Grade Caulking 5 daysMon 7/28/25Fri 8/1/254648Remove Precast Supports3 daysThu 9/11/25Mon 9/15/255549Structural Steel121 daysMon 7/21/25Mon 1/5/2650Bearing Plates & Deck Angle5 daysMon 7/21/25Fri 7/25/254451Columns5 daysMon 7/28/25Fri 8/1/255052Beams5 daysMon 8/4/25Fri 8/8/255153Joists8 daysMon 8/11/25Wed 8/20/255254Decking5 daysThu 8/21/25Wed 8/27/255355Welding and Detailing 10 daysThu 8/28/25Wed 9/10/255456Misc Metals10 daysTue 12/23/25Mon 1/5/264057Metal Panels15 daysTue 9/16/25Mon 10/6/2558Metal Panel Framing5 daysTue 9/16/25Mon 9/22/254859Metal Panels and Soffits10 daysTue 9/23/25Mon 10/6/255860Roofing31 daysThu 9/11/25Thu 10/23/2561Roof Blocking10 daysThu 9/11/25Wed 9/24/255562Roof Penetrations4 daysThu 9/11/25Tue 9/16/255563Roof Drain Rough Ins4 daysWed 9/17/25Mon 9/22/256264Roof Insulation 8 daysTue 9/23/25Thu 10/2/256365Roof Membrane 8 daysFri 10/3/25Tue 10/14/256466Roof Flashing6 daysWed 10/15/25Wed 10/22/256567Roof Pavers1 dayThu 10/23/25Thu 10/23/256668MEP Underground Rough Ins15 daysTue 9/16/25Mon 10/6/2569Plumbing Undergrounds10 daysTue 9/16/25Mon 9/29/254870Electrical Undergrounds8 daysThu 9/18/25Mon 9/29/2569FF71Trench Drains5 daysTue 9/30/25Mon 10/6/256972Slab on Grade Concrete69 daysWed 10/15/25Mon 1/19/2673Sand Cushion5 daysWed 10/15/25Tue 10/21/256574Vapor Barrier 8 daysMon 10/20/25Wed 10/29/2565FS+3 days75Insulation4 daysThu 10/30/25Tue 11/4/257476Rebar 8 daysWed 11/5/25Fri 11/14/257577Forming 4 daysMon 11/17/25Thu 11/20/257678Concrete Placement10 daysFri 11/21/25Thu 12/4/257779Concrete Curing 28 daysFri 12/5/25Tue 1/13/267880Concrete Sealing4 daysWed 1/14/26Mon 1/19/267942Precast Erection - Area B43Precast Erection - Area A44Precast Welding and Detailing45Below Grade Caulking46Earthwork Backfill47Above Grade Caulking 48Remove Precast Supports50Bearing Plates & Deck Angle51Columns52Beams53Joists54Decking55Welding and Detailing 56Misc Metals58Metal Panel Framing59Metal Panels and Soffits61Roof Blocking62Roof Penetrations63Roof Drain Rough Ins64Roof Insulation 65Roof Membrane 66Roof Flashing67Roof Pavers69Plumbing Undergrounds70Electrical Undergrounds71Trench Drains73Sand Cushion74Vapor Barrier 75Insulation76Rebar 77Forming 78Concrete Placement79Concrete Curing 80Concrete SealingJanFebMarAprMayJunJulAugSepOctNovDecJanFebMarAprMayJunQtr 1, 2025Qtr 2, 2025Qtr 3, 2025Qtr 4, 2025Qtr 1, 2026Qtr 2, 2026Lakeville FiRST Center - Contract SchedulePage 2Page 265 of 899 IDTask ModeTask Name Duration Start Finish Predecessors81Range System 75 daysMon 2/9/26Fri 5/22/2682Range System Installation 75 daysMon 2/9/26Fri 5/22/264083Interior Framing30 daysFri 12/5/25Thu 1/15/2684Doors Frames (Stud Walls)7 daysFri 12/5/25Mon 12/15/2585SS85Cold Form Metal Framing20 daysFri 12/5/25Thu 1/1/267886Door Frames (CMU Walls)5 daysTue 12/23/25Mon 12/29/254087Blocking & Backing10 daysFri 1/2/26Thu 1/15/268588MEP Rough Ins46 daysFri 1/2/26Fri 3/6/2689Plumbing Rough Ins20 daysFri 1/2/26Thu 1/29/268590HVAC Rough Ins20 daysFri 1/2/26Thu 1/29/268591Fire Suppression Rough Ins20 daysFri 1/2/26Thu 1/29/268592Electrical Rough Ins25 daysFri 1/2/26Thu 2/5/268593Low Voltage Rough Ins and Pathways10 daysFri 1/23/26Thu 2/5/2692FF94Fire Alarm Rough Ins10 daysFri 1/23/26Thu 2/5/2692FF95Drywall31 daysFri 1/23/26Fri 3/6/2696Drywall Hang15 daysFri 1/23/26Thu 2/12/2689FS-5 days97Drywall Finishing 16 daysFri 2/13/26Fri 3/6/269698Storefront, Doors, Windows76 daysFri 1/23/26Fri 5/8/2699Storefront Doors & Frames8 daysFri 1/23/26Tue 2/3/2696SS100Glazing8 daysWed 2/18/26Fri 2/27/2699FS+10 days101HM & Wood Doors7 daysThu 4/16/26Fri 4/24/26115102Door Hardware10 daysMon 4/27/26Fri 5/8/26101103Painting45 daysMon 3/9/26Fri 5/8/26104Paint Ceilings10 daysMon 3/9/26Fri 3/20/2697105Paint Precast and Masonry15 daysMon 3/23/26Fri 4/10/26104106Paint Interior Drywall 10 daysMon 4/13/26Fri 4/24/26105107Paint Misc Metals10 daysMon 4/27/26Fri 5/8/26106108Tile18 daysMon 3/9/26Wed 4/1/26109Wall Tile 8 daysMon 3/9/26Wed 3/18/2697110Floor Tile10 daysThu 3/19/26Wed 4/1/26109111Flooring93 daysWed 1/14/26Fri 5/22/26112Polished Concrete5 daysWed 1/14/26Tue 1/20/2679113Carpet15 daysThu 4/2/26Wed 4/22/26110114Resilient Flooring15 daysThu 4/2/26Wed 4/22/26110115Wood Flooring10 daysThu 4/2/26Wed 4/15/26110116Interior Finishes37 daysThu 4/2/26Fri 5/22/26117Restroom Partitions5 daysThu 4/2/26Wed 4/8/26110118Casework15 daysThu 4/23/26Wed 5/13/26113119Stainless Countertops7 daysMon 4/27/26Tue 5/5/26106120Toilet Accessories6 daysThu 4/9/26Thu 4/16/2611782Range System Installation 84Doors Frames (Stud Walls)85Cold Form Metal Framing86Door Frames (CMU Walls)87Blocking & Backing89Plumbing Rough Ins90HVAC Rough Ins91Fire Suppression Rough Ins92Electrical Rough Ins93Low Voltage Rough Ins and Pathways94Fire Alarm Rough Ins96Drywall Hang97Drywall Finishing 99Storefront Doors & Frames100Glazing101HM & Wood Doors102Door Hardware104Paint Ceilings105Paint Precast and Masonry106Paint Interior Drywall 107Paint Misc Metals109Wall Tile 110Floor Tile112Polished Concrete113Carpet114Resilient Flooring115Wood Flooring117Restroom Partitions118Casework119Stainless Countertops120Toilet AccessoriesJanFebMarAprMayJunJulAugSepOctNovDecJanFebMarAprMayJunQtr 1, 2025Qtr 2, 2025Qtr 3, 2025Qtr 4, 2025Qtr 1, 2026Qtr 2, 2026Lakeville FiRST Center - Contract SchedulePage 3Page 266 of 899 IDTask ModeTask Name Duration Start Finish Predecessors121Fire Extinguisher Cabinets3 daysMon 4/27/26Wed 4/29/26106122ACT Ceiling20 daysMon 4/27/26Fri 5/22/26106123Lockers8 daysMon 4/27/26Wed 5/6/26106124Doors and Hardware8 daysThu 4/23/26Mon 5/4/26113125Interior Glazing3 daysTue 5/5/26Thu 5/7/26124126Door Operators3 daysTue 5/5/26Thu 5/7/26124127Appliances2 daysThu 5/14/26Fri 5/15/26118128MEP Finishes23 daysMon 4/27/26Wed 5/27/26129Lighting Fixtures and Devices15 daysMon 4/27/26Fri 5/15/26106130Grills, Diffuesers, Registers15 daysMon 4/27/26Fri 5/15/26129FF131Plumbing Fixtures10 daysThu 5/14/26Wed 5/27/26118132Low Voltage Finishes10 daysThu 5/14/26Wed 5/27/26131FF133Testing and Balancing8 daysMon 5/18/26Wed 5/27/26130134Final Cleaning 17 daysTue 5/5/26Wed 5/27/26135Final Clean Parking3 daysThu 5/7/26Mon 5/11/26146136Final Clean Interior8 daysMon 5/18/26Wed 5/27/26127137Final Clean Exterior4 daysTue 5/5/26Fri 5/8/26144138Precast Finish5 daysMon 5/11/26Fri 5/15/26139Precast Washing and Graffiti Coat5 daysMon 5/11/26Fri 5/15/26137140Exterior Improvements40 daysThu 4/2/26Wed 5/27/26141Exterior Flatwork10 daysThu 4/2/26Wed 4/15/26115SS142Exterior Fence and Gate10 daysMon 4/6/26Fri 4/17/26141SS+2 days143Landscape Irrigation5 daysThu 4/16/26Wed 4/22/26141144Landscaping8 daysThu 4/23/26Mon 5/4/26143145Exterior Building Sign8 daysMon 5/18/26Wed 5/27/26139146Asphalt 2nd Lift2 daysTue 5/5/26Wed 5/6/26144147Parking Lot Striping1 dayThu 5/7/26Thu 5/7/26146148Substantial Completion13 daysThu 5/28/26Mon 6/15/26149Substantial Completion1 dayThu 5/28/26Thu 5/28/26147,136,127150Punchlist11 daysFri 5/29/26Fri 6/12/26149151Owner Equipment5 daysFri 5/29/26Thu 6/4/26149152Owner Furniture10 daysFri 5/29/26Thu 6/11/26149153Owner Occupancy1 dayMon 6/15/26Mon 6/15/26150,151,152121Fire Extinguisher Cabinets122ACT Ceiling123Lockers124Doors and Hardware125Interior Glazing126Door Operators127Appliances129Lighting Fixtures and Devices130Grills, Diffuesers, Registers131Plumbing Fixtures132Low Voltage Finishes133Testing and Balancing135Final Clean Parking136Final Clean Interior137Final Clean Exterior139Precast Washing and Graffiti Coat141Exterior Flatwork142Exterior Fence and Gate143Landscape Irrigation144Landscaping145Exterior Building Sign146Asphalt 2nd Lift147Parking Lot Striping149Substantial Completion150Punchlist151Owner Equipment152Owner Furniture153Owner OccupancyJanFebMarAprMayJunJulAugSepOctNovDecJanFebMarAprMayJunQtr 1, 2025Qtr 2, 2025Qtr 3, 2025Qtr 4, 2025Qtr 1, 2026Qtr 2, 2026Lakeville FiRST Center - Contract SchedulePage 4Page 267 of 899 INVOICING REQUIREMENTS GCPay will be utilized for this project and will be required for all submissions of payment applications, change orders, compliance materials and lien waivers. GCPay is an online construction payment management product that allows general contractors and subcontractors to quickly and easily collaborate on and automate the application for payment (AFP), lien waiver, compliance and payment process Subcontractors shall use GCPay to submit all payment applications, compliance materials and lien waivers. GCPay is cloud-based, so can be used at any time by visiting gcpay.com from any device – computer, tablet or smart phone. While the GCPay system is simple to use, GCPay will provide online training session/s for you and your employees. We will schedule these trainings in the near future and notify you of date and time, along with a meeting invite. If you are not already registered within the GC Pay database system, immediately after Subcontract Award, Subcontractors can use the following steps to have your business set up in the system: 1. Visit gcpay.com and click GET STARTED at the top of the home page. If you have questions during the registration process, call the GCPay customer support team on 877-447-2584 2. Follow the prompts to register your company and create a login If you are already using GCPay for other projects or GC’s, you do not need to register again. We will give access to your projects and you will see these projects the next time you log in to GCPay. 24 x 7 x 365 support is available to you. Contact the GCPay support team at any time by phone on 877 - 447-2584 or by email on support@gcpay.com. GCPay is being implemented on this project at no cost to the Subcontractor. However, should the Subcontractor wish to select payment by ACH, a, 0.15% fee will be charged ($25 minimum per payment, $2,500 cap per contract). Page 268 of 899 RJM Construction CITY OF LAKEVILLE FiRST CENTER Golden Valley, Minnesota LAKEVILLE, MN RESPONSIBLE CONTRACTOR VERIFICATION 004115 Bid Package #2 SECTION 004115 RESPONSIBLE CONTRACTOR VERIFICATION Page 269 of 899 RJM Construction CITY OF LAKEVILLE FiRST CENTER Golden Valley, Minnesota LAKEVILLE, MN RESPONSIBLE CONTRACTOR VERIFICATION 004115 Bid Package #2 AFFIDAVIT OF RESPONSIBLE CONTRACTOR State of Minnesota ) ) SS County of ____________ ) I hereby swear (or affirm) under the penalty for perjury at the time of submitting a prime contractor bid for the City of Lakeville FiRST Center project to the City of Lakeville: 1. That I am a contractor within the meaning of MINN. STAT. § 16C.285, subd 1(c); 2. That I am in compliance with worker’s compensation and unemployment insurance requirements; 3. That I am currently registered with the Department of Revenue and the Department of Employment and Economic Development; 4. That I have a valid Federal Tax Identification Number; 5. That if I am a foreign corporation or cooperative, I have filed a Certificate of Authority to transact business in Minnesota with the Secretary of State; 6. That I am in compliance with and since July 1, 2014 or a three-year period before submitting this verification, whichever is shorter (“Applicable Period”), have not violated Minn. Stat. §§ 177.24, 177.25, 177.41 – 177.44, 181.13, 181.14 or 181.722, and have not violated United States Code, title 29, sections 201 to 219, or United States Code, title 40, sections 3141 to 3148. For purposes of this clause, a violation occurs when a contractor or related entity: i. Repeatedly fails to pay statutorily required wages or penalties on one or more separate projects for a total underpayment of $25,000 or more within the Applicable Period, provided that a failure to pay is “repeated” only if it involves two or more separate and distinct occurrences of underpayment during the Applicable Period; ii. Has been issued an order to comply by the commissioner of labor and industry that has become final; Page 270 of 899 RJM Construction CITY OF LAKEVILLE FiRST CENTER Golden Valley, Minnesota LAKEVILLE, MN RESPONSIBLE CONTRACTOR VERIFICATION 004115 Bid Package #2 iii. Has been issued at least two determination letters within the Applicable Period by the Department of Transportation finding an underpayment by the contractor or related entity to its own employees; iv. Has been found by the commissioner of labor and industry to have repeatedly or willfully violated any of the sections referenced in this clause pursuant to Minn. Stat. § 177.27; v. Has been issued a ruling or findings of underpayment by the administrator of the Wage and Hour Division of the United States Department of Labor that have become final or have been upheld by an administrative law judge or the Administrative Review Board; or vi. Has been found liable for underpayment of wages or penalties or misrepresenting a construction worker as an independent contractor in an action brought in a court having jurisdiction. 7. That I am in compliance with and, during the Applicable Period before submitting the verification, have not violated Minn. Stat. § 181.723 or Minn. Stat. Ch. 326B. For purposes of this clause, a violation occurs when a contractor has been issued a final administrative or licensing order; 8. That I have not received a final determination assessing a monetary sanction from the Department of Administration or Transportation for failure to meet targeted group business, disadvantaged business enterprise, or veteran-owned business goals, due to a lack of good faith effort, more than once during the Applicable Period before submitting the verification; 9. That I am not currently suspended or debarred by the federal government or the state of Minnesota or any of its departments, commissions, agencies, or political subdivisions that have authority to debar a contractor; 10. That the following consists of a list of first-tier subcontractors that I intend to retain for work on the Project: i. ii. iii. iv. 11. That I will submit to the City a supplemental verification under oath confirming compliance with Minn. Stat. § 16C.285, subdivision 3, clause (7) upon being determined the apparent successful prime contractor as a condition precedent to execution of the construction contract with the City for the Project. Firm (Contractor/Bidder) Name____________________________________________________ Page 271 of 899 RJM Construction CITY OF LAKEVILLE FiRST CENTER Golden Valley, Minnesota LAKEVILLE, MN RESPONSIBLE CONTRACTOR VERIFICATION 004115 Bid Package #2 Signed _______________________________________________________________________ (Owner or Officer) Printed Name by Owner or Officer: __________________________________________ Title: _____________________________________ Bidder’s E.I. Number: ___________________________________________________________ (Number used on Employer’s Quarterly Federal Tax Return, U.S. Treasury Department Form 941) Subscribed and sworn to before me this __________ day of ____________________, 20___. (SEAL) __________________________________________ Notary Public Page 272 of 899 RJM Construction CITY OF LAKEVILLE FiRST CENTER Golden Valley, Minnesota LAKEVILLE, MN RESPONSIBLE CONTRACTOR VERIFICATION 004115 Bid Package #2 END OF SECTION Page 273 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 1 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx RJM Construction City of Lakeville Public Safety Training Facility (Project Number 24520-0014) JOBSITE SAFETY REQUIREMENTS All persons working or visiting shall comply with the following safety requirements on all RJM Construction worksites. Each subcontractor is responsible for their tiered-subcontractor and vendors they shall assume all expenses related to, but not limited to, the following safety protocols: • Personal protective equipment • Drug and alcohol-free workplace testing • Training requirements Each Subcontractor shall designate a full time on-site safety representative. The safety representative shall be responsible for performing safety inspections and identifying and resolving safety related concerns. All subcontractors shall have their site supervisor and/or safety representative attend a pre-construction meeting to review the following: • Safety policies for the jobsite • New employee orientation requirements • Weekly Tool-Box Safety meetings at the jobsite (to be turned in weekly to RJM Superintendent) • Conducting a weekly safety inspection and hazard identification • Accident reporting and emergency procedures • Accountability for all crew members and tiered subcontractor crew members in the event of an emergency and reporting to the site superintendent if anyone is unable to be accounted for. If the subcontractor or tiered-subcontractor refuses to correct unsafe conditions, RJM Construction and their representatives are authorized to stop that portion of the work until the work can be brought into compliance with established project safety requirements. The cost to bring the work operation into compliance shall be incurred by the subcontractor and/or tiered-subcontractor and at no time shall the cost be charged to RJM Construction. Each subcontractor shall immediately notify RJM Construction Project Superintendent of all employee injuries, property damage and general public incidents. Written investigation reports shall be completed and forwarded to RJM Construction Superintendent within 24 hours of any incident involving employee injury, property damage and incidents with the general public. Page 274 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 2 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx Safety Orientation and Policies For ALL personnel working or visiting on RJM Construction Project’s Check when completed To be completed by Subcontractors, their tiered-subcontractors, Architects, Engineers and vendor employees prior to beginning work on site. All site visitors are also required to complete a visitor waiver. Initial ____ RJM Employees, Contractors and tiers of subcontractors and vendors shall adhere to all RJM site- specific safety requirements, OSHA applicable regulations (most current edition) and state, federal and local regulations. Initial ____ DO NOT remove, alter or otherwise impair the effectiveness of safety measures without approval from RJM Construction Superintendent. Doing so may result in removal from site. Initial ____ Subcontractors shall hold weekly safety meetings with all workers (mandatory attendance). Document these meetings and submit a copy to RJM Construction Supervision. Job Site Conduct/Policies Initial ____ Anyone acting in an unsafe manner may be removed from the jobsite. Initial ____ Use of iPods, MP3 Players and personal Radio/Cd players requiring earbuds or headsets and personnel cell phone use are prohibited. UNDER NO CIRCUMSTANCES SHOULD AN OPERATOR BE ON THE PHONE WHILE ANY EQUIPMENT IS IN USE. If you must take a business call during operation, you must stop the equipment, put it in neutral/park, lower attachments to the ground, then take the call. Initial ____ Alcohol, drug use, marijuana/THC/cannabis products, fighting, harassment or horseplay are prohibited and will result in immediate removal from the project and or company. Initial ____ Tobacco products (including e-cigarettes) are only allowed outside the building; violations may lead to immediate removal from the site. Initial ____ Inappropriate language or negative attitudes will not be tolerated. Offenders may be asked to leave the site. All jobsite workers must be respectful always. Initial ____ All workers must use designated construction entry points. The requirement to wear PPE starts as soon as you set foot on the site. Subcontractor Responsibility (ies): 1. ____ Have required competent person on site at all times. Provide names to RJM superintendent. 2. ____ Ensure that all new employees, vendors and visitors to the construction project shall be properly trained in hazard recognition and complete the site safety orientation requirements. 3. ____ No one is to operate motorized power trucks and other mechanized equipment unless certified by subcontractor and listed on the RJM Equipment Trained form. OSHA requires certain equipment operators be certified. Proof of certification must be provided upon request. All moving equipment is to be inspected daily and have proper warning devises. Seat belts, if provided, are to be used at all times. Page 275 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 3 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx Site Chemicals: 1. ____ Monitor all combustible engines for Carbon Monoxide. Diesel engines must be monitored for NO2. Document results at least 3 times per shift. If CO goes over 50 on meter, document every 10 minutes until under 50. CO level of 100 requires evacuation. If NO2 goes over 2.5, document every 10 minutes until under 2.5. NO2 level of 5 requires evacuation. 2. ____ Submit to RJM a copy of their Safety Manual and all required Safety Data Sheets PRIOR to starting work. 3. ____ Review SDS on all chemicals you are using with RJM Superintendent Personal Protective Equipment required within established construction site: 1. ____ Wear hardhats 100% of the time (RJM does not furnish hardhats to anyone other than visitors) 2. ____ Wear ANSI Z-87 approved eye and face protection 100% of the time while on the construction project. Prescription safety glasses require side shields. Face protection (shield) required when using grinders, chop saw, chipping hammer, and partner saw. 3. ____ Appropriate hard sole footwear shall be worn based on employee activity. (no athletic shoes, high heels or open toed footwear) 4. ____ Appropriate clothing shall be worn based on the jobsite. NO Shorts, skirts, or dresses. Trades are not allowed to wear tank tops; all shirts must have a minimum of a 4” sleeve) 5. ____ Additional PPE as needed to protect workers from injury. 6. ____ Wear Class II High Visibility Clothing when working around moving motor vehicles, traffic or as designated by jobsite rules. 7. ____ All subcontractor delivery personnel are always to wear appropriate PPE while out of vehicle or remain in their vehicles. It is the subcontractor’s responsibility to notify their vendor and enforce this policy. 8 9. ____ _____ All personnel working in an area generating airborne silica dust must wear proper PPE. Employees of subcontractors must always follow their Silica Exposure Control Plan. If a dust cloud forms, no workers will be allowed to work in that area without proper PPE. RJM will stop all work not conforming to the Plan All persons welding are to wear proper clothing, hoods, glasses and ensure area is screened to prevent others from viewing the arc. Housekeeping should be performed during and at end of work day: 1. ____ Always keep jobsite clean. 2. ____ DO NOT use fire extinguisher holders for any other use than they were intended for . 3. ____ Ensure all compressed gas cylinders are properly stored and secured at all times. Page 276 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 4 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx 4. ____ Be aware of causes of Slips, Trips and Fall conditions and correct immediately. 5. ____ Install all proper signage and controlled access zones to ensure others safety. 6. ____ Never block emergency exits, keep exit lanes open at all times. 7. ____ All concrete masonry contractors are to provide a cleanup station for removal of Hexavalent chromium from the skin if running water is not available. 8. ____ Everyone is to eat in their designated lunch areas. Empty pop and water containers are to be put in the garbage and NOT left on ledges nor thrown on the floor or put in the construction debris piles. 9. ____ When sweeping the floor, compound or vacuuming must be used to control the dust. Piles are NOT to be left on the floor. They must be picked up immediately after sweeping. DRY sweeping is NOT allowed. 10. ____ Use of stilts is prohibited in areas where the floor is not 100% free of debris and electrical cords, or anything that can be perceived as a trip hazard. Site Conditions: Electrical: 1. ____ Conduct and document daily jobsite safety inspection for your work area. 2. ____ Fall protection policy requires workers exposed to falls of six feet and greater to use established fall protection methods or be 100% tied off. 3. ____ All scaffolding is to be inspected daily and the inspection card signed and attached to the scaffold. Do not use scaffold unless it has been inspected and the card signed off by the competent person daily. 4. ____ All hoisting or rigging is to be done in a controlled access zone with authorized personnel only allowed. 5. ____ All exposed vertical rebar, sill plate bolts, column pier bolts, and form stakes (any rod/conduit protruding above the working surface) must have caps or similar protection method on then to prevent impalement. 6. ____ DO NOT enter any area marked off by RED DANGER TAPE or signed as a Controlled Access Zone unless authorized. 7. ____ Prior to saw cutting or coring the floor, the subcontractor must scan the area to be cut for in bed or under slab utilities. Mark slab with results, if present review with RJM Superintendent prior to cutting. 8. ____ Any openings in the floor larger than 1” must be covered. Cover needs to be spray painted orange and marked as HOLE then secured to the floor immediately after exposing or creating it Never leave an unsafe condition unattended until properly covered or barricaded. 9. ____ Before employees are allowed to work in excavations, a competent person shall be identified and determine type of soil and employee protection methods. 10. _____ All HOT work requires a permit (includes grinding). A fire extinguisher must be present at all times. Do not move jobsite fire extinguishers. All Welding, at eye level, requires proper screening. 11. _____ All utilities are to be exposed by hand digging when excavations are within 4’ of a marked utility location. Page 277 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 5 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx 1. ____ Remove all unsafe electrical cords, tools and equipment from the jobsite immediately upon discovering defect. ONLY cords with markings showing (SJ, SJO, SJT, SJTO, S, SO, ST, and STO) are allowed. ONLY 12 gauge or lower cords can be repaired. ALL repairs must return cord to original condition. When possible, extension cords must be kept off the floor. Extension cords may not be plugged into one another if so designated by manufacture. 2. ____ Ground fault circuit interrupters (GFCI) are required on all tools and equipment. All extension cords and power tools shall be properly grounded and inspected daily for damage. 3. ____ Use of power strips for anything outside of office area is prohibited 4. ____ All GFCI are to be tested monthly and test documented on equipment. 5. ____ ALL electrical panels in the construction area are to be labeled as either ENERGIZED or NOT ENERGIZED. Uncovered Energized panels are not to be left unattended. Proper covers or controlled access are required. 6. ____ Prior to any demolition work check with electrician to make sure proper lockout /tagout procedures are in place and verified. All other utilities are to be shut off or disconnected prior to demolition activity starting. 7. ____ ALL work within 50 feet of high-voltage overhead lines MUST be coordinated with the RJM superintendent. TOOLS: 1. ____ Never use unguarded tools. 2. ____ Use ladders per OSHA guidelines and manufactures restrictions. Ensure ladders are inspected daily prior to use. 3. ____ Proper Lockout/Tagout procedures are required when working on equipment or tools where unexpected start-up may occur, or the release of energy may result in injury. 4. ____ All tools are to be inspected daily before use. Remove all unsafe tools and equipment from the jobsite immediately upon discovering defect. Equipment: 1. ____ Conduct and document daily jobsite safety inspection of all equipment and equipment of your tiered subcontractors. 2. ____ ALL Cranes, lifts and forklifts MUST have current annual inspection stickers on equipment. 3. ____ TWO WEEKS Prior to any crane use, a Crane Lift plan must be filled out, signed off by both the crane company representative and the vendor safety representative. The plan is then submitted to the RJM Superintendent, then RJM Safety Director for final approval. ALL Crane operators must show Certification prior to beginning setup. 4. ____ When using a scissors lift the chain must always be attached. Aerial lifts require fall protection use at all time. 5. ____ All lifts must be inspected before each shift. Page 278 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 6 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx 6. ____ Prior to moving the lift, the floor must be clear of all debris and materials. NEVER run over an extension cord with a lift. Make sure travel path is level with no openings in floor. Industrial Hygiene 1. ____ Review any environmental reports. When doing work in an area and you encounter a substance you suspect is hazardous, STOP, contact the RJM superintendent immediately, do not proceed until instructed to. 2. ____ When working around material marked “contains” asbestos and/or lead, please follow established procedures. Under no circumstances are you to disturb these areas without previous RJM Superintendent authorization. All cutting, Chipping, drilling, sanding and grinding of silica/quartz containing products must be done with appropriate dust controls. If a dust cloud forms, no workers will be allowed to work in that area without proper PPE. Wet methods or attached vacuums are required. RJM /Subcontractor Silica Exposure Control Plan must always be followed. Activities will be stopped if controls are not in place or being properly followed. 7. ____ Always remain alert to the equipment moving around you. DO NOT get near moving equipment unless necessary. Do not walk beside equipment. If necessary, to travel with a piece of equipment, walk in front or behind it. 8. ____ If you need to communicate verbally with the operator, use hand signals to get their attention. Approach equipment so the operator can see you. Wait for them to acknowledge you and stop the equipment before approaching. IF YOU CAN’T SEE THE OPERATOR, THEY CAN’T SEE YOU 9. 10. ____ ____ Be aware of the swing radius of excavators and other equipment do not work or travel within that radius. Forklift free rigging will not be allowed. Picks using a forklift require the use of an engineered attachment. Page 279 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 7 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx EMERGENCY ACTION PLAN 1. ___ Subcontractors are required to have First Aid kits with their crew at all times. 2. ___ RJM has a First AID Kit, AED UNIT and Eye Wash station in the Construction Office. 3. ___ Everyone within the construction site are to go to the designated Tornado shelter upon hearing warning sirens. The location is ________________________. 4. ___ ALARM and EMERGENCY COMMUNICATION is as follows: MEDICAL EMERGENCY - 3 (three) blasts of the air horn. Radio/phone calls to superintendent with location of the Accident/injured party. SITE EVACUATION - 6 (six) blasts of the air horn (leave site immediately) Other hazards discussed related to the construction project: IN ADDITION TO THE ITEMS LISTED ABOVE ALL CONTRACTORS AND THEIR WORKERS ARE REQUIRED TO FOLLOW MNOSHA RULES AND REGULATIONS AT ALL TIMES WHILE ON THE JOBSITE. Page 280 of 899 Company Name: ____________________________ Initials _______ Date__________ Page 8 of 8 3/6/2025 https://rjmconstruction.sharepoint.com/sites/NDrive/Shared Documents/Safety/Orientation/Jobsite orientation/Jobsite Specific Orientation Requirements/City of Lakeville Public Safety Subcontractor.docx Subcontractors and their tiered-subcontractors shall enforce these safety requirements and any employee who fails to follow those requirements shall be subject to the following disciplinary actions: Non-Serious – Safety infractions of a less serious nature will be handled as follows: Serious – One which could result in serious injury or loss of life or serious loss of property, may be subject to three- day suspension or immediate removal from the site. Fall Protection – An employee who is found not tied off in an area that requires fall protection is subject to immediate removal from the jobsite. Supervisor Accountability – If two or more employees working for the same supervisor are found in serious infraction as described above, that subcontractor supervisor is also subject to disciplinary action up to and including immediate removal from the site. 1st Offense: non-serious Verbal Warning (documented in safety assessment) 2nd Offense: non-serious Written Warning Removal from the project for remainder of day 3rd Offense: non-serious or 1st Serious Offense Written Warning Removal from project for remainder of day and the entire following day. 4th Offense: non-serious or 2nd Serious Offense Written Warning Removal of employee from RJM jobs for one year. Documentation - Notice of safety hazards (written) shall be given to the employee, and a copy sent to the company Project Manager/Safety Director. RJM RESERVES THE RIGHT TO REMOVE ANYONE FROM ANY JOBSITE AT ANY TIME. ANY EMPLOYEE OF A SUBCONTRACTOR OR TIERED-SUBCONTRACTOR REMOVED FROM THE JOB SITE WILL NOT BE ALLOWED ON ANY RJM CONSTRUCTION SITE FOR A PERIOD OF ONE (1) YEAR. This is to acknowledge that I have completed the RJM Safety Orientation and understand that failure to comply with the Safety Program may be grounds for actions identified above and in the contract. Employee Name (Print): Date: Name of Subcontractor (Print): Subcontractor Employee Signature: Subcontractor Supervisor/Foreman Signature: RJM Safety Representative Signature: Date: BADGE # _______________ Page 281 of 899 Date: 10/6/2025 Amelia Meadows 2nd Addition Final Plat Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution approving the Amelia Meadows 2nd Addition final plat. Overview U.S. Home, LLC has submitted a final plat application for eight single family lots, 62 attached townhome lots, and five outlots on 39.35 acres of land located east of Cedar Avenue (CSAH 23) and north of 200th Street (CR 64). The Amelia Meadows preliminary plat of 88 single family lots and 144 attached townhome lots was approved by the City Council on November 18, 2024. The Amelia Meadows final plat of 49 single family lots was approved by the City Council on June 2, 2025. The Amelia Meadows 2nd Addition final plat is consistent with the approved preliminary plat and after approval, there will be 31 single family lots and 82 attached townhome lots yet to be final platted. The final plat plans have been reviewed by Engineering and Parks and Recreation staff. Supporting Information 1. Final Plat Resolution 2. Signed Development Contract 3. Planning & Engineering reports Financial Impact: $0 Budgeted: No Source: Envision Lakeville Community Values: Report Completed by: Kris Jenson, Planning Manager Page 282 of 899 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 25-______ RESOLUTION APPROVING THE FINAL PLAT OF AMELIA MEADOWS 2ND ADDITION WHEREAS, the owner of the property described as AMELIA MEADOWS 2ND ADDITION has requested final plat approval; and WHEREAS, the preliminary plat was reviewed by the Planning Commission and the Parks, Recreation and Natural Resources Committee and approved by the City Council; and WHEREAS, the final plat is consistent with the preliminary plat; and WHEREAS, the final plat is acceptable to the City; NOW THEREFORE BE IT RESOLVED by the Lakeville City Council: 1. AMELIA MEADOWS 2ND ADDITION final plat is hereby approved subject to the development contract and security requirements. 2. The Mayor and City Clerk are hereby authorized to sign the final plat mylars and the development contract. 3. The City Clerk is directed to file a certified copy of this resolution with the Dakota County Recorder. Page 283 of 899 2 ADOPTED by the Lakeville City Council this 6th day of October 2025. CITY OF LAKEVILLE Luke M. Hellier, Mayor ATTEST: _______________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) CITY OF LAKEVILLE ) I hereby certify that the foregoing Resolution No. 25-_________is a true and correct copy of the resolution presented to and adopted by the City Council of the City of Lakeville at a duly authorized meeting thereof held on the 6th day of October 2025 as shown by the minutes of said meeting in my possession. __________________________ Ann Orlofsky City Clerk (SEAL) Drafted By: City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Page 284 of 899 1 237337v5 Amelia Meadows 2nd Addition (reserved for recording information) DEVELOPMENT CONTRACT (Developer Installed Improvements) AMELIA MEADOWS 2ND ADDITION THIS DEVELOPMENT CONTRACT (the “Contract”) dated ____________________, 2025, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation (“City”), and U.S. HOME, LLC, a Minnesota corporation (the “Developer”). 1. REQUEST FOR PLAT. The Developer has asked the City to approve a plat for AMELIA MEADOWS 2ND ADDITION (referred to in this Contract as the "plat"). The land is situated in the County of Dakota, State of Minnesota, and is legally described on Exhibit A attached hereto and made a part hereof by reference. 2. CONDITIONS OF PLAT. The City hereby approves the plat on condition that the Developer enter into this Contract, furnish the security required by it, and record the plat with the County Recorder or Registrar of Titles within 180 days after the City Council approves the final plat. 3. RIGHT TO PROCEED. Within the plat or land to be platted, the Developer may not grade or otherwise disturb the earth or remove trees, unless a grading permit has been approved by the City Engineer Page 285 of 899 2 237337v5 Amelia Meadows 2nd Addition following approval of a preliminary plat by the City Council, construct sewer lines, water lines, streets, utilities, public or private improvements, or any buildings until all the following conditions have been satisfied: 1) this agreement has been fully executed by both parties and filed with the City Clerk, 2) the necessary security has been received by the City, 3) the necessary insurance for the Developer and its construction contractors has been received by the City, and 4) the plat has been filed with the Dakota County Recorder or Registrar of Titles’ office. 4. PHASED DEVELOPMENT. If the plat is a phase of a multi-phased preliminary plat, the City may refuse to approve final plats of subsequent phases if the Developer has breached this Contract and the breach has not been remedied. Development of subsequent phases may not proceed until Development Contracts for such phases are approved by the City. Park dedication charges referred to in this Contract are not being imposed on outlots, if any, in the plat that are designated in an approved preliminary plat for future subdivision into lots and blocks. Such charges will be calculated and imposed when the outlots are final platted into lots and blocks. 5. PRELIMINARY PLAT STATUS. If the plat is a phase of a multi-phased preliminary plat, the preliminary plat approval for all phases not final platted shall lapse and be void unless final platted into lots and blocks, not outlots, within two (2) years after preliminary plat approval. 6. CHANGES IN OFFICIAL CONTROLS. For two (2) years from the date of this Contract, no amendments to the City’s Comprehensive Plan, except an amendment placing the plat in the current metropolitan urban service area, or official controls shall apply to or affect the use, development density, lot size, lot layout or dedications of the approved plat unless required by state or federal law or agreed to in writing by the City and the Developer. Thereafter, notwithstanding anything in this Contract to the contrary, to the full extent permitted by state law, the City may require compliance with any amendments to the City’s Comprehensive Plan, official controls, platting or dedication requirements enacted after the date of this Contract. 7. DEVELOPMENT PLANS. The plat shall be developed in accordance with the following plans. The plans shall not be attached to this Contract. With the exception of Plans A, B, C, and F the plans may be Page 286 of 899 3 237337v5 Amelia Meadows 2nd Addition prepared, subject to the City Engineer’s approval, after entering the Contract, but before commencement of any work in the plat. The City Engineer may approve minor amendments to Plan B without City Council approval. The erosion control plan may also be approved by the Dakota County Soil and Water Conservation District. If the plans vary from the written terms of this Contract, the written terms shall control. The plans are: Plan A - Plat Plan B - Final Grading, Drainage, and Erosion Control Plan Plan C - Plans and Specifications for Public Improvements Plan D - Street Lighting Plan Plan E - Landscape Plan Plan F - Site Plan 8. IMPROVEMENTS. The Developer shall install and pay for the following: A. Sanitary Sewer System B. Water System C. Storm Sewer System D. Streets E. Concrete Curb and Gutter F. Street Lights G. Site Grading, Stormwater Treatment/Infiltration Basins, and Erosion Control H. Underground Utilities I. Setting of Iron Monuments J. Surveying and Staking K. Sidewalks and Trails L. Retaining Walls The improvements shall be installed in accordance with the City subdivision ordinance; City standard specifications for utility and street construction; and any other ordinances including Section 11-16-7 of the City Code concerning erosion and drainage and Section 4-1-4-2 prohibiting grading, construction activity, and the Page 287 of 899 4 237337v5 Amelia Meadows 2nd Addition use of power equipment between the hours of 10 o’clock p.m. and 7 o’clock a.m. The Developer shall submit plans and specifications which have been prepared by a competent registered professional engineer to the City for approval by the City Engineer. The Developer shall instruct its engineer to provide adequate field inspection personnel to assure an acceptable level of quality control to the extent that the Developer’s engineer will be able to certify that the construction work meets the approved City standards as a condition of City acceptance. In addition, the City may, at the City’s discretion and at the Developer’s expense, have one or more City inspectors and a soil engineer inspect the work on a full or part-time basis. The Developer, its contractors and subcontractors, shall follow all instructions received from the City’s inspectors. The Developer’s engineer shall provide for on-site project management. The Developer’s engineer is responsible for design changes and contract administration between the Developer and the Developer ’s contractor. The Developer or its engineer shall schedule a pre-construction meeting at a mutually agreeable time at the City with all parties concerned, including the City staff, to review the program for the construction work. In accordance with Minnesota Statutes 505.021, the final placement of iron monuments for all lot corners must be completed before the applicable security is released. The Developer’s surveyor shall also submit a written notice to the City certifying that the monuments have been installed following site grading, utility and street construction. 9. CONTRACTORS/SUBCONTRACTORS. City Council members, City employees, and City Planning Commission members, and corporations, partnerships, and other entities in which such individuals have greater than a 25% ownership interest or in which they are an officer or director may not act as contractors or subcontractors for the public improvements identified in Paragraph 8 above. 10. PERMITS. The Developer shall obtain or require its contractors and subcontractors to obtain all necessary permits, which may include: A. Dakota County for County Road Access and Work in County Rights-of-Way B. MnDot for State Highway Access C. MnDot for Work in Right-of-Way D. Minnesota Department of Health for Watermains E. MPCA NPDES Permit for Construction Activity F. MPCA for Sanitary Sewer and Hazardous Material Removal and Disposal Page 288 of 899 5 237337v5 Amelia Meadows 2nd Addition G. DNR for Dewatering H. City of Lakeville for Building Permits I. MCES for Sanitary Sewer Connections J. City of Lakeville for Retaining Walls 11. DEWATERING. Due to the variable nature of groundwater levels and stormwater flows, it will be the Developer’s and the Developer’s contractors and subcontractors responsibility to satisfy themselves with regard to the elevation of groundwater in the area and the level of effort needed to perform dewatering and storm flow routing operations. All dewatering shall be in accordance with all applicable county, state, and federal rules and regulations. DNR regulations regarding appropriations permits shall also be strictly followed. 12. TIME OF PERFORMANCE. The Developer shall install all required public improvements by November 30, 2026, with the exception of the final wear course of asphalt on streets. The final wear course on streets shall be installed between August 15th and October 15th the first summer after the base layer of asphalt has been in place one freeze thaw cycle. The Developer may, however, request an extension of time from the City. If an extension is granted, it shall be conditioned upon updating the security posted by the Developer to reflect cost increases and the extended completion date. Final wear course placement outside of this time frame must have the written approval of the City Engineer. 13. LICENSE. The Developer hereby grants the City, its agents, employees, officers and contractors a license to enter the plat to perform all work and inspections deemed appropriate by the City in conjunction with plat development. 14. EROSION CONTROL. Prior to initiating site grading, the erosion control plan, Plan B, shall be implemented by the Developer and inspected and approved by the City. The City may impose additional erosion control requirements if they would be beneficial. All areas disturbed by the grading operations shall be stabilized per the MPCA Stormwater Permit for Construction Activity. Seed shall be in accordance with the City’s current seeding specification which may include temporary seed to provide ground cover as rapidly as possible. All seeded areas shall be fertilized, mulched, and disc anchored as necessary for seed retention. The parties recognize that time is of the essence in controlling erosion. If the Developer does not comply with Page 289 of 899 6 237337v5 Amelia Meadows 2nd Addition the MPCA Stormwater Permit for Construction Activity or with the erosion control plan and schedule or supplementary instructions received from the City, the City may take such action as it deems appropriate to control erosion. The City will endeavor to notify the Developer in advance of any proposed action, but failure of the City to do so will not affect the Developer’s and City’s rights or obligations hereunder. If the Developer does not reimburse the City for any cost the City incurred for such work within ten (10) days, the City may draw down the letter of credit to pay any costs. No development, utility or street construction will be allowed and no building permits will be issued unless the plat is in full compliance with the approved erosion control plan. The Developer is responsible for obtaining a MPCA Construction Permit for the site as well as developing and maintaining the SWPPP throughout construction phase. The permit requires that all erosion and sediment BMPS must be clearly outlined in a site’s SWPPP. Changes made throughout construction should be documented in the SWPPP. Redundant silt fence is required along all wetlands and waterways that do not have a 50-foot established buffer. Additional erosion control measures may be required during construction as deemed necessary by City staff or the Vermillion River Watershed JPO. Any additional measures required shall be installed and maintained by the Developer. The MS4 Administration Fee has been collected on the parent parcels with Amelia Meadows final plat. 15. GRADING. The plat shall be graded in accordance with the approved grading development and erosion control plan, Plan “B”. The plan shall conform to City of Lakeville specifications. Within thirty (30) days after completion of the grading and final establishment of the ground cover or temporary stabilization approved by the City, the Developer shall provide the City with an “as constructed” grading plan certified by a registered land surveyor or engineer that all storm water treatment/infiltration basins and swales, have been constructed on public easements or land owned by the City. The “as constructed” plan shall include field verified elevations of the following: a) cross sections of storm water treatment/infiltration basins; b) location and elevations along all swales, wetlands, wetland mitigation areas if any, locations and dimensions of borrow areas/stockpiles, and installed “conservation area” posts; and c) lot corner elevations and building pads, and all other items listed in City Code Section 10-3-5.NN. The City will withhold issuance of a Certificate of Page 290 of 899 7 237337v5 Amelia Meadows 2nd Addition Occupancy until the approved certified grading plan is on file with the City and all erosion control measures are in place as determined by the City Engineer. The Developer certifies to the City that all footings placed on fill have been monitored and constructed to meet or exceed FHA/HUD 79G specifications. The soils observation and testing report, including referenced development phases and lot descriptions, shall be submitted to the Building Official for review prior to the issuance of the Certificate of Occupancy. Prior to the release of the grading and erosion control security, the “as-constructed” plan for the lot must be submitted to verify that the final as-built grades and elevations of the specific lot and all building setbacks are consistent with the approved grading plan for the development, and amendments thereto as approved by the City Engineer, and that all required property monuments are in place. If the final grading, erosion control and “as-constructed” grading plan is not timely completed, the City may enter the lot, perform the work, and draw on the letter of credit. Upon satisfactory completion of the grading, erosion control and “as-constructed” grading plan, the security, less any draw made by the City, shall be released. Amelia Meadows 2nd Addition is located within subdistrict FO-018 of Farmington stormwater district as identified in the City’s Water and Natural Resources Management Plan. Development of Amelia Meadows 2nd Addition does not include the construction of stormwater management basins. Drainage will be directed to stormwater management basins constructed with Amelia Meadows final plat to collect and treat the stormwater runoff generated from the site. The basins will outlet to the channel within the final plat area. The channel flows west to east into the City of Farmington. No building permits will be issued for the plat until all basin and channel restoration work is completed in Amelia Meadows plat. The final grading plan shall identify all fill lots in which the building footings will be placed on fill material. The grading specifications shall also indicate that all embankments meet FHA/HUD 79G specifications. The Developer shall certify to the City that all lots with footings placed on fill material are appropriately constructed. Building permits will not be issued until a soils report and an as-built certified grading plan have been submitted and approved by City staff. Page 291 of 899 8 237337v5 Amelia Meadows 2nd Addition Amelia Meadows 2nd Addition contains more than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. 16. CLEAN UP. The Developer shall clean dirt and debris from streets that has resulted from construction work by the Developer, subcontractors, their agents or assigns. Prior to any construction in the plat, the Developer shall identify in writing a responsible party and schedule for erosion control, street cleaning, and street sweeping. 17. OWNERSHIP OF IMPROVEMENTS. Upon completion of the work and construction required by this Contract and final acceptance by the City, the public improvements lying within public easements shall become City property without further notice or action. 18. CITY ENGINEERING ADMINISTRATION, CONSTRUCTION OBSERVATION. The Developer shall pay a fee for in-house engineering administration. City engineering administration will include monitoring of construction observation, consultation with Developer and its engineer on status or problems regarding the project, coordination for final inspection and acceptance, project monitoring during the warranty period, and processing of requests for reduction in security. Fees for this service shall be three percent (3%) of construction costs identified in the Summary of Security Requirements if using a letter of credit, assuming normal construction and project scheduling. The Developer shall pay for construction observation performed by the City’s in-house engineering staff or consulting engineer. Construction observation shall include part or full time inspection of proposed public utilities and street construction and will be billed on hourly rates estimated to be seven percent (7%) of the estimated construction cost. 19. STORM SEWER. Development of Amelia Meadows includes the construction of public storm sewer systems. Developer must install public storm sewer within the subdivision to collect and convey stormwater runoff generated from within the public right-of-way and lots to the public stormwater management basins constructed with the Amelia Meadows final plat. Draintile construction is required in areas of non-granular soils within Amelia Meadows 2nd Addition for the street sub-cuts and lots. Any additional draintile construction, including perimeter draintile required Page 292 of 899 9 237337v5 Amelia Meadows 2nd Addition for building footings, which is deemed necessary during construction shall be the Developer’s responsibility to install and finance. The Storm Sewer Charge has not been collected on the parent parcels and must be paid by the Developer with the final plat, calculated as follows: Storm Sewer Charge Summary Gross Area of Amelia Meadows 2nd Addition 1,714,127.00 s.f. Less Area of Outlot A (Future Development) (-) 500,705.00 s.f. Less Area of Outlot E (Future Development) Less Area of Block 8 (Single-Family) (-) 511,967.00 s.f. (-) 113,448.00 s.f. Total Storm Sewer Charge Area (Multi-Family) = 588,007.00 s.f. Storm Sewer Charge Summary Gross Area of Block 8 (Single-Family) 113,448.00 s.f Total Storm Sewer Charge Area (Single-Family) = 113,448.00 s.f. 588,007.00 s.f. x $0.198/s.f. = $116,425.39 Net Area Amelia Meadows 2nd Addition 2025 Unit Rate (Multi-Family) Storm Sewer Charge Amelia Meadows 2nd Addition (Multi-Family) 113,448.00 s.f. x $0.178/s.f. = $20,193.74 Net Area Amelia Meadows 2nd Addition 2025 Unit Rate (Single-Family) Storm Sewer Charge Amelia Meadows 2nd Addition (Single-Family) $116,425.39 + $20,193.74 = $136,619.13 Storm Sewer Charge Amelia Meadows 2nd Addition (Multi-Family) Storm Sewer Charge Amelia Meadows 2nd Addition (Single-Family) Storm Sewer Charge Amelia Meadows 2nd Addition The Storm Sewer Charge for Outlots A and E will be collected with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. 20. SANITARY SEWER. Amelia Meadows 2nd Addition is located within subdistrict FO-60100 of the Farmington Outlet sanitary sewer district as identified in the City’s Sanitary Sewer Comprehensive Plan. Page 293 of 899 10 237337v5 Amelia Meadows 2nd Addition Development of Amelia Meadows 2nd Addition includes the extension of public sanitary sewer. The Developer must construct and extend an 8-inch sanitary sewer within the subdivision. The wastewater from the development will be conveyed via trunk sanitary sewer to the MCES Farmington Interceptor and continue to the Empire Wastewater Treatment Facility. The Sanitary Sewer Availability Charge has not been collected on the parent parcel and must be paid by the Developer with the final plat, calculated as follows: 70 units x $327.00 = $22,890.00 Total Units Amelia Meadows 2nd Addition 2025 Unit Rate Sanitary Sewer Availability Charge Amelia Meadows 2nd Addition The Sanitary Sewer Availability Charge for Outlots A and E will be collected with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. 21. WATERMAIN. Development of Amelia Meadows 2nd Addition includes the extension of public watermain. 8-inch watermain will be extended within the development to provide water service to the subdivision. 8-inch watermain will be extended to the northern plat boundary at Gallifrey Way to service future development. Development of Amelia Meadows 2nd Addition includes the construction of privately owned and maintained watermain within Outlot B. 22. CONSTRUCTION ACCESS. Construction traffic access and egress for grading, utility construction and site construction shall be from Gallifrey Way. 23. PARKS, TRAILS, AND SIDEWALKS. Development of Amelia Meadows 2nd Addition includes the construction of public trails and sidewalks. The Developer must install five-foot wide concrete sidewalks, with pedestrian curb ramps, will be installed along one side of all local streets except for the Gallifrey Court cul-de-sac. The Developer must install five-foot-concrete sidewalks, with pedestrian curb ramps, along both sides of Gallifrey Way. The Park Dedication requirement has not been collected on the parent parcels and will be satisfied through a cash contribution the Developer must pay with the final plat, calculated as follows: Page 294 of 899 11 237337v5 Amelia Meadows 2nd Addition 8 units x $5,832.00 = $46,656.00 Total Units (Low-Density) Amelia Meadows 2nd Addition 2025 Unit Rate (Low-Density) Park Dedication Fee Amelia Meadows 2nd Addition (Low-Density) 62 units x $3,968.00 = $246,016.00 Total Units (Medium-Density) Amelia Meadows 2nd Addition 2025 Unit Rate (Medium-Density) Park Dedication Fee Amelia Meadows 2nd Addition (Medium-Density) $46,656.00 + $246,016.00 = $292,672.00 Park Dedication Fee Amelia Meadows 2nd Addition (Low-Density) Park Dedication Fee Amelia Meadows 2nd Addition (Medium-Density) Park Dedication Fee Amelia Meadows 2nd Addition Park dedication requirements for Outlots A and E must be satisfied with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks through a cash contribution at the rate in effect at the time of final plat approval. 24. ENVIRONMENTAL RESOURCES EXPENSES. The Developer shall pay a cash fee for one-year of the Environmental Resources Fee at the time of final plat approval, calculated as follows: 8 units x $61.52/unit = $492.16 Total Units (Single Family) Amelia Meadows 2nd Addition 2025 Rate Environmental Resources Fee Amelia Meadows 2nd Addition (Single Family) 62 units x $61.52/unit x 0.50 = $1,907.12 Total Units (Townhomes) Amelia Meadows 2nd Addition 2025 Rate Utility Factor Environmental Resources Fee Amelia Meadows 2nd Addition (Townhomes) $492.16 + $1,907.12 = $2,399.28 Environmental Resources Fee Amelia Meadows 2nd Addition (Single Family Environmental Resources Fee Amelia Meadows 2nd Addition (Townhomes) Environmental Resources Fee Amelia Meadows 2nd Addition 25. LANDSCAPING. Each townhome building must provide landscaping at the immediate perimeter of the unit. The overall landscaping for the plat must be installed as shown on the landscape plan. All landscaped areas, including common open space and public right of way, must have an inground irrigation system with an automatic controller. The Developer shall post a $37,900.00 landscaping security at the time of final plat approval to ensure that the landscaping is installed in accordance with the approved plan. Page 295 of 899 12 237337v5 Amelia Meadows 2nd Addition Unless a single-family lot already has two (2) trees on it, the Developer or lot purchaser shall plant sufficient trees so that there are at least two (2) trees on every lot in the plat, one of which must be planted in the front yard. Trees that are chosen by the Developer or property owner cannot cause a public nuisance, such as cotton producing trees, or trees that may become a public hazard due to insect infestation or weak bark. The minimum deciduous tree size shall be two and one-half (2½) inches caliper, balled and burlapped. Evergreen trees must be at least eight feet (8’) tall. The trees may not be planted in the right-of-way. The Developer or lot purchaser shall sod the front yard, boulevard, and side yards to the rear of the structure on every lot. Weather permitting, the trees, sod, and seed shall be planted within sixty (60) days after a home has received a certificate of occupancy. Before a building permit is issued, a cash escrow of $1,000.00 per lot shall be furnished the City to guarantee compliance with the landscaping requirements. If the landscaping is not completed in a timely manner, the City may enter the lot, perform the work, and apply the cash escrow toward the cost. Upon satisfactory completion of the landscaping the escrow funds, without interest, less any draw made by the City, shall be returned to the person who deposited the funds with the City. All trees shall be warranted to be alive, of good quality, and disease free for twelve (12) months after planting. Any replacements shall be warranted for twelve (12) months from the time of planting. The Developer or property owner is responsible for contacting the City when all the landscaping has been installed to set up an inspection. Fifty percent (50%) of the security will be released when all the landscaping has been installed and inspected by City staff and the remaining fifty percent (50%) will be released one year after the landscaping inspection and any warranty work has been completed. The Developer or property owner is responsible for contacting the City when all the landscaping has been installed to set up an inspection. 26. WETLANDS. The wetland delineation for the site was approved on February 27, 2024. The wetland delineation was completed by MNR. The delineation identified two small wetlands on the site adjacent to the Vermillion River Watershed Water Quality Corridor. As part to of the 1st Addition the Page 296 of 899 13 237337v5 Amelia Meadows 2nd Addition previously farmed and eroded channel will be realigned and restored. No additional impacts are proposed to wetlands with the 2nd Addition. All wetlands, channel and buffers were placed in a city owned outlot. The Developer is responsible for the establishment of the channel with native vegetation and will be required to manage the site for a minimum of 5 years or until it is fully established. The Developer must install Natural Area signs will be installed along the channel and buffer areas in the plat. Final locations for 20 Natural Area signs will be approved by the City prior to installation. 27. SPECIAL PROVISIONS. The following special provisions shall apply to plat development: A. Implementation of the recommendations listed in the September 10, 2025, Planning Report, and September 2, 2025, Engineering Report. B. The Developer shall submit Homeowners Association (“HOA”) documents establishing a homeowners association for the exterior maintenance of the attached townhome units, maintenance of the private roads, private utilities, irrigation system, and maintenance of the following common area lots: Outlots B, C, and D, subject to review and approval of City staff and the City Attorney. The Developer shall also provide documentation confirming that the HOA has been established with the Minnesota Secretary of State’s office, that the HOA Declarations have been recorded with Hennepin County and that a deed conveying Outlots B, C, and D has been recorded with the County prior to release of any building permits. C. Prior to City Council approval of the final plat, the Developer shall furnish a boundary survey of the proposed property to be platted with all property corner monumentation in place and marked with lath and a flag. Any encroachments on or adjacent to the property shall be noted on the survey. The Developer shall post a $7,500.00 security for the final placement of interior subdivision iron monuments at property corners. The security was calculated as follows: seventy-five (75) lots/outlots at $100.00 per lot/outlot. The security will be held by the City until the Developer's land surveyor certifies that all irons have been set following site grading and utility and street Page 297 of 899 14 237337v5 Amelia Meadows 2nd Addition construction. In addition, the certificate of survey must also include a certification that all irons for a specific lot have either been found or set prior to the issuance of a building permit for that lot. D. The Developer shall construct a temporary Cul-de-Sac at the north end of Gallifrey Way and enter into a temporary public roadway, drainage and utility easement with the City in a recordable form approved by the City for recording with the final plat. The Developer shall install a “Future Street Extension” sign and barricades at the north end of Gallifrey Way. The Developer shall provide a $5,000.00 security for the future removal and restoration. E. The Developer shall construct a temporary Cul-de-Sac at the west end of Gerber Pass and enter into a temporary public roadway, drainage and utility easement with the City in a recordable form approved by the City for recording with the final plat. The Developer shall install a “Future Street Extension” sign and barricades at the west end of Gerber Pass. The Developer shall provide a $2,500.00 security for the future removal and restoration. F. The Developer shall be responsible for the cost of street light installation consistent with a street lighting plan approved by the City. Before the City signs the final plat, the Developer shall post a security for street light installation consistent with the approved plan. The estimated amount of this security is $10,800.00 and consists of nine (9) post-top streetlights at $1,200.00. G. The Developer must submit the final plat and construction drawings in an electronic format. The electronic format shall be in .pdf and either .dwg/.dxf or .shx format. All construction record drawings (e.g., grading, utilities, streets) shall be in electronic format in accordance with standard City specifications. H. A cash fee for the preparation of addressing, property data, and City base map updating shall be paid with the final plat and is calculated as follows: 75 lots/outlots x $90.00/unit = $6,750.00 Lots/Outlots Amelia Meadows 2nd Addition 2025 Rate Property Data & Asset/Infrastructure Mgmt. Fee Amelia Meadows 2nd Addition I. The following lots are prohibited from having driveway access to Gallifrey Way: • Lots 1 and 8, Block 1. Page 298 of 899 15 237337v5 Amelia Meadows 2nd Addition 28. TRAFFIC CONTROL SIGNS AND STREETLIGHT OPERATION COSTS. A cash fee of $2,875.00 for traffic control signs shall be paid with the final plat. If street signs are installed during frost conditions, the Developer shall pay an additional $150.00 for each traffic control sign location. If multiple mobilizations are needed, the Developer shall pay an additional $300.00 for each mobilization. A cash fee for one-year of streetlight operating expenses shall be paid with the final plat and is calculated as follows: 70 units x $40.48/unit = $2,833.60 Total Units Amelia Meadows 2nd Addition 2025 Rate Streetlight Operating Fee Amelia Meadows 2nd Addition 29. SUMMARY OF SECURITY REQUIREMENTS. To guarantee compliance with the terms of this Contract, payment of real estate taxes including interest and penalties, payment of special assessments, payment of the costs of all public improvements, and construction of all public improvements, the Developer shall furnish the City with a cash escrow, or letter of credit, in the form attached hereto, from a bank ("security") for $2,380,198.16. The amount of the security was calculated as follows: CONSTRUCTION COSTS: A. Sanitary Sewer $416,783.34 B. Watermain $359,303.00 C. Storm Sewer $466,129.40 D. Streets $818,826.00 E. Erosion Control and Restoration $13,844.50 CONSTRUCTION SUB-TOTAL $2,074,886.24 OTHER COSTS: A. Developer’s Design (3.0%) $62,246.59 B. Developer’s Construction Survey (2.5%) $51,872.16 C. City’s Legal Expense (0.5%) $10,374.43 D. City Construction Observation (5.0%) $103,744.31 E. Developer’s Record Drawing (0.5%) $10,374.43 F. Gallifrey Way and Gerber Pass Temporary Cul-De-Sac Removal $7,500.00 G. Natural Area Signs $3,000.00 H. Streetlights $10,800.00 I. Landscaping $37,900.00 Page 299 of 899 16 237337v5 Amelia Meadows 2nd Addition J. Lot Corners/Iron Monuments $7,500.00 OTHER COSTS SUB-TOTAL $305,311.92 TOTAL SECURITIES: $2,380,198.16 This breakdown is for historical reference; it is not a restriction on the use of the security. The bank shall be subject to the approval of the City Administrator. The City may draw down the security, on five (5) business days written notice to the Developer, for any violation of the terms of this Contract or without notice if the security is allowed to lapse prior to the end of the required term. If the required public improvements are not completed at least thirty (30) days prior to the expiration of the security, the City may also draw it down without notice. If the security is drawn down, the proceeds shall be used to cure the default. Upon receipt of proof satisfactory to the City that work has been completed and financial obligations to the City have been satisfied, with City approval the security may be reduced from time to time by ninety percent (90%) of the financial obligations that have been satisfied. Ten percent (10%) of the amounts certified by the Developer's engineer shall be retained as security until all improvements have been completed, all financial obligations to the City satisfied, the required "as constructed" plans have been received by the City, a warranty security is provided, and the public improvements are accepted by the City Council. The City’s standard specifications for utility and street construction outline procedures for security reductions. The Developer shall post a security to ensure the final placement of iron monuments at property corners with the final plat. The security is $100.00 per lot and outlot for a total of $7,500.00. The City shall hold this security until the Developer’s Land Surveyor certifies that all irons have been placed following site grading, street and utility construction. 30. SUMMARY OF CASH REQUIREMENTS. The following is a summary of the cash requirements under this Contract which must be furnished to the City prior to the City Council signing the final plat: A. Park Dedication Fee $292,672.00 B. Sanitary Sewer Availability Charge $22,890.00 C. Storm Sewer Charge $136,619.13 D. Traffic Control Signs $2,875.00 Page 300 of 899 17 237337v5 Amelia Meadows 2nd Addition E. Streetlight Operating Fee $2,833.60 F. Environmental Resources Expenses $2,399.28 G. Property Data and Asset/Infrastructure Management Fee $6,750.00 H. City Engineering Administration (3% for letters of credit) $62,246.59 TOTAL CASH REQUIREMENTS $529,285.60 31. RESPONSIBILITY FOR COSTS. A. Except as otherwise specified herein, the Developer shall pay all costs incurred by it or the City in conjunction with the development of the plat, including but not limited to Soil and Water Conservation District charges, legal, planning, engineering and construction observation inspection expenses incurred in connection with approval and acceptance of the plat, the preparation of this Contract, review of construction plans and documents, and all costs and expenses incurred by the City in monitoring and inspecting development of the plat. B. The Developer shall hold the City and its officers, employees, and agents harmless from claims made by itself and third parties for damages sustained or costs incurred resulting from plat approval and development. The Developer shall indemnify the City and its officers, employees, and agents for all costs, damages, or expenses which the City may pay or incur in consequence of such claims, including attorneys' fees. C. The Developer shall reimburse the City for costs incurred in the enforcement of this Contract, including engineering and attorneys' fees. D. The Developer shall pay, or cause to be paid when due, and in any event before any penalty is attached, all special assessments referred to in this Contract. This is a personal obligation of the Developer and shall continue in full force and effect even if the Developer sells one or more lots, the entire plat, or any part of it. E. The Developer shall pay in full all bills submitted to it by the City for obligations incurred under this Contract within thirty (30) days after receipt. If the bills are not paid on time, the City may halt plat development and construction until the bills are paid in full. Bills not paid within thirty (30) days shall accrue interest at the rate of eighteen percent (18%) per year. Additionally, the Developer Page 301 of 899 18 237337v5 Amelia Meadows 2nd Addition shall pay in full all bills submitted to it by the City prior to any reductions in the security for the development. F. In addition to the charges and special assessments referred to herein, other charges and special assessments may be imposed such as but not limited to City or MCES sewer availability charges ("SAC"), City water connection charges, City sewer connection charges, and building permit fees. 32. DEVELOPER’S DEFAULT. In the event of default by the Developer as to any of the work to be performed by it hereunder, the City may, at its option, perform the work and the Developer shall promptly reimburse the City for any expense incurred by the City, provided the Developer, except in an emergency as determined by the City, is first given notice of the work in default, not less than forty-eight (48) hours in advance. This Contract is a license for the City to act, and it shall not be necessary for the City to seek a Court order for permission to enter the land. When the City does any such work, the City may, in addition to its other remedies, assess the cost in whole or in part. 33. FORCE MAJEURE. If Developer is delayed at any time in progress of the plat by acts of God, casualty, insurrection, strikes, war, terrorism, lockouts, pandemic, governmental order (including health orders), labor disputes, adverse weather conditions which could not reasonably be anticipated, or any causes, acts, or occurrences beyond Developer’s control (financial inability excluded) (collectively, “Force Majeure Items”), then the commencement date and completion dates (without adjustment to the Development Contract sums) shall be extended for such reasonable time as the Force Majeure Items continue. 34. MISCELLANEOUS. A. The Developer represents to the City that the plat complies with all city, county, metropolitan, state, and federal laws and regulations, including but not limited to: subdivision ordinances, zoning ordinances, and environmental regulations. If the City determines that the plat does not comply, the City may, at its option, refuse to allow construction or development work in the plat until the Developer does comply. Upon the City's demand, the Developer shall cease work until there is compliance. Page 302 of 899 19 237337v5 Amelia Meadows 2nd Addition B. Third parties shall have no recourse against the City under this Contract. C. Breach of the terms of this Contract by the Developer shall be grounds for denial of building permits, including lots sold to third parties. D. If any portion, section, subsection, sentence, clause, paragraph, or phrase of this Contract is for any reason held invalid, such decision shall not affect the validity of the remaining portion of this Contract. E. Grading, curbing, and one lift of asphalt shall be installed on all public and private streets prior to issuance of a permanent or temporary certificate of occupancy. F. If building permits are issued prior to the acceptance of public improvements, the Developer assumes all liability and costs resulting in delays in completion of public improvements and damage to public improvements caused by the City, Developer, its contractors, subcontractors, material men, employees, agents, or third parties. No sewer and water connections or inspections may be conducted and no one may occupy a building for which a building permit is issued on either a temporary or permanent basis until the streets needed for access have been paved with a bituminous surface and the utilities are accepted by the City Engineer. G. The action or inaction of the City shall not constitute a waiver or amendment to the provisions of this Contract. To be binding, amendments or waivers shall be in writing, signed by the parties and approved by written resolution of the City Council. The City's failure to promptly take legal action to enforce this Contract shall not be a waiver or release. H. This Contract shall run with the land and may be recorded against the title to the property. In the event this Contract is recorded, upon request by Developer, the City covenants to provide a recordable Certificate of Completion within a reasonable period of time following the request, upon the completion of the work and responsibilities required herein, payment of all costs and fees required and compliance with all terms of the Contract. A release of this Contract may be provided in the same manner and subject to the same conditions as a Certificate of Completion provided there are no outstanding or ongoing obligations of Developer under the terms of this Contract. The Page 303 of 899 20 237337v5 Amelia Meadows 2nd Addition Developer covenants with the City, its successors and assigns, that the Developer is well seized in fee title of the property being final platted and/or has obtained consents to this Contract, in the form attached hereto, from all parties who have an interest in the property; that there are no unrecorded interests in the property being final platted; and that the Developer will indemnify and hold the City harmless for any breach of the foregoing covenants. I. Insurance. Developer and Contractor shall provide a copy of the Development Contract to their insurance professional for verification that the certificate of insurance is in compliance with the requirements of the Development Contract. Prior to execution of the final plat, Developer and its general contractor shall furnish to the City a certificate of insurance showing proof of the required insurance required under this Paragraph. Developer and its general contractor shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, such insurance as shall protect Developer and its general contractor and the City for work covered by the Contract including workers’ compensation claims and property damage, bodily and personal injury which may arise from operations under this Contract, whether such operations are by Developer and its general contractor or anyone directly or indirectly employed by either of them. The minimum amounts of insurance shall be as follows: Commercial General Liability (or in combination with an umbrella policy) $2,000,000 Each Occurrence $2,000,000 Products/Completed Operations Aggregate $2,000,000 Annual Aggregate The following coverages shall be included: Premises and Operations Bodily Injury and Property Damage Personal and Advertising Injury Blanket Contractual Liability Products and Completed Operations Liability Automobile Liability $2,000,000 Combined Single Limit – Bodily Injury & Property Damage Including Owned, Hired & Non-Owned Automobiles Workers Compensation Page 304 of 899 21 237337v5 Amelia Meadows 2nd Addition Workers’ Compensation insurance in accordance with the statutory requirements of the State of Minnesota, including Employer’s Liability with minimum limits are as follows: • $500,000 – Bodily Injury by Disease per employee • $500,000 – Bodily Injury by Disease aggregate • $500,000 – Bodily Injury by Accident The Developer’s and general contractor’s insurance must be “Primary and Non-Contributory”. All insurance policies (or riders) required by this Contract shall be (i) taken out by and maintained with responsible insurance companies organized under the laws of one of the states of the United States and qualified to do business in the State of Minnesota, (ii) shall name the City, its employees and agents as additional insureds (CGL and umbrella only) by endorsement which shall be filed with the City and (iii) shall identify the name of the plat. A copy of the endorsement must be submitted with the certificate of insurance. Developer’s and general contractor’s policies and Certificate of Insurance shall contain a provision that coverage afforded under the policies shall not be cancelled without at least thirty (30) days’ advanced written notice to the City, or ten (10) days’ notice for non-payment of premium. An Umbrella or Excess Liability insurance policy may be used to supplement Developer’s or general contractor’s policy limits on a follow-form basis to satisfy the full policy limits required by this Contract. J. Indemnification. To the fullest extent permitted by law, Developer agrees to defend, indemnify and hold harmless the City, and its employees, officials, and agents from and against all claims, actions, damages, losses and expenses, including reasonable attorney fees, arising out of Developer’s negligence or its performance or failure to perform its obligations under this Contract. Developer’s indemnification obligation shall apply to Developer’s general contractor, subcontractor(s), or anyone directly or indirectly employed or hired by Developer, or anyone for whose acts Developer may be liable. Developer agrees this indemnity obligation shall survive the completion or termination of this Contract. Page 305 of 899 22 237337v5 Amelia Meadows 2nd Addition K. Each right, power or remedy herein conferred upon the City is cumulative and in addition to every other right, power or remedy, express or implied, now or hereafter arising, available to City, at law or in equity, or under any other agreement, and each and every right, power and remedy herein set forth or otherwise so existing may be exercised from time to time as often and in such order as may be deemed expedient by the City and shall not be a waiver of the right to exercise at any time thereafter any other right, power or remedy. L. The Developer may not assign this Contract without the written permission of the City Council. The Developer's obligation hereunder shall continue in full force and effect even if the Developer sells one or more lots, the entire plat, or any part of it, until the City’s issuance of a Certificate of Completion and Release. M. Retaining walls that require a building permit shall be constructed in accordance with plans and specifications prepared by a structural or geotechnical engineer licensed by the State of Minnesota. Following construction, a certification signed by the design engineer shall be filed with the Building Official evidencing that the retaining wall was constructed in accordance with the approved plans and specifications. All retaining walls identified on the development plans and by special conditions referred to in this Contract shall be constructed before any other building permit is issued for a lot on which a retaining wall is required to be built. N. Should the Developer convey any lot or lots in the Development to a third party, the City and the owner of that lot or those lots may amend this Development Contract or other city approvals or agreements for development or use of those lots without the approval or consent of the Developer or other lot owners in the Development. Private agreements between the owners of lots within the Development for shared service or access and related matters necessary for the efficient use of the Development shall be the responsibility of the lot owners and shall not bind or restrict City authority to approve applications from any lot owner in the Development. 35. NOTICES. Required notices to the Developer shall be in writing, and shall be either hand delivered to the Developer, its employees or agents, or mailed to the Developer by certified mail at the Page 306 of 899 23 237337v5 Amelia Meadows 2nd Addition following address: 2780 Snelling Avenue N Suite 101 Roseville, MN 55113 . Notices to the City shall be in writing and shall be either hand delivered to the City Administrator, or mailed to the City by certified mail in care of the City Administrator at the following address: Lakeville City Hall, 20195 Holyoke Avenue, Lakeville, Minnesota 55044. [The remainder of this page has been intentionally left blank. Signature pages follow.] Page 307 of 899 24 237337v5 Amelia Meadows 2nd Addition CITY OF LAKEVILLE BY: ___________________________________________ Luke M. Hellier, Mayor (SEAL) AND __________________________________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) )ss. COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this ________ day of ______________, 2025, by Luke M. Hellier and by Ann Orlofsky, the Mayor and City Clerk of the City of Lakeville, a Minnesota municipal corporation, on behalf of the corporation and pursuant to the authority granted by its City Council. ______________________________________________ NOTARY PUBLIC Page 308 of 899 Page 309 of 899 Page 310 of 899 27 237337v5 Amelia Meadows 2nd Addition EXHIBIT “A” TO DEVELOPMENT CONTRACT Legal Description of Property Being Final Platted as AMELIA MEADOWS 2ND ADDITION Outlot A, AMELIA MEADOWS, according to the recorded plat thereof, Dakota County, Minnesota [Platted as Amelia Meadows 2nd Addition, Dakota County, Minnesota.] . Page 311 of 899 1 City of Lakeville Community Development Memorandum To: Tina Goodroad, Community Development Director From: Kris Jenson, Planning Manager Date: September 10, 2025 Subject: Amelia Meadows 2nd Addition Final Plat Application Action Deadline: October 17, 2025 INTRODUCTION Lennar has submitted an application and plans for the final plat of Amelia Meadows 2nd Addition, which includes eight single family lots and 62 attached townhome lots located east of Cedar Avenue (CSAH 23) and north of 200th Street (CR 64). This is the second phase of the preliminary plat of 88 single family lots and 144 attached townhomes lots that was approved by the City Council on November 18, 2024. The Amelia Meadows final plat of 49 single family lots was approved by the City Council on June 2, 2025. The lot, block and street design of the Amelia Meadows 2nd Addition final plat is consistent with the approved preliminary plat. The final plat plans have been reviewed by Engineering and Parks and Recreation staff. EXHIBITS A. Location Map B. Final Plat C. Preliminary Plat D. September 11, 2025 Plat Commission letter PLANNING A NALYSIS Existing Conditions. The Amelia Meadows 2nd Addition final plat area consists of five parcels. Previously the site was used for agriculture and several homesites. A grading permit has been issued for the site (Exhibit A). Page 312 of 899 2 Zoning. The zoning of the overall Amelia Meadows 2nd Addition development is RM-3, Medium Density Residential District and RST-2, Single and Two Family Residential District. Attached townhomes and single family homes, respectively, are permitted uses within those districts. SINGLE FAMILY LOT REQUIREMENTS Lot Area. Single family lots within the RST-2 District are required to provide a minimum lot area of 8,400 square feet for interior lots and 10,200 square feet for corner lots. The area of the eight lots in the final plat meet the minimum square footage required. Lot Width. The minimum lot width for single-family lots within the RST-2 District is 70 feet for interior lots and 85 feet for corner lots. All lots meet the minimum lot width requirement. Setbacks. Setback requirements for single family lots in the RST-2 District is outlined below: Front Side (Interior) Side (Corner) Side (Buffer) Rear Rear (Buffer) 20 feet house 25 feet garage 7 feet 20 feet 30 feet 30 feet 50 feet The proposed building pads meet the minimum setback requirements for interior and corner lots. ATTACHED TOWNHOME DEVELOPMENT STANDARDS Lot Requirements. The following minimum requirements for attached townhome building setbacks in the RM-3 District pertain to the Amelia Meadows 2nd Addition final plat: Base Lot Between Buildings (Attached Units) Front Yard (to ROW) Front Yard (to private drive) RM-3 10 feet 14 feet 10 feet (front) 25 feet (garage) 30 feet The proposed unit lots shown on the Autumn Meadows 2nd Addition final plat have sufficient area to accommodate attached townhome units. The RM-3 District requires at least 3,800 square feet per unit. The Autumn Meadows 2nd Addition final plat has an average of just under 7,000 square feet per unit for the attached townhomes area, which exceeds the minimum lot area per unit requirements of the RM-3 District. Exterior Materials. Each unit must meet the requirements of Section 11-60-21.B.3, which requires that a minimum of 25% of the area of each elevation of the unit must have an exterior finish of brick, stucco, and/or natural or artificial stone. Except for brick, stucco, and/or natural or artificial stone, no single elevation may have more than 75% of one type of finish or have more than 60% of all elevations of one type of finish. The City has deemed the use of cement fiberboard material as Page 313 of 899 3 satisfying the minimum masonry material requirement and is therefore also allowed to exceed the maximum area limit for non-masonry materials. Floor Area. The developer must submit dimensioned floor plans for the detached townhome units to verify compliance with the minimum requirements for above grade floor area established by Section 11-17-13.D of the Zoning Ordinance. Garage Area. The RM-3 District requires that a minimum of one (1) of the off-street parking stall per dwelling unit required by the Zoning Ordinance be provided within an enclosed garage attached to the principal building. Homeowner’s Association. A homeowner’s association is required to be established for ownership and maintenance of the 62 attached townhome lots and Outlots B, C, and D. Prior to building permits being issued for the townhomes, the Developer must submit the HOA documents for review by the City Attorney, as well as provide proof that the HOA documents have been recorded and that all common areas have been deeded to the HOA for ownership. Landscaping. Each townhome building must provide landscaping at the immediate perimeter of the unit. The overall landscaping for the site must be installed as shown on the landscape plan dated September 2, 2025. All landscaped areas, including common open space and public right of way, must have an inground irrigation system with an automatic controller. A security of $37,900 is required to guarantee installation of the landscaping within the townhome common area. Development Density. The Amelia Meadows 2nd Addition final plat includes a total of 70 dwelling units on 39.35 acres, for a gross density of 1.79 units per acre. The area of the eight single family home lots and adjacent public right-of-way is 3.93 acres, which is a net density of 2.04 units per acre. The area of the 62 attached townhome lots is 9.89 acres, which is a net density of 6.27 units per acre. Phasing. This is the second of three planned phases of the Amelia Meadows preliminary plat. The first phase included 49 single family lots. After approval of the Amelia Meadows 2nd Addition final plat, there will be 82 attached townhome lots and 31 single family lots to be platted. Outlots. There are five outlots proposed with the Amelia Meadows 2nd Addition final plat. Outlot A is 11.49 acres in area and will be retained by the Developer for future development. Outlot B is 1.53 acres in area and will be deeded to the HOA for common open space and private drives for townhome access. Outlot C is 1.30 acres in area and will be deeded to the HOA for common open space. Outlot D is 1.91 acres in area and will be deeded to the HOA for common open space. Outlot E is 11.75 acres in area and will be retained by the Developer for future development. Access. Amelia Meadows 2nd Addition will have access to 200th Street via Gallifrey Way. Page 314 of 899 4 Streets & Right-of-Way. Amelia Meadows 2nd Addition is adjacent to and will include the construction of the following streets: Gallifrey Way is identified as a minor collector street in the City’s Transportation Plan and will be extended north from it’s current terminus to provide full access to 200th Street. Gallifrey Way will be a 38-foot-wide street within an 80-foot-wide right-of-way and include five-foot-wide sidewalks on both sides of the street. Barricades and “Future street extension” signs must be placed at the north end of the street. The Developer shall construct a temporary turnaround at the north end of the street, provide a temporary public roadway, drainage, and utility easement for the turnaround, and provide a $5,000 security for the future removal and restoration of the area. Refer to the September 2, 2025 Engineering report for additional information. Lots 1 and 8, Block 1 are prohibited from having driveway access to Gallifrey Way. Gafford Drive will be a local residential 32-foot-wide street within a 60-foot right of way with a five (5) foot wide sidewalk on one side of the street. “Future Street Extension” signs and barricades must be placed at the Gafford Drive street stub east of Gallifrey Way. Gerber Pass will be a local residential 32-foot-wide street within a 60-foot right of way with a five (5) foot wide sidewalk on one side of the street. A temporary cul-de-sac is required at the west terminus of Gerber Pass. The Developer shall install “Future Street Extension” signs and barricades at the west end of the street, as well as provide a temporary public roadway, drainage, and utility easement for the temporary turaound as well as provide a $2,500 security for the future removal of the cul-de-sac. Gallifrey Court will be a local residential 32-foot-wide street within a 60-foot wide right-of-way that ends in a permanent cul-de-sac. Private Drives. There will be two private drives within Outlot B to provide access to 18 attached units. The private drives must be a minimum of 24 feet in width and must be posted as no parking zones on both sides of the driveway. Dakota County Plat Commission. The Amelia Meadows 2nd Addition final was reviewed at the Plat Commission’s September 10, 2025 meeting, where the Amelia Meadows 2nd Addition final plat was recommended for approval. Park Dedication. The City’s Parks Trails and Open Space Plan does not identify a future neighborhood park within the Amelia Meadows 2nd Addition plat boundary. Park dedication will be satisfied through a cash contribution of $292,672.00. See the September 2, 2025 engineering report for more details. Tree Preservation. A tree preservation plan was approved with the preliminary plat. It indicated 196 trees on site, all of which were proposed to be removed with the development. Grading activity has been ongoing on site and tree removal has been completed. Page 315 of 899 5 Wetlands. A wetland delineation was completed for the site on February 27, 2024. There are two small wetlands adjacent to the water quality corridor, which will be realigned and restored with the development of Amelia Meadows 2nd Addition. The wetland replacement plan was approved on October 28, 2024. Grading, Drainage and Erosion Control. The final plat includes grading, drainage and erosion control plans. Grading, drainage and erosion control is discussed in more detail in the September 2, 2025 engineering report. RECOMMENDATION The Amelia Meadows 2nd Addition final plat is consistent with the approved preliminary plat and complies with the requirements of the Zoning and Subdivision Ordinances. Community Development Department staff recommends approval of the Amelia Meadows 2nd Addition final plat subject to the following conditions: 1. The recommendations listed in the September 2, 2025 engineering report. 2. A five-foot-wide concrete sidewalk shall be constructed along one side of Gafford Drive and Gerber Pass and both sides of Gallifrey Way at the developer’s expense as shown on the approved final plat plans. 3. A “Future Street Extension” sign and barricades must be placed at the west end of Gerber Pass. The Developer must grant a temporary turnaround easement over the temporary cul de sac location and provide a $2,500 security for its future removal and restoration. 4. A “Future Street Extension” sign and barricades must be placed at the north end of Gallifrey Way. The Developer must grant a temporary turnaround easement over the temporary cul de sac location and provide a $5,000 security for its future removal and restoration. 5. Lots 1 and 8, Block 1 are prohibited from having driveway access to Gallifrey Way. 6. “Future Street Extension” signs and barricades must be placed at the Gafford Drive street stub east of Gallifrey Way. 7. The developer shall pay $292,672.00 in park dedication fees with the final plat. 8. The approved landscape plan is dated September 2, 2025, and landscaping on site must be installed per the approved plan. Prior to a landscape inspection, an as-built landscape plan must be submitted to the City. A security of $37,900 is required to be submitted with the final plat to guarantee installation of the landscaping. 9. Prior to building permits being issued for the townhomes, the Developer must submit the HOA documents for review by the City Attorney, as well as provide proof that the HOA documents have been recorded and that all common areas have been deeded to the HOA for ownership. Page 316 of 899 Dakota County, Maxar± 200TH ST (CR 64)CEDAR AVE (CSAH 23)202ND ST City of FarmingtonG ALLI FREY WAY City of Lakeville Location Map Amelia Meadows 2nd Addition Final Plat EXHIBIT A Final Plat Area Page 317 of 899 Overall Boundary12345678910111214151617181920212223242526123456123456781234123456123412345678234567122345678GAFFORD DRGERBER PASSGALLIFREY CTG A L L I F R E Y W A Y Outlot: 1Outlot: 5OUTLOT AOUTLOT C O U T L O T DOUTLOT EINSET A(SEE SHEET 3 OF 3SHEETS)ΔΔΔ ΔΔΔ Δ Curve TableCurve #C1C2C3C4Length (FT)127.54158.7850.5575.39Radius (FT)245.00305.00260.00340.00Delta29° 49' 37"29° 49' 37"11° 08' 25"12° 42' 15"Chord BearingS44° 36' 39.18"ES44° 36' 39.18"EN05° 28' 16.07"EN06° 15' 10.76"EChord Length (FT)126.11156.9950.4775.23OUTLOT B1318Δ0SCALE IN FEET100 5050 100200SHEET 2 OF 3 SHEETSSRRGNNE ENIGEDESIENNSATHRE-BERGQUIST, INC.SUSSYRS OER EVRPLANORTHThe basis for the bearing system is the north line ofOutlot A, AMELIA MEADOWS and is assumed tobear North 89 degrees 54 minutes 03 seconds EastDenotes a 1/2 inch by 14 inch iron pipe monument setand marked by License No. 62269.Denotes a 1/2 inch pipe monument found and markedby License No. 62269.Denotes Restricted Access to Dakota County per theDakota County Contiguous Plat OrdinanceAMELIA MEADOWS 2ND ADDITIONOFFICIAL PLATEXHIBIT BPage 318 of 899 Nothing1NothingROWNothing2Outlot: 618234567115201041917931816252261524114823137221262134561287635122431423561234134521678OUTLOT B812234567Δ Δ ΔΔΔΔΔΔG A L L I F R E Y W A Y GAFFORD DRGALLIFREYGERBER PASSΔΔΔ ΔΔΔ ΔΔΔΔ ΔΔΔΔΔ Δ Δ ΔΔΔΔΔ ΔΔΔΔ ΔΔΔΔ Δ Δ Δ Δ Δ4GA F F O R D D R Δ ΔΔΔΔΔΔΔΔ CT0SCALE IN FEET50 2525 50100Denotes a 1/2 inch by 14 inch iron pipe monument setand marked by License No. 62269.Denotes a 1/2 inch pipe monument found and markedby License No. 62269, unless shown otherwise.NOT TO SCALE10 55Being 5 feet in width and adjoining side lot lines and being 10 feet inwidth and adjoining public ways, unless otherwise indicated on this plat.10 DRAINAGE AND UTILITY EASEMENTS ARE SHOWN THUS:INSET ASHEET 3 OF 3 SHEETSSRRGNNE ENIGEDESIENNSATHRE-BERGQUIST, INC.SUSSYRS OER EVRPLANORTH AMELIA MEADOWS 2ND ADDITIONOFFICIAL PLATFROM SHEET 2 OF 3 SHEETSThe basis for the bearing system is the north line ofOutlot A, AMELIA MEADOWS and is assumed tobear North 89 degrees 54 minutes 03 seconds East(See Sheet 2 of 3 Sheets)Page 319 of 899 Dakota County Surveyor’s Office Western Service Center  14955 Galaxie Avenue  Apple Valley, MN 55124 952.891 -7087  Fax 952.891 -7127  www.co.dakota.mn.us September 11, 2025 City of Lakeville 20195 Holyoke Ave. Lakeville, MN 55044 Re: AMELIA MEADOWS 2nd ADDITION The Dakota County Plat Commission met on September 10, 2025, to consider the preliminary plat of the above referenced plat. The plat is adjacent to CSAH 23 (Cedar Ave.) and is therefore subject to the Dakota County Contiguous Plat Ordinance. This is a replat of Outlot A, AMELIA MEADOWS for residential development. Restricted access is shown along CSAH 23. There were no further comments. The Plat Commission has approved the preliminary and final plat and will recommend approval to the County Board of Commissioners meeting on October 7, 2025. Traffic volumes on CSAH 23 are 21,800 ADT and are anticipated to be 39,000 ADT by the year 2040. These traffic volumes indicate that current Minnesota noise standards for residential units could be exceeded for the proposed plat. Residential developments along County highways commonly result in noise complaints. In order for noise levels from the highway to meet acceptable levels for adjacent residential units, substantial building setbacks, buffer areas, and other noise mitigation elements should be incorporated into this development. No work shall commence in the County right of way until a permit is obtained from the County Transportation Department and no permit will be issued until the plat has been filed with the County Recorder’s Office. The Plat Commission does not review or approve the actual engineering design of proposed accesses or other improvements to be made in the right of way. Nothing herein is intended to restrict or limit Dakota County’s rights with regards to Dakota County rights of way or property. The Plat Commission highly recommends early contact with the Transportation Department to discuss the permitting process which reviews the design and may require construction of highway improvements, including, but not limited to, turn lanes, drainage features, limitations on intersecting street widths, medians, etc. Please contact TJ Bentley regarding permitting questions at (952) 891-7115 or Todd Tollefson regarding Plat Commission or Plat Ordinance questions at (952) 891-7070. Sincerely, Todd B. Tollefson Secretary, Plat Commission c: Charlie Wiemerslage, Sathre EXHIBIT D Page 321 of 899 City of Lakeville Public Works – Engineering Division Memorandum To: Kris Jenson, Planning Manager From: Jon Nelson, Assistant City Engineer McKenzie L. Cafferty, Environmental Resources Manager Joe Masiarchin, Parks and Recreation Director Copy: Zach Johnson, City Engineer Tina Goodroad, Community Development Director Julie Stahl, Finance Director Dave Mathews, Building Official Date: September 2, 2025 Subject: Amelia Meadows 2nd Addition • Final Plat Review • Grading and Erosion Control Plan Review • Utility Plan Review • Tree Preservation Review BBAACCKKGGRROOUUNNDD Lennar has submitted a final plat named Amelia Meadows 2nd Addition. This is the second phase of the Cedar Hills North preliminary plat approved by the City Council on November 18, 2024. The proposed subdivision is located east of and adjacent to Cedar Avenue (CSAH 23) and north of and adjacent to 200th Street (CR 64). The parent parcels consist of Outlot A, Amelia Meadows, zoned RST-2 (Single and Two-Family Residential). The final plat consists of eight (8) single-family lots and sixty-two (62) multi-family lots within eight (8) blocks, and five (5) outlots on 39.35 acres. The outlots created with the final plat shall have the following use: Outlot A: Future development; to be retained by developer (11.49 acres) Outlot B: Common Lot; to be deeded to HOA (1.53 acres) Outlot C: Common Lot; to be deeded to HOA (1.30 acres) Outlot D: Common Lot; to be deeded to HOA (1.91 acres) Outlot E: Future development; to be retained by developer (11.75 acres) Page 322 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 22 OOFF 99 The proposed development will be completed by: Developer: Lennar Engineer/Surveyor: Sathre-Bergquist, Inc. SSIITTEE CCOONNDDIITTIIOONNSS The Amelia Meadows 2nd Addition site is agricultural land and contains a drainageway south of the plat area traveling west to east. The site drains south towards the drainageway. There is an overhead line and facility on the west end of the site. SSTTRREEEETT AANNDD SSUUBBDDIIVVIISSIIOONN LLAAYYOO UUTT Cedar Avenue (CSAH 23) Amelia Meadows 2nd Addition is located east of Cedar Avenue, a minor arterial County highway, as identified in the City’s Transportation Plan. Cedar Avenue is currently constructed as a four-lane divided rural roadway with an urban center median. The current Dakota County Plat Review Needs Map indicates a half right-of-way requirement of 100 feet and designates this roadway as a future six-lane urban roadway over its entire length adjacent to the plat. The Developer has dedicated the necessary right-of-way as shown on the final plat. The Amelia Meadows 2nd Addition final plat was reviewed and recommended for approval by the Dakota County Plat Commission at their September 10, 2025 meeting. Gallifrey Way Development of Amelia Meadows includes the construction and extension of Gallifrey Way, a minor collector roadway, as identified in the City’s Transportation Plan. Gallifrey Way is designed as a 38-foot wide urban roadway with five-foot sidewalks along both sides of the street within 80-feet of right-of-way. The Developer shall construct a temporary cul-de-sac at the north end of Gallifrey Way within a temporary public roadway, drainage and utility easement and provide a $5,000 security for the future removal and restoration. Gafford Drive and Gerber Pass Development of Amelia Meadows 2nd Addition includes the construction of Gafford Drive and Gerber Pass, local roadways. Gafford Drive and Gerber Pass are designed as 32-foot wide urban roadways with a five-foot sidewalk along one side of the street within 60-feet of right- of-way. The Developer shall construct a temporary cul-de-sac at the west end of Gerber Pass within a temporary public roadway, drainage and utility easement and provide a $2,500 security for the future removal and restoration. Gallifrey Court Development of Amelia Meadows 2nd Addition includes the construction of Gallifrey Court, a local roadway. Road 5 is designed as a 32-foot wide urban roadway within 60-feet of right-of- way. Road 5 will terminate in a permanent cul-de-sac on the east end. Private Roads Page 323 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 33 OOFF 99 Development of Amelia Meadows 2nd Addition includes the construction of privately owned and maintained roads within Outlot B. CCOONNSSTTRRUUCCTTIIOONN AACCCCEESSSS Construction traffic access and egress for grading, utility and street construction will be from Gallifrey Way. PPAARRKKSS,, TTRRAAIILLSS AANNDD SSIIDD EEWWAALLKKSS The City’s Parks, Trails and Open Space Plan does not designate a park within Amelia Meadows 2nd Addition. The Park Dedication requirement has not been collected on the parent parcels and shall be satisfied through a cash contribution with the final plat. Development of Amelia Meadows 2nd Addition includes the construction of public trails and sidewalks. Five-foot wide concrete sidewalks, with pedestrian curb ramps, will be installed along one side of all local streets except for the Gallifrey Court cul-de-sac. Five-foot-concrete sidewalks, with pedestrian curb ramps, will be installed along both sides of Gallifrey Way. The Park Dedication requirement has not been collected on the parent parcels and will be satisfied through a cash contribution to be paid with the final plat, calculated as follows: 8 units x $5,832.00 = $46,656.00 Total Units (Low-Density) Amelia Meadows 2nd Addition 2025 Unit Rate (Low-Density) Park Dedication Fee Amelia Meadows 2nd Addition (Low-Density) 62 units x $3,968.00 = $246,016.00 Total Units (Medium- Density) Amelia Meadows 2nd Addition 2025 Unit Rate (Medium- Density) Park Dedication Fee Amelia Meadows 2nd Addition (Medium- Density) $46,656.00 + $246,016.00 = $292,672.00 Park Dedication Fee Amelia Meadows 2nd Addition (Low- Density) Park Dedication Fee Amelia Meadows 2nd Addition (Medium- Density) Park Dedication Fee Amelia Meadows 2nd Addition The Developer shall satisfy the park dedication requirement for Outlots A and E with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks through a cash contribution at the rate in effect at the time of final plat approval. UUTTIILLIITTIIEESS SSAANNIITTAARRYY SSEEWWEERR Amelia Meadows 2nd Addition is located within subdistrict FO-60100 of the Farmington Outlet sanitary sewer district as identified in the City’s Sanitary Sewer Comprehensive Plan. Page 324 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 44 OOFF 99 Development of Amelia Meadows 2nd Addition includes the extension of public sanitary sewer. 8-inch sanitary sewer will be constructed within the subdivision. The wastewater from the development will be conveyed via trunk sanitary sewer to the MCES Farmington Interceptor and continue to the Empire Wastewater Treatment Facility. Development of Amelia Meadows 2nd Addition includes the construction of privately owned and maintained sanitary sewer within Outlot B. The Sanitary Sewer Availability Charge has not been collected on the parent parcel and is required with the final plat, calculated as follows: 70 units x $327.00 = $22,890.00 Total Units Amelia Meadows 2nd Addition 2025 Unit Rate Sanitary Sewer Availability Charge Amelia Meadows 2nd Addition The Sanitary Sewer Availability Charge for Outlots A and E will be collected with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. WWAATTEERRMMAAIINN Development of Amelia Meadows 2nd Addition includes the extension of public watermain. 8- inch watermain will be extended within the development to provide water service to the subdivision. 8-inch watermain will be extended to the northern plat boundary at Gallifrey Way to service future development. Development of Amelia Meadows 2nd Addition includes the construction of privately owned and maintained watermain within Outlot B. DDRRAAIINNAAGGEE AANNDD GG RR AADDIINN GG Amelia Meadows 2nd Addition is located within subdistrict FO-018 of the Farmington stormwater district as identified in the City’s Water and Natural Resources Management Plan. Development of Amelia Meadows 2nd Addition does not include the construction of stormwater management basins. Drainage will be directed to stormwater management basins constructed with Amelia Meadows final plat to collect and treat the stormwater runoff generated from the site. The basins will outlet to the channel within the final plat area. The channel flows west to east into the City of Farmington. No building permits will be issued for the 2nd Addition until all basin and channel restoration work is completed for in the 1st Addition. The final grading plan shall identify all fill lots in which the building footings will be placed on fill material. The grading specifications shall also indicate that all embankments meet FHA/HUD 79G specifications. The Developer shall certify to the City that all lots with footings placed on fill material are appropriately constructed. Building permits will not be issued until Page 325 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 55 OOFF 99 a soils report and an as-built certified grading plan have been submitted and approved by City staff. Amelia Meadows 2nd Addition contains more than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. SSTTOORRMM SSEEWWEERR Development of Amelia Meadows includes the construction of public storm sewer systems. Storm sewer will be installed within the subdivision to collect and convey stormwater runoff generated from within the public right-of-way and lots to the public stormwater management basins constructed with the Amelia Meadows final plat. Draintile construction is required in areas of non-granular soils within Amelia Meadows 2nd Addition for the street sub-cuts and lots. Any additional draintile construction, including perimeter draintile required for building footings, which is deemed necessary during construction shall be the developer’s responsibility to install and finance. The Storm Sewer Charge has not been collected on the parent parcels and is required with the final plat, calculated as follows: Storm Sewer Charge Summary Gross Area of Amelia Meadows 2nd Addition 1,714,127.00 s.f. Less Area of Outlot A (Future Development) (-) 500,705.00 s.f. Less Area of Outlot E (Future Development) Less Area of Block 8 (Single-Family) (-) 511,967.00 s.f. (-) 113,448.00 s.f. Total Storm Sewer Charge Area (Multi-Family) = 588,007.00 s.f. Storm Sewer Charge Summary Gross Area of Block 8 (Single-Family) 113,448.00 s.f Total Storm Sewer Charge Area (Single-Family) = 113,448.00 s.f. 588,007.00 s.f. x $0.198/s.f. = $116,425.39 Net Area Amelia Meadows 2nd Addition 2025 Unit Rate (Multi-Family) Storm Sewer Charge Amelia Meadows 2nd Addition (Multi-Family) 113,448.00 s.f. x $0.178/s.f. = $20,193.74 Net Area Amelia Meadows 2nd Addition 2025 Unit Rate (Single-Family) Storm Sewer Charge Amelia Meadows 2nd Addition (Single-Family) $116,425.39 + $20,193.74 = $136,619.13 Storm Sewer Charge Amelia Meadows 2nd Addition Storm Sewer Charge Amelia Meadows 2nd Storm Sewer Charge Amelia Meadows 2nd Addition Page 326 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 66 OOFF 99 (Multi-Family) Addition (Single-Family) The Storm Sewer Charge for Outlots A and E will be collected with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. FEMA FLOODPLAIN ANALYSIS Amelia Meadows 2nd Addition is shown on the Flood Insurance Rate Map (Map No. 27037C0212E; Eff. Date 12/2/2011) as Zone X by the Federal Emergency Management Agency (FEMA). Based on this designation, there are no areas in the plat located within a Special Flood Hazard Area (SFHA), as determined by FEMA. WWEETTLLAANNDDSS The wetland delineation for the site was approved on February 27, 2024. The wetland delineation was completed by MNR. The delineation identified two small wetlands on the site adjacent to the Vermillion River Watershed Water Quality Corridor. As part to of the 1st Addition the previously farmed and eroded channel will be realigned and restored. No additional impacts are proposed to wetlands with the 2nd Addition. All wetlands, channel and buffers were placed in a city owned outlot. The developer is responsible for the establishment of the channel with native vegetation and will be required to manage the site for a minimum of 5 years or until it is fully established. Natural Area signs will be installed along the channel and buffer areas in the 2nd Addition. Final locations (20) will be approved by the city prior to installation. TTRREEEE PPRREESSEERRVVAATT II OONN The tree preservation plan identifies 196 trees on site and the trees have subsequently been removed upon issuance of a grading permit prior to recording of the final plat. EERROOSSIIOONN CCOONNTTRROOLL The Developer is responsible for meeting all the requirements of the MPCA Construction Permit. Redundant silt fence is required along all wetlands and waterways that do not have a 50-foot established buffer. Additional erosion control measures may be required during construction as deemed necessary by City staff or the Vermillion River Watershed JPO. Any additional measures required shall be installed and maintained by the developer. Page 327 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 77 OOFF 99 The MS4 Administration Fee has been collected on the parent parcels with Amelia Meadows final plat. SECURITIES The Developer shall provide a Letter of Credit as security for the Developer-installed improvements relating to Amelia Meadows 2nd Addition. Construction costs are based upon a cost estimate submitted by the Developer’s engineer on August 11, 2025 (amended September 18, 2025). CONSTRUCTION COSTS Sanitary Sewer $ 416,783.34 Watermain 359,303.00 Storm Sewer 466,129.40 Streets 818,826.00 Erosion Control and Restoration 13,844.50 SUBTOTAL - CONSTRUCTION COSTS $ 2,074,886.24 OTHER COSTS Developer’s Design (3.0%) $ 62,246.59 Developer’s Construction Survey (2.5%) 51,872.16 City’s Legal Expense (0.5%) 10,374.43 City Construction Observation (5.0%) 103,744.31 Developer’s Record Drawing (0.5%) 10,374.43 Gallifrey Way and Gerber Pass Temporary Cul-De-Sac Removal Natural Area Signs 7,500.00 3,000.00 Streetlights 10,800.00 Landscaping Lot Corners/Iron Monuments $37,900 7,500.00 SUBTOTAL - OTHER COSTS $ 305,311.92 TOTAL PROJECT SECURITY $ 2,380,198.16 The street light security totals $10,800 which consists of nine (9) post-top streetlights at $1,200 each. The Developer shall post a security to ensure the final placement of iron monuments at property corners with the final plat. The security is $100.00 per lot and outlot for a total of $7,500.00. The City shall hold this security until the Developer’s Land Surveyor certifies that all irons have been placed following site grading, street, and utility construction. CASH FEES A cash fee of $2,875.00 for traffic control signs shall be paid with the final plat. If street signs are installed during frost conditions, the Developer shall pay an additional $150.00 for each Page 328 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 88 OOFF 99 traffic control sign location. If multiple mobilizations are needed, the Developer shall pay an addition $300.00 for each mobilization. A cash fee for one-year of streetlight operating expenses shall be paid with the final plat and is calculated as follows: 70 units x $40.48/unit = $2,833.60 Total Units Amelia Meadows 2nd Addition 2025 Rate Streetlight Operating Fee Amelia Meadows 2nd Addition A cash fee for one-year of environmental resources management expenses shall be paid with the final plat and is calculated as follows: 8 units x $61.52/unit = $492.16 Total Units (Single Family) Amelia Meadows 2nd Addition 2025 Rate Environmental Resources Fee Amelia Meadows 2nd Addition (Single Family) 62 units x $61.52/unit x 0.50 = $1,907.12 Total Units (Townhomes) Amelia Meadows 2nd Addition 2025 Rate Utility Factor Environmental Resources Fee Amelia Meadows 2nd Addition (Townhomes) $492.16 + $1,907.12 = $2,399.28 Environmental Resources Fee Amelia Meadows 2nd Addition (Single Family Environmental Resources Fee Amelia Meadows 2nd Addition (Townhomes) Environmental Resources Fee Amelia Meadows 2nd Addition A cash fee for the preparation of addressing, property data, and City base map updating shall be paid with the final plat and is calculated as follows: 75 lots/outlots x $90.00/unit = $6,750.00 Lots/Outlots Amelia Meadows 2nd Addition 2025 Rate Property Data & Asset/Infrastructure Mgmt. Fee Amelia Meadows 2nd Addition The Developer shall submit the final plat and construction drawings in an electronic format. The electronic format shall be in .pdf and either .dwg/.dxf or .shx format. The Developer shall also pay a cash fee for City Engineering Administration. The fee for City Engineering Administration will be based on three percent (3.00%) of the estimated construction cost, or $62,246.59. CASH REQUIREMENTS Park Dedication $ 292,672.00 Sanitary Sewer Availability Charge 22,890.00 Storm Sewer Charge 136,619.13 Traffic Control Signs 2,875.00 Streetlight Operating Fee 2,833.60 Environmental Resources Management Fee 2,399.28 Property Data and Asset/Infrastructure Management Fee 6,750.00 City Engineering Administration (3.00%) 62,246.59 Page 329 of 899 AAMMEELLIIAA MMEEAADDOOWWSS 22NNDD AADDDDIITTIIOONN FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 22,, 22002255 PPAAGGEE 99 OOFF 99 TOTAL CASH REQUIREMENTS $ 529,285.60 RREECCOOMMMMEENNDDAATTIIOO NN Engineering recommends approval of the final plat, grading and erosion control plan, utility plan, and landscape plan for Amelia Meadows 2nd Addition, subject to the requirements and stipulations within this report. Page 330 of 899 Date: 10/6/2025 Master Agreement with Lakeville Baseball Association for Facility Use and Sponsorships Proposed Action Staff recommends adoption of the following motion: Move to approve Master Agreement with Lakeville Baseball Association (LBA) for Facility Use and Sponsorships. Overview The construction of Grand Prairie Park was approved as part of the November 2021 Park Bond Referendum. A significant component of the park includes the construction of a baseball facility. After reviewing the plans and specifications for the baseball facility, LBA requested enhancements for an improved facility that would support expanded usage. LBA agreed to donate $1 million towards the baseball facility upgrades that would not have been included in the project otherwise. The enhancements include items such as an integrated covered grandstand, restrooms, and a press box, block dugouts with a metal roof, a double batting cage, a PA system, and a single-point entry. The City Council approved this donation on August 7, 2023. LBA requested upgrades to the scoreboard, including the addition of a video screen and the installation of a Batter’s Eye, which resulted in a $375,000 donation increase. However, LBA recently received a lower quote for the cost of the scoreboard and their donation has changed to $340,000. LBA has sought sponsorship and other revenue sources to generate funds for these contributions. While agreements between the City and LBA have been previously executed, the construction of the baseball facility at Grand Prairie Park has provided an opportunity to enter into a master agreement between the two parties. The master agreement would apply to all aspects of LBA usage of Grand Prairie, King, Quigley-Sime and Steve Michaud Parks. Provisions have been included for LBA payments to the City, reservation and usage processes, LBA’s pursuit of sponsorships, maintenance, concession operations, fees, and other miscellaneous items. The Mayor and City Council approved the initial agreement at their meeting on October 7, 2024, but necessary changes have been made to reflect a reduced cost for the scoreboard and revised agreement terms due to shifting construction timelines at Grand Prairie Park. Representatives from LBA and city staff have met to discuss the attached agreement and recognize the mutual benefit of repealing any past agreements and executing an all- encompassing agreement for LBA’s usage of city park fields and facilities. Supporting Information 1. Master Agreement with Lakeville Baseball Association for Facility Use and Sponsorships Page 331 of 899 Financial Impact: $340,000 Budgeted: No Source: Donations and & Sponsorships Envision Lakeville Community Values: Access to a Multitude of Natural Amenities and Recreational Opportunities Report Completed by: Joe Masiarchin, Parks & Recreation Director Page 332 of 899 1 232434v4 MASTER AGREEMENT MASTER AGREEMENT (“Agreement”) made this 6th day of October, 2025, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation ("City"), and the LAKEVILLE BASEBALL ASSOCIATION, INC., a Minnesota non-profit corporation (the "LBA"). RECITALS A. The City owns and operates the following parks that include baseball fields (“Fields”) used by LBA for its programs, including but not limited to: Grand Prairie Park (GPP) Quigley-Sime Park (QUI) King Park (KP) Steve Michaud Park (STE) Collectively referred to herein as “Parks.” B. LBA has previously requested upgrades to certain Fields within the Parks and has contributed financially to the construction, improvement, maintenance and operations of Fields within some of the Parks; C. The parties have entered into prior agreements related to the financial participation of LBA related to the Parks and agreements related to sponsorship options for LBA to generate revenues for their financial contributions; D. The parties desire to repeal prior agreements and enter into this Master Agreement to provide terms related to LBA’s financial contributions, maintenance responsibilities, sponsorship and naming rights, and use of the Fields within the Parks. NOW THEREFORE, THE PARTIES AGREE AS FOLLOWS: 1. LBA PAYMENTS. A. LBA agrees to pay $1,000,000.00 to the City for the installation of certain upgrades to the Field at Grand Prairie Park identified in Exhibit A (“Upgrades”) payable in $100,000.00 annual payments paid to the City by November 1st of each year, beginning on November 1, 2026. The Upgrades would not otherwise be included in the Field improvement at Grand Prairie Park, B. LBA will also pay $340,000.00 to the City for the additional upgrades at Grand Prairie Park identified in Exhibit A (“Additional Upgrades”) payable in $34,000.00 annual payments Page 333 of 899 2 232434v4 paid to the City by November 1st of each year, beginning on November 1, 2026. The Upgrades would not otherwise be included in the Field improvement at Grand Prairie Park. 2. OWNERSHIP. A. The Parks, Upgrades, Additional Upgrades and all improvements within the Parks will remain, at all times, in the sole possession, ownership and control of the City. B. No interest in real estate is being created by the City on behalf of LBA under the terms of this Agreement. The City is not transferring control of the Parks, Fields, Upgrades or Additional Upgrades by entering into this Agreement. 3. FACILITY AND FIELD RESERVATIONS A. Designated Representative. LBA shall appoint a designated representative to manage overall scheduling of LBA league games, tournaments and camps (“LBA Events”). The designated representative will be responsible for submitting a master game/tournament/camp schedule (“LBA Event Scheduled”) to the City for Field reservations. B. Reservations. Reservations of Fields by LBA for LBA Events are subject to the following: 1. LBA reservations will be taken in order of the Group Priority established in the City’s Policy on use of Fields. 2. Submittal by LBA of field requests does not grant a permit or confirmation to conduct an LBA Event at a Park Field. 3. All requests for Fields must be submitted by the City’s published deadlines for Field requests and reviewed by the City for approval. City deadlines for Field requests will be established annually according to the activity season. These deadlines are sent via email to all returning field users and published on the City’s website. 4. Field permits issued by the City for LBA Events are not transferable or assignable. 5. LBA must promptly notify Lakeville Park and Recreation staff and receive approval by the City of any schedule changes or changes in fields, to allow other users to reserve fields not used by LBA. 6. The City reserves the right to cancel or relocate an LBA event due to poor weather conditions or adverse property conditions to protect the fields. Page 334 of 899 3 232434v4 7. A field permit issued by the City does not grant LBA with any property rights to the Parks including but not limited to any possessory rights or rights to restrict access and use of any member of the general public on Park property. 8. LBA shall use the Grand Prairie Park field mainly for baseball games. No practices are to be held without prior approval through the City’s Field reservation process. 9. LBA shall take all reasonable actions to protect the fields from excessive wear caused by heavy use or extreme weather conditions (drought, heavy rains). 10. LBA will be responsible for any additional services requested or required for their usage of fields, such as, but not limited to, portable toilets or extra trash cans. 11. In addition to providing player numbers, LBAs shall provide to the City additional documents that provide a scope of the organization’s health such as: financial/treasury documents, previous years players numbers, or future plans, upon request by the City. C. Tournaments. LBA may schedule tournaments for City resident and non-resident teams, subject to the terms of this Agreement. Tournament requests must be submitted with LBA Event Schedule by the City deadline for field requests. 1. LBA may host unlimited tournaments during LBA’s baseball season, provided each of the Parks is allowed one weekend off each month for rest and rehabilitation. 2. Each LBA Tournament may last no more than four consecutive days. D. LBA Camps. LBA may facilitate camps for LBA on Fields at Parks. Camps may only be attended by athletes registered to play for LBA. The City reserves the right to request participant rosters from LBA at its discretion. LBA shall provide resident and non-resident percentages for LBA Camps upon request by the City, together with any supporting documentation. 4. FEES. A. LBA Scheduled Events. Except as otherwise provided under this Section 4, the City agrees to waive field and rental fees outlined in the Lakeville Parks and Recreation Fee Schedule for LBA Events during the term of this Agreement. B. LBA Camps. LBA shall pay fees as provided in the Lakeville Parks and Recreation Fee Schedule. C. LBA Youth Athletic Association. The Youth Athletic Association Participation Fee, which is specified in the Lakeville Parks and Recreation Fee Schedule will not be waived by the City. Page 335 of 899 4 232434v4 D. Parking. LBA may not charge parking fees for any LBA scheduled events, except by separate written agreement with the City which agreement may require a reimbursement to the City of a portion of the parking fee. E. LBA Ticketed Events. LBA shall not hold a ticketed event at the Parks, unless the ticketed event is approved by written agreement with the City which agreement may require a reimbursement to the City of a portion of the ticket fees. 5. NAMING RIGHTS/SPONSORSHIPS. LBA is granted authorization to pursue the sale of naming rights and sponsorships within the parks identified below, subject to the following provisions: A. Grand Prairie Park. LBA is granted the authority to pursue the sale of naming rights and sponsorships for the elements within Grand Prairie Park as identified in Exhibit B, not to exceed 10 years from the date of this Agreement, unless otherwise noted in Exhibit B, after which, without a new Master Agreement between the City and LBA, the naming rights and sponsorships may be sold by the City and any LBA signage installed may be removed by the City. B. King Park, Steve Michaud Park and Quigley-Sime Park. LBA is granted the authority to pursue the sale of sponsorships Program that allows banners to be placed within King Park, Steve Michaud Park and Quigley-Sime Park. LBA shall enter into sponsorship agreements for banners with sponsors not to exceed 10 years from the date of this Agreement, after which, without a new Master Agreement between the City and LBA, the sponsorships may be sold by the City and any LBA banners installed may be removed by the City. C. General Requirements. 1. Except as otherwise noted herein, LBA shall be responsible for all costs associated with naming/sponsorship rights, including signage. 2. All signage, naming rights agreements and sponsorship agreements must comply with City ordinances and policies concerning signage, including sponsorship signage, and the City Sponsorship and Advertising Policy for Park Facilities. 3. All naming rights and sponsorship agreements entered into by LBA must comply with the terms of this Agreement be in a form approved by the City. Copies of all naming and sponsorship Agreements must be promptly provided to the City upon execution. 4. The City has the right to remove any banner or signage that is not in compliance with the terms of this Agreement. Page 336 of 899 5 232434v4 5. LBA, at its sole cost and expense, shall be responsible for naming rights/sponsorship solicitation, promotion and management of the naming/sponsorship programs provided under this Agreement, including the following: a. Placement and removal of the banners from the Parks. b. Storing banners during the off-season. c. Maintenance, repair and replacement of all banners placed in the Parks. d. Promptly repairing any damage to the fences, wind screens or other parts of the Fields caused by or attributed to the banners. e. All costs for damage caused within the Parks in connection with the use of the Parks for banners under the terms of this Agreement. f. LBA shall provide the City with an annual financial report to account for the revenues and expenditures of the Naming Rights and Sponsorship program. The report shall be provided by December 1st of each year. 6. EQUIPMENT PROVIDED BY LBA. LBA will provide equipment at Grand Prairie Park at LBA’s cost as provided in this Section. All equipment and plans for installation must be approved by the City Parks Director. A. Concessions Building: Stand-alone shelving and replacement, as necessary, of refrigerators and freezers purchased by the City. B. Bullpen: All items required to complete bullpens after construction including but not limited to: netting system and frame, home plate, pitching rubber, mound creation or portable pitching mound, artificial turf flooring or mats. Bullpen will be constructed with fencing, gates and ag-lime only. C. Batting Cages: All items required to complete batting cages after construction including but not limited to: netting system and frame, home plate, pitching machine, artificial turf flooring or mats. Batting cages will be constructed with fencing, gates and ag-lime only. D. Dugout: Stand-alone shelving. E. Additional Equipment. Any and all additional equipment required for play such as but not limited to: L-Screens, baseballs, chalking machine, line marking chalk. F. Ownership and Maintenance. LBA shall own and properly maintain the equipment identified in Paragraph 6 in good condition during the term of this Agreement. Page 337 of 899 6 232434v4 7. FIELD MAINTENANCE. A. Pre-Game Maintenance. LBA shall be responsible for pre-game set up for all LBA Events, which shall include the following: setting of bases, chalking field lines in the infield, completing a field safety inspection of the entire field: turf condition, field moisture (too wet to play), infield dirt condition, infield/outfield transition inspection, base paths, dugouts, fencing, safety netting, warning tracks and transition to grass, pitching mound, home plate. B. Post-Game Maintenance for All Fields. LBA shall be responsible for all post-game maintenance for all LBA events, as follows: 1. remove and store bases; 2. tarp pitching mound; 3. remove trash and debris from dugouts, bullpens, batting cages and stands and place in appropriate containers. C. Maintenance at All Fields, Excluding Grand Prairie Park. LBA shall be responsible for the following maintenance for all fields for LBA Events, excluding Grand Prairie Park: 1. fill and repair surface impacts from play at home plate and pitching mound; 2. rake grass edge into infield a minimum of 1 foot; 3. level any holes or high spots; 4. rake pitching mound key leveling any holes or high spots. D. Maintenance at Grand Prairie Park. 1. Tarp home plate 2. Unless otherwise approved by the City, LBA shall not perform infield maintenance other than what is needed to complete the game(s) scheduled for that day. 3. The City shall be responsible for managing the infield surface, pitching mound and home plate areas. E. Maintenance Standards. All Field maintenance done by LBA must be done in coordination with the City of Lakeville Parks Superintendent or Supervisor to maintain City field maintenance standards. F. Damage to Fields. 1. LBA shall not be responsible for damage to Fields or facilities within the Parks that may occur from normal wear and tear. Page 338 of 899 7 232434v4 2. Damage to Fields or facilities within the Parks that occurs as a result of intentional or negligent treatment during use or maintenance by LBA, its officers, employees, members, agents, volunteers, participants, or invitees may be subject to the following, as determined by the City Park Director: a. LBA required attendance at a maintenance/best practices meeting for field/facility prior to further use by LBA of the Field or facility within the Parks. b. Reduction in allowed LBA reservations for a Field or facility within the Parks. c. Reimbursement for damages prior to future use by LBA of the Parks. d. Cancellation of LBA remaining Field reservations within the Parks. 8. CONCESSIONS/LIQUOR. A. Authorization. 1. LBA is authorized to run and maintain the concessions facilities at the Grand Prairie Park Grandstand, King, Steve Michaud and Quigley-Sime Parks (“Concessions Facilities”) for LBA Events and for third party scheduled events during the time period of the scheduled event. 2. Other renters may run concessions with the understanding that they will not have access to the Concessions Facilities. 3. LBA is authorized to sell malt beverages and wine at the Concessions Facilities during scheduled events. Prior to any sale of alcohol, LBA must obtain the appropriate liquor license for sale of alcohol at the Concessions Facilities. B. Use of Concessions Facilities. Unless specifically agreed to in writing by the City, LBA shall use the Concession Facilities only for the purpose of preparing, storing, and selling to the public food, beverages and merchandise; and engaging in such other activities incidental thereto. LBA shall not use or occupy the Concession Facilities or knowingly permit the Concession Facilities to be used or occupied: (i) contrary to any statute, rule, order, ordinance, requirement or regulation applicable thereto; (ii) in any manner which would cause structural injury to the improvements, cause the value or usefulness of the Concession Facilities or any part thereof substantially to diminish (reasonable wear and tear excepted); (iii) which would adversely affect the City’s activities on property owned by the City adjacent to the Concession Facilities; or (iv) which would constitute a public or private nuisance or waste. LBA shall promptly upon discovery of any such prohibited use take all necessary steps to compel the discontinuance of such use and shall immediately notify the City of such use. Page 339 of 899 8 232434v4 C. Hours. Any time limit to sales or is reference to sales during the time period for the event sufficient. D. LBA Obligations. 1. LBA shall obtain any necessary permits or licenses for sale of food and beverage products and merchandise at the Concessions Facilities and shall maintain such permits and licenses in good standing during the term that LBA is authorized to operate the Concessions Facility. 2. LBA shall be solely responsible for security of the Concessions Facilities, including the inventory and any loss, damage or destruction. 3. LBA shall comply with all procedures and policies set by the City pertaining to the Concessions Facilities. 4. LBA shall not sell tobacco or products containing THC at the Concessions Facilities. 5. LBA shall not serve food or beverages in glass containers. 6. LBA shall not sell any beverages contrary to a City beverage policy or any contract maintained by the City. In order to minimize conflicts regarding food, beverage and merchandise issues, LBA agrees to meet with City representatives prior to preparing the annual product list and periodically thereafter. 7. LBA shall not provide food, beverages or merchandise to City employees at a discount or without charge. 8. LBA shall not store, keep, dispose of, transport or generate at the Concession Facilities any hazardous substances or other dangerous materials. 9. LBA shall not make any alterations to the Concessions Facilities or the surrounding areas without the prior written approval of the City. 10. LBA shall not erect, install or maintain any signs, advertising media, product logo displays or other signs in connection with its use of the Concessions Facilities, except as authorized under this Agreement or by prior written approval of the City. 11. Designated Representative. LBA shall appoint a designated representative to manage LBA use of Concessions Facilities and act as the City’s primary contact for use of Concessions Facilities. 12. Repair, maintenance, cleaning of the Concessions Facilities. Page 340 of 899 9 232434v4 a. Keep the Concessions Facilities in good order and condition. b. Keep the Concessions Facilities and the surrounding areas reasonably free from trash and rubbish. c. LBA shall reimburse the City for any cleaning costs incurred by the City as a result of LBA’s failure to comply with the cleaning obligations. E. Ownership and Maintenance. All equipment and property owned by LBA shall remain the property of LBA. LBA shall be solely responsible for maintaining and cleaning of its property. F. Assumption of Risks. LBA assumes all risk of loss or damage of LBA’s property within the Concession Facilities, including any loss or damage caused by water leakage, fire, windstorm, explosion, theft, vandalism or other cause. The City shall not be liable to LBA or those claiming through LBA, for injury, death or property damage occurring on, in, or about the Concessions Facilities, except as may be caused by the willful misconduct or negligence of the City. Nothing herein shall be deemed to be a waiver of any limits of liability granted the City under statutory or common laws. G. Discrimination. LBA will not discriminate against any party seeking to retain LBA’s services based on race, color, creed, religion, ancestry, gender, national origin, affectional preference, disability, age, marital status, status with regard to public assistance, or status as a disabled veteran. LBA will include similar nondiscrimination provisions in all subcontracts into which it enters for performance of its obligations hereunder. H. Insurance. LBA shall obtain and keep in force during the term of this Agreement the insurance required by the City for rental of the Concessions Facilities and the serving of liquor at the Concessions Facilities. I. Termination. Either party may terminate this Section 8 of the Agreement upon 30 days’ notice to the other party. The City may terminate this Section 8 or any portion thereof immediately upon a breach by LBA under Section 8. J. LBA’s Obligations Upon Termination. Upon termination of this Section 8 LBA will immediately cease all sales of food, beverage and merchandise at the Concessions Facilities and promptly remove all LBA property from the Concessions Facilities. Any LBA property that is not removed from the Concessions Facilities within 30 days shall be deemed abandoned by the City and the City may remove LBA property from the Concessions Facilities. K. Food Trucks and Other Providers. The rights to serve food and beverages at the Parks is not exclusive to LBA. Food trucks are allowed in designated areas, with prior approval of the Lakeville Parks and Recreation Department. 9. VEHICLES/PARKING Page 341 of 899 10 232434v4 A. Unless expressly provided in a permit, all motorized vehicles, including Golf carts, UTV’s and other recreational vehicles are prohibited within the Parks, including park trails and parkways designated for public transportation. This prohibition shall not apply to the use of motorized wheelchairs and scooters by handicapped individuals. B. Any vehicle pass that has been provided to LBA must be clearly displayed on the dashboard of each vehicle in the designated area. Any vehicles not properly displaying the appropriate vehicle pass are prohibited any may result in the issuance of a warning and/or citation and/or towed from City property. 10. DECOMMISSIONING. The Parks or any improvements contained within the Parks, including the Upgrades or Additional Upgrades may be decommissioned based on the City’s determination that the Upgrades or Additional Upgrades have reached the end of their useful life or required repairs become financially burdensome to the City or the City determines that a Park is needed for another public use. If the Upgrades at Grand Prairie Park are decommissioned prior to LBA’s final payment of provided under Section 1, no further payments will be made by LBA. 11. MISCELLANEOUS. A. LBA must have all users of equipment in the Grand Prairie Park press box, including but not limited to the sound, system, video screen and scoreboard, trained by the City or designated LBA members in the use of the equipment prior to use. B. Access to the Parks and the facilities located within the Parks access may only be provided by the Lakeville Parks and Recreation Department. LBA may not allow others to use LBA access to the Parks and the facilities located within the Parks. C. LBA’s use of the Parks is limited to the hours that the Parks are opened as designated by the City. D. LBA shall obtain and keep in force during the term of this Agreement the insurance required by the City for rental of the Parks and Fields. 12. NOTICES. All notices, offers, consents or other communications required or permitted to be given pursuant to this Agreement shall be in writing and shall be considered as properly given or make if delivered personally or by messenger or delivered by mail, and addressed to the address of the intended recipients at the following addresses: Page 342 of 899 11 232434v4 TO CITY: City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Attn: Parks and Recreation Director TO LBA: Lakeville Baseball Association, Inc. PO Box 517 Lakeville, MN 55044 Attn: Commissioner Either party may change its address by giving notice in writing stating its new address to the other party. 13. COMPLIANCE WITH LAWS. LBA shall comply with all federal, state and local laws and City policies in connection with its use of the Parks as provided under this Agreement. 14. INDEMNIFICATION. LBA shall defend, indemnify and hold harmless the City, its employees, agents, contractors and invitees against all claims, demands, causes of action, fines penalties, damages (including consequential damages), losses, liabilities, judgments, and all related costs and expenses (including reasonable attorneys' fees) for injury, death, disability or illness of any person, or damage to property, occurring on or about the Parks, arising from LBA’s operations on City property, or any acts, omissions, or negligence of LBA or LBA’s officers, agents, members, employees, volunteers, invitees, or visitors. Notwithstanding the foregoing, LBA shall not be obligated to indemnify the City for claims, demands and actions arising out of or caused by the negligence or willful misconduct of City employees or agents. 15. ASSIGNABILITY. The rights and obligations of LBA under this Agreement shall not be assignable or transferable 16. AUDITS. Under Minnesota Statutes § 16C.05, subdivision 5, LBA’s books, records, documents, and accounting procedures and practices relevant to this Agreement are subject to examination by the City and the State Auditor or Legislative Auditor, as appropriate, for a minimum of six years from the end of this Agreement. 17. GOVERNMENT DATA PRACTICES. LBA must comply with the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, as it applies to all data provided under this Agreement, and as it applies to all data created, collected, received, stored, used, maintained, or disseminated under this Agreement. The civil remedies of Minnesota Statutes §13.08 apply to the release of the data referred to in this clause by either LBA or the City. Page 343 of 899 12 232434v4 18. MODIFICATIONS/AMENDMENTS. Any alterations, variations, modifications, amendments or waivers of the provisions of this Agreement shall only be valid when they have been reduced to writing, approved by the City and LBA. 19. WAIVER. The waiver by either party of any breach or failure to comply with any provision of this Agreement by the other party shall not be construed as, or constitute a continuing waiver of such provision or a waiver of any other breach of or failure to comply with any other provision of this Agreement. 20. GOVERNING LAW. This Agreement shall be construed in accordance with governed by the laws of the State of Minnesota. 21. COUNTERPARTS. This Agreement may be executed in multiple counterparts, each of which shall be deemed an original, but all of which together shall constitute one and the same document. 22. TERM; TERMINATION. A. Except as otherwise provided in this Agreement, this Agreement shall terminate on December 31, 2035, unless otherwise extended or amended by the parties. B. This Agreement may be terminated by either party in the event of a material breach by the other party upon 30 days’ notice to the other party. 23. ENTIRE AGREEMENT. This Agreement, and any documents referenced or incorporated herein, represent the entire integrated agreement between LBA and the City and supersedes all prior negotiations, representations, or agreements, either written or oral. [Remainder of page intentionally left blank] [Signature pages to follow] Page 344 of 899 13 232434v4 THIS AGREEMENT executed by the parties hereto the day and year first above written. CITY OF LAKEVILLE BY: ______________________________ Luke M. Hellier, Mayor AND _____________________________ Ann Orlofsky, City Clerk LAKEVILLE BASEBALL ASSOCIATION, INC. Thane Hathaway Commissioner Thane Hathaway (Oct 1, 2025 17:16:39 EDT) Page 345 of 899 14 232434v4 EXHIBIT A GRAND PRAIRIE PARK UPGRADES Upgrades: • Grandstand with restroom, concessions, storage and press box • Block dugouts with protective fence • Single entrance controlled for ticketed events Additional Upgrades: • Scoreboard & video board • Batter's Eye Page 346 of 899 15 232434v4 EXHIBIT B GRAND PRAIRIE PARK NAMING AND SPONSORSHIP ELEMENTS 1. Grandstand Naming Rights a. City will pay up to $5,000 for the ID Sign and Grandstand Sign 2. Beer Garden Naming Rights 3. Concessions Stand Naming Rights 4. Left Field Observation Deck Naming Rights 5. Right Field Observation Deck Naming Rights 6. Scoreboard Naming Rights 7. Left Field Dugout Sponsor 8. Right Field Dugout Sponsor 9. Field (Grounds Crew) Naming Rights 10. Batting Cage #1 Sponsor 11. Batting Cage #2 Sponsor 12. Press Box Sponsor 13. Warmup Mound #1 14. Warmup Mound #2 15. Batters Eye 16. Stadium Seats 17. Wall of Fame 18. First Base Patio 19. Restrooms 20. Storage / Umpire Room 21. Field Lighting Page 347 of 899 AGREEMENT Final Audit Report 2025-10-01 Created:2025-09-29 By:Joseph Masiarchin (jmasiarchin@lakevillemn.gov) Status:Signed Transaction ID:CBJCHBCAABAADr9wjNlqdFan8FgKMNCxPveHQ_xBIwoJ "AGREEMENT" History Document created by Joseph Masiarchin (jmasiarchin@lakevillemn.gov) 2025-09-29 - 2:41:58 PM GMT Document emailed to Thane Hathaway (thane.hathaway@lakevillebaseball.org) for signature 2025-09-29 - 2:42:03 PM GMT Email viewed by Thane Hathaway (thane.hathaway@lakevillebaseball.org) 2025-09-29 - 5:57:56 PM GMT Email viewed by Thane Hathaway (thane.hathaway@lakevillebaseball.org) 2025-10-01 - 9:15:13 PM GMT Document e-signed by Thane Hathaway (thane.hathaway@lakevillebaseball.org) Signature Date: 2025-10-01 - 9:16:39 PM GMT - Time Source: server Agreement completed. 2025-10-01 - 9:16:39 PM GMT Page 348 of 899 Date: 10/6/2025 Supplemental Agreement with Irrigation by Design, Inc. (IBD) for King Park Irrigation Filtration Installation Proposed Action Staff recommends adoption of the following motion: Move to accept supplemental agreement from IBD for King Park Irrigation filtration installation. Overview An irrigation filtration system installed at King Park will be utilized to filter the storm basin water. The filtered water will reduce valve and sprinkler head repairs. Maintenance staff time will be reduced, and operation of the irrigation system will improve. IBD’s supplemental agreement identifies the scope of services and estimated cost to complete is $102,975.19 and is subject to the Master Services Agreement dated April 21, 2025. At this time, Staff is recommending the Mayor and City Council accept the proposal from Irrigation by Design in the amount of $102,975.19. Supporting Information 1. Irrigation Filtration Proposal Financial Impact: $102,975.19 Budgeted: Yes Source: Park Dedication Envision Lakeville Community Values: Access to a Multitude of Natural Amenities and Recreational Opportunities Report Completed by: Mark Kruse, Parks Superintendent Page 349 of 899 Caring professionals who deliver exceptional management of our outdoor living environment. 175 James Avenue North | Minneapolis, MN 55405 | 763.559.7771 | www.irrigationbydesign.com Irrigation by Design proudly employs EPA WaterSense ® Partners IRRIGATION FILTRATION PROPOSAL Date: September 16, 2025 Attn: Mr. Mark Kruse Parks Superintendent City of Lakeville Parks Department 20195 Holyoke Avenue Lakeville, MN 55044 Email: mkruse@lakevillemn.gov Desk: 952-985-2715 Project: King Park Filtration installation Scope of proposed work: a) Furnish, install and place into service, a self-cleaning filtration system to filter reuse irrigation pond water before entering the King Park irrigation distribution system. Work will include associated irrigation pump station augmentation. b) City of Lakeville Parks will form and install a concrete pad and related materials at the designated location outside of the existing irrigation pumphouse. IBD will set the new filter assembly, connect, test and place into service. Modification of the existing stormwater irrigation pumphouse will be required. c) Following filter installation and testing, a weather resistant control cabinet to house and protect the reuse irrigation filter assembly will be measured, ordered separately and installed by IBD. • Installation to be performed utilizing manufacturer recommendations and industry best Practices. • IBD personnel are certified in accordance with HDPE manufacturer requirements for Fusion Safety, Manual Butt Fusion, Hydraulic Butt Fusion, Sidewall Fusion, Socket Fusion and Aquasaddle Fusion, Cert No. 3408. Certification paperwork available upon request. Page 350 of 899 Mr. Mark Kruse King Park Filtration Installation September 16, 2025 Caring professionals who deliver exceptional management of our outdoor living environment. 175 James Avenue North | Minneapolis, MN 55405 | 763.559.7771 | www.irrigationbydesign.com Irrigation by Design proudly employs EPA WaterSense ® Partners •Irrigation by Design, Inc. meets all Quality Assurance requirements of Certified Irrigation Designer, Certified Irrigation Contractor, Power Limited Technician and Technology Systems Contractor License. •Work will be warranted against defects in materials or workmanship for a period of one year from the date of placement into service. Proposed Fee: Not including applicable sales tax*: $102,975.19 Note(s): *Sales tax exemption certificate is required if exempt from sales tax Bonding is not included in this pricing. This is not a prevailing wage project. Deposit in the amount of 50% is required prior to ordering. Pricing is valid for 30 days beyond the date of this proposal. Water in Motion, Inc. consulting, research, design fees, if any, are not included. Signed:Matthew Kuha - CIC, CLIA, EPA Watersense Partner Business Development - Irrigation by Design, Inc. 763-559-7771 APPROVAL: The City of Lakeville Parks Department selects approves Irrigation by Design, Inc. to proceed with this project: ________________________________________________________ ________________________ Signature of an authorized Client representative Date ________________________________________________________ _________________________ Printed name of an authorized Client representative Phone ________________________________________________________ _________________________ Position of an authorized Client representative Email Date: October 6, 2025 Page 351 of 899 Date: 10/6/2025 APPRO Development/NPL Expansion - Site Improvement Performance Agreement Proposed Action Staff recommends adoption of the following motion: Move to approve the Site Improvement Performance Agreement (SIPA) with APPRO Development. Overview APPRO Development, Inc. has submitted a site plan application and civil plan set to construct a new building and parking lot on the vacant lot on Lot 1, Block 1, Airlake Development 8th Addition. The property is located south of and adjacent to 215th Street (CSAH 70). The parcel is zoned I-2, Light Industrial District. Development of the property requires administrative site plan approval and City Council approval of a SIPA. The proposed site plan improvements include construction of an 11,500 square foot office/warehouse/storage building. The site and building plans provide for the construction of private sanitary sewer and water utilities, and expansion of an existing stormwater basin on an adjoining lot to serve the Property. An at-grade parking lot will also be constructed. Access to the property is from the existing access point on the developed NPL site to the west. The site plan complies with Zoning Ordinance requirements and will be approved by City staff in conjunction with a building permit application. Supporting Information 1. Site Improvement Performance Agreement (SIPA) 2. Location Map and Narrative from Applicant 3. APPRO Engineering Report 9-8-25 4. Grading and Landscaping Plans Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Diversified Economic Development Report Completed by: Heather Botten, Senior Planner Page 352 of 899 Page 353 of 899 Page 354 of 899 Page 355 of 899 Page 356 of 899 Page 357 of 899 Page 358 of 899 Page 359 of 899 Page 360 of 899 Page 361 of 899 Page 362 of 899 Page 363 of 899 Page 364 of 899 Page 365 of 899 Page 366 of 899 Building Narrative 08/05/2025 A new building is being proposed on the existing undeveloped lot that is west of Performance Computer Forms and East of NPL companies on the south side of County Road 70/215th Street West. The development includes a new building and outdoor storage yard. This will be an expansion of operations for NPL in Lakeville. NPL is an underground utility company that utilizes excavating and boring equipment to install underground gas piping, electrical cabling and high speed internet fiber. The building will be used for storage of weather sensitive material and the expanded yard will be used for truck, trailer, excavating equipment and other material related to their operation. Much of which is stored in Lakeville currently. Page 367 of 899 City of Lakeville Public Works – Engineering Division Memorandum To: Heather Botten, Senior Planner From: Jon Nelson, Assistant City Engineer McKenzie L. Cafferty, Environmental Resources Manager Joe Masiarchin, Parks and Recreation Director Copy: Zach Johnson, City Engineer Tina Goodroad, Community Development Director Julie Stahl, Finance Director Dave Mathews, Building Official Date: September 8, 2025 Subject: Appro Development – NPL Expansion Lot 1, Block 1, Airlake Development 8th Addition • Site Plan Review • Grading and Erosion Control Plan Review • Utility Plan Review BACKGROUND APPRO Development, Inc. has submitted a site plan application and grading and utility plan to construct a private parking lot and new building on the existing vacant lot on Lot 1, Block 1, Airlake Development 8th Addition. The property is located south of and adjacent to 215th Street (CSAH 70). The parent parcel is zoned I-2, Light Industrial District. The proposed site plan application will be completed by: Applicant: APPRO Development, Inc. Engineer: Rehder & Associates, Inc. SITESITE CONDITIONSCONDITIONS Lot 1, Block 1, Airlake Development 8th Addition consists of undeveloped land. An existing driveway bisects the eastern property line. A railway line crosses over the southeast corner of the property. The remainder of the property is undeveloped landscaped greenspace. Page 368 of 899 AAPPROPPRO DDEVELOPMENTEVELOPMENT –– NPLNPL EEXPANSIONXPANSION LLOTSOTS 1,1, BBLOCKLOCK 1,1, AAIRLAKEIRLAKE DDEVELOPMENTEVELOPMENT EEIGHTHIGHTH AADDITIONDDITION SSITEITE PPLANLAN SSEPTEMBEREPTEMBER 8,8, 20252025 PPAGEAGE 22 OFOF 55 SITESITE PLANPLAN REVIEWREVIEW APPRO Development, Inc. proposes to construct a building and parking lot on Lot 1, Block 1. The site proposes to expand an existing stormwater basin directly south of the site plan area. UTILITIESUTILITIES SSANITARYANITARY SSEWEREWER The site proposes connecting to an existing sanitary sewer stub located in 215th Street (CSAH 70) right-of-way. WWATERMAINATERMAIN The site proposes connecting to an existing watermain stub located in 215th Street (CSAH 70) right-of-way. OOVERHEADVERHEAD UUTILITIESTILITIES There are existing overhead utility lines adjacent to the parent parcels along 215th Street (CSAH 70), which will not be impacted with the proposed site plan improvements. DRAINAGEDRAINAGE ANDAND GRADINGGRADING The parent parcel is located within subdistricts SC-046 and SC-054 of the South Creek Stormwater District, as identified in the City’s Water Resources Management Plan. The parent parcel does not have any existing stormwater management on site. The applicant will expand the existing stormwater basin immediately south of the site to treat the runoff from the added impervious surface area with the site plan improvements. The developer is responsible for the restoration and establishment of the basin (Acorn Tappe 1st Addition Outlot A). The developer shall submit a grading plan that is reviewed and approved by city staff prior to approval of the site plan. The site improvements contain more than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. A copy of the Notice of Stormwater Permit Coverage must be submitted to the City upon receipt from the MPCA. FEMAFEMA FLOODPLAINFLOODPLAIN ANALYSISANALYSIS The site is shown on the Flood Insurance Rate Map (Map No. 27037C0213E; Eff. Date 12/2/2011) as Zone X by the Federal Emergency Management Agency (FEMA). Based on this Page 369 of 899 AAPPROPPRO DDEVELOPMENTEVELOPMENT –– NPLNPL EEXPANSIONXPANSION LLOTSOTS 1,1, BBLOCKLOCK 1,1, AAIRLAKEIRLAKE DDEVELOPMENTEVELOPMENT EEIGHTHIGHTH AADDITIONDDITION SSITEITE PPLANLAN SSEPTEMBEREPTEMBER 8,8, 20252025 PPAGEAGE 33 OFOF 55 designation, there are no areas in the plat located within a Special Flood Hazard Area (SFHA), as determined by FEMA. STORMSTORM SEWERSEWER Storm sewer will be installed within the site to collect and convey stormwater runoff generated from within the site to the expanded public stormwater management basin constructed to the south of the site. The Storm Sewer Charge has been collected on the parent parcels and will not be required with the site plan improvements. WETLANDSWETLANDS The site was evaluated for wetlands by Kjolhaug Environmental and no wetlands were identified on the site. TREETREE PRESERVATIONPRESERVATION A tree preservation plan was not prepared with the site plan improvements. No trees are proposed to be removed with the site plan improvements. EROSIONEROSION CONTROLCONTROL The Applicant is responsible for obtaining a MPCA Construction Permit for the site as well as developing and maintaining the SWPPP throughout construction phase. The permit requires that all erosion and sediment BMPS be clearly outlined in a site’s SWPPP. Changes made throughout construction should be documented in the SWPPP. A revised SWPPP plan must be submitted to and approved by the City addressing all outstanding comments prior to any grading activity. Additional erosion control measures may be required during construction as deemed necessary by City staff. Any additional measures required shall be installed and maintained by the Developer. $12,801 x 2% Grading Costs = $256.02 Mass Grading Cost MS4 Admin Fee Total SECURITIESSECURITIES The Developer shall provide a Letter of Credit as security for the Developer-installed improvements relating to the site. Page 370 of 899 AAPPROPPRO DDEVELOPMENTEVELOPMENT –– NPLNPL EEXPANSIONXPANSION LLOTSOTS 1,1, BBLOCKLOCK 1,1, AAIRLAKEIRLAKE DDEVELOPMENTEVELOPMENT EEIGHTHIGHTH AADDITIONDDITION SSITEITE PPLANLAN SSEPTEMBEREPTEMBER 8,8, 20252025 PPAGEAGE 44 OFOF 55 CONSTRUCTION COSTS Storm Sewer Improvements $ 2,100.00 Erosion Control, Grading, and Restoration Vegetation Establishment (3-year maintenance period) 14,651.00 50,000.00 SUBTOTAL - CONSTRUCTION COSTS $ 66,751.00 OTHER COSTS Developer’s Design (3.0%) $ 2,002.53 Developer’s Construction Survey (2.5%) 1,668.78 City’s Legal Expense (0.5%) 333.76 City Construction Observation (5.0%) 3,337.55 Developer’s Record Drawing (0.5%) Landscaping 333.76 20,192.37 SUBTOTAL - OTHER COSTS $27,868.75 TOTAL PROJECT SECURITY $94,619.75 CASH FEES A cash fee for one-year of environmental resources management expenses shall be paid with the final plat and is calculated as follows: 1 unit x $61.52/unit x 4.20 = $258.38 Total Units 2025 Rate Utility Factor Environmental Resources Fee A cash fee for the preparation of addressing, property data, and City base map updating shall be paid with the final plat and is calculated as follows: 1 lots/outlots x $90.00/unit = $90.00 Lots/Outlots 2025 Rate Property Data & Asset/Infrastructure Mgmt. Fee The Developer shall also pay a cash fee for City Engineering Administration. The fee for City Engineering Administration will be based on three percent (3.00%) of the estimated construction cost, or $2,002.53. CASH REQUIREMENTS MS4 Admin Fee Environmental Resources Management Fee 256.02 258.38 Property Data and Asset/Infrastructure Management Fee 90.00 City Engineering Administration (3.00%) 2,002.53 TOTAL CASH REQUIREMENTS $2,606.93 Page 371 of 899 AAPPROPPRO DDEVELOPMENTEVELOPMENT –– NPLNPL EEXPANSIONXPANSION LLOTSOTS 1,1, BBLOCKLOCK 1,1, AAIRLAKEIRLAKE DDEVELOPMENTEVELOPMENT EEIGHTHIGHTH AADDITIONDDITION SSITEITE PPLANLAN SSEPTEMBEREPTEMBER 8,8, 20252025 PPAGEAGE 55 OFOF 55 RECOMMENDATIONRECOMMENDATION Engineering recommends approval of the site plan, grading and erosion control plan, and utility plan for the Appro Development - NPL expansion, subject to the requirements and stipulations within this report. Page 372 of 899 Page 373 of 899 Page 374 of 899 Page 375 of 899 Date: 10/6/2025 Naming Rights Agreement Between the City of Lakeville, Lakeville Baseball Association and Jeff Belzer’s Todd Chevrolet, Incorporated for the Grand Prairie Park Grandstand Proposed Action Staff recommends adoption of the following motion: Move to approve Naming Rights Agreement Between the City of Lakeville, Lakeville Baseball Association and Jeff Belzer’s Todd Chevrolet for Grand Prairie Park Grandstand Overview As part of the funding for the construction of the grandstand at Grand Prairie Park, LBA has pledged a $1 million donation to support a portion of the project, including upgrades that would not have been included otherwise. This includes items such as an integrated covered grandstand, restrooms, and a press box, block dugouts with a metal roof, a double batting cage, a PA system, and a single-point entry. As part of their fundraising efforts, LBA has been exploring a naming rights and sponsorship opportunity with Jeff Belzer’s Todd Chevrolet for the grandstand. Staff and representatives from LBA have met numerous times with Belzer to define terms for this partnership. Under this agreement, the grandstand will be named “Belzer Stadium.” The terms of the agreement include a $250,000 naming rights contribution that will be paid in increments of $25,000 over the next ten years. All naming rights and sponsorship signage must meet the criteria defined by staff. The agreement stipulates that sponsor signage will be included on the park ID sign facing Cedar Avenue and above the main entrance of the grandstand, as well as other branded signage located within the grandstand facility. This agreement only pertains to the grandstand and other amenities cited in the agreement; LBA is allowed to pursue additional naming rights and sponsorship opportunities for other amenities within the facility. After the ten-year term, Belzer will have the first right of refusal to extend their terms before LBA pursues other naming rights and sponsorship opportunities. Staff recognizes that this is a mutually beneficial agreement that allows LBA to satisfy their donation obligation to the City. Supporting Information 1. Naming Rights Agreement Between the City, LBA and Jeff Belzer’s Todd Chevrolet, Inc. for the Grand Prairie Park Grandstand Page 376 of 899 Financial Impact: $250,000 Budgeted: No Source: Donations/Naming Rights Sponsorship Envision Lakeville Community Values: Report Completed by: Joe Masiarchin, Parks & Recreation Director Page 377 of 899 Page 378 of 899 Page 379 of 899 Page 380 of 899 Page 381 of 899 Page 382 of 899 Page 383 of 899 Page 384 of 899 Page 385 of 899 Date: 10/6/2025 Resolution Awarding Agreement for Abatement and Demolition with Rachel Contracting at 17622 Dodd Boulevard Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution awarding an agreement with Rachel Contracting for abatement and demolition activities at 17622 Dodd Boulevard, City Project 25-18. Overview The City Council approved a purchase agreement to acquire the property at 17622 Dodd Boulevard on June 2, 2025. The City closed on the property on June 27, 2025, and the seller has vacated the site. The existing buildings must be demolished and disposed of to prepare the site for future public facilities. In support of facilitating demolition activities, WSB inspected the existing buildings and developed an Asbestos and Regulated Materials Survey. The report identified the presence of asbestos containing and/or regulated materials. To assist in advancing redevelopment of the site, the asbestos containing and/or regulated materials must be properly removed and/or disposed of prior to demolition activities. The City received seven bids on September 30, 2025 for abatement and demolition activities for City Project 25-18 ranging from a low bid of $74,280 submitted by Rachel Contracting to a high bid of $131,000. The agreement includes the project responsibilities, scope of services and cost to complete the abatement and demolition work. Supporting Information 1. 2025.10.06 Resolution Awarding Abatement and Demolotion Agreement 2. 2025.10.06 Agreement for Abatement and Demolition 3. 2025.10.01 Bid Recommendation Financial Impact: $74,280 Budgeted: Yes Source: Multiple Sources Envision Lakeville Community Values: Design that Connects the Community Report Completed by: Zach Johnson, City Engineer Page 386 of 899 CITY OF LAKEVILLE RESOLUTION NO. 25- Resolution Awarding Agreement for Abatement and Demolition Activities at 17622 Dodd Boulevard City Project 25-18 WHEREAS, the City of Lakeville received sealed bids on Tuesday, September 30, 2025, at 3:00 p.m. for abatement and demolition activities at 17622 Dodd Boulevard, City Project 25-18; and WHEREAS, the lowest responsible bid was from Rachel Contracting, LLC. NOW, THEREFORE, BE IT RESOLVED, that the City Council of the City of Lakeville, Minnesota: Hereby awards the contract to the lowest responsible bidder that meets all the bid requirements, Rachel Contracting, LLC., with a bid in the amount of $74,280.00. The abatement and demolition are proposed to be completed as specified in the contract documents. ADOPTED by the Lakeville City Council this 6th day of October 2025. CITY OF LAKEVILLE ______________________________ Luke M. Hellier, Mayor ATTEST: _________________________________ Ann Orlofsky, City Clerk Page 387 of 899 1 237432v1 INDEPENDENT CONTRACTOR AGREEMENT ABATEMENT AND DEMOLITION PROJECT AGREEMENT made this 6th day of October 2025, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation ("City") and RACHEL CONTRACTING, LLC, a Minnesota corporation ("Contractor"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. CONTRACT DOCUMENTS. The Contract consists of the following documents. In the event of conflict among the documents, the conflict shall be resolved by the order in which they are listed, with the document listed first having the first priority and the document listed last having the last priority: A. This Independent Contractor Agreement; B. City’s Bid Documents and Specifications for Abatement and Demolition Project dated September 8, 2025; and C. Contractor’s Bid for 17622 Dodd Boulevard, Contract Abatement & Demolition Project (“Bid”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts. Contract Document “A” has the first priority and Contract Document “C” has the last priority. 2. SCOPE OF SERVICES. The City retains Contractor to remove and dispose of asbestos containing materials listed in the Asbestos and Regulated Materials Assessment dated August 26, 2025 (“Report”) and demolish and removal all buildings, structures, foundations, footings, and concrete support slabs. Contractor acknowledges receipt of the Report. Contractor agrees to complete the services under this Agreement substantially within the time frames identified in the Proposal with a final completion date of November 14, 2025. 3. COMPENSATION. Contractor shall be paid Seventy-Four Thousand Two Hundred Eight and no/100 Dollars ($74,280.00) by the City, which fee is inclusive of reimbursables, expenses, taxes and other charges. The fee shall not be adjusted if the estimated hours to perform a task, the number of estimated required meetings or any other estimate or assumption are exceeded. Contractor shall be paid upon full completion of the work required herein. The City will normally pay an invoice within 35 days of receipt. Prior to final payment, Contractor must furnish City with a lien waiver for all labor, materials, equipment and supplies furnished for the project and form IC134 completed as required by Minnesota Rules, Part 8092.2000. 4. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. Page 388 of 899 2 237432v1 5. DOCUMENTS. All reports, plans, models, software, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. The City shall be the copyright owner. The vesting of the City’s ownership of the copyright in materials created by the Contractor shall be contingent upon the City’s fulfillment of its payment obligations hereunder. The Contractor shall be allowed to use a description of the services provided hereunder, including the name of the City, and photographs or renderings of any projects which develop from the planning or other services provided by the Contractor, in the normal course of its marketing activities. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Contractor shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided, including, but not limited to, Minnesota Statutes § 16C.285. 7. STANDARD OF CARE. Contractor shall exercise the same degrees of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional Contractor under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Contractor’s services. 8. INDEMNIFICATION. Contractor shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the execution or performance of the work or services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Prior to the start of the project, Contractor shall furnish to the City a certificate of insurance showing proof of the required insurance required under this Paragraph. Contractor shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, such insurance as shall protect Contractor and the City for work covered by the Contract including workers’ compensation claims and property damage, bodily and personal injury which may arise from operations under this Contract, whether such operations are by Contractor or anyone directly or indirectly employed by either of them. The minimum amounts of insurance shall be as follows: Commercial General Liability (or in combination with an umbrella policy) $2,000,000 Each Occurrence $2,000,000 Products/Completed Operations Aggregate $2,000,000 Annual Aggregate The following coverages shall be included: Premises and Operations Bodily Injury and Property Damage Personal and Advertising Injury Blanket Contractual Liability Products and Completed Operations Liability Automobile Liability $2,000,000 Combined Single Limit – Bodily Injury & Property Damage Including Owned, Hired & Non-Owned Automobiles Page 389 of 899 3 237432v1 Workers Compensation Except as provided below, Contractor must provide Workers’ Compensation insurance for all its employees and, in case any work is subcontracted, Contractor will require the subcontractor to provide Workers’ Compensation insurance in accordance with the statutory requirements of the State of Minnesota, including Coverage B, Employer’s Liability. Insurance minimum limits are as follows: $500,000 – Bodily Injury by Disease per employee $500,000 – Bodily Injury by Disease aggregate $500,000 – Bodily Injury by Accident If Minnesota Statute 176.041 exempts Contractor from Workers’ Compensation insurance or if the Contractor has no employees in the City, Contractor must provide a written statement, signed by an authorized representative, indicating the qualifying exemption that excludes Contractor from the Minnesota Workers’ Compensation requirements. If during the course of the contract the Contractor becomes eligible for Workers’ Compensation, the Contractor must comply with the Workers’ Compensation insurance requirements herein and provide the City with a certificate of insurance. Professional/Technical (Errors and Omissions) Liability Insurance This policy will provide coverage for all claims the Contractor may become legally obligated to pay resulting from any actual or alleged negligent act, error, or omission related to Contractor’s professional services required under the contract. Contractor is required to carry the following minimum limits: $1,000,000 – per claim or event $2,000,000 – annual aggregate Any deductible will be the sole responsibility of the Contractor and may not exceed $50,000 without the written approval of the City. If the Contractor desires authority from the City to have a deductible in a higher amount, the Contractor shall so request in writing, specifying the amount of the desired deductible and providing financial documentation by submitting the most current audited financial statements so that the City can ascertain the ability of the Contractor to cover the deductible from its own resources. The retroactive or prior acts date of such coverage shall not be after the effective date of this Contract and Contractor shall maintain such insurance for a period of at least three (3) years, following completion of the work. If such insurance is discontinued, extended reporting period coverage must be obtained by Contractor to fulfill this requirement. The Contractor’s insurance must be “Primary and Non-Contributory”. All insurance policies (or riders) required by this Contract shall be (i) taken out by and maintained with responsible insurance companies organized under the laws of one of the states of the United States and qualified to do business in the State of Minnesota, (ii) shall name the City, its employees and agents as additional insureds (CGL and umbrella only) by endorsement which shall be filed with the City. A copy of the endorsement must be submitted with the certificate of insurance. Contractor’s policies and Certificate of Insurance shall contain a provision that coverage afforded under the policies shall not be cancelled without at least thirty (30) days’ advanced written notice to the City, or ten (10) days’ notice for non-payment of premium. An Umbrella or Excess Liability insurance policy may be used to supplement Contractor’s policy limits on a follow-form basis to satisfy the full policy limits required by this Contract. Page 390 of 899 4 237432v1 10. INDEPENDENT CONTRACTOR. The City hereby retains Contractor as an independent contractor upon the terms and conditions set forth in this Agreement. Contractor is not an employee of the City and is free to contract with other entities as provided herein. Contractor shall be responsible for selecting the means and methods of performing the work. Contractor shall furnish any and all supplies, equipment, and incidentals necessary for Contractor's performance under this Agreement. City and Contractor agree that Contractor shall not at any time or in any manner represent that Contractor or any of Contractor's agents or employees are in any manner agents or employees of the City. Contractor shall be exclusively responsible under this Agreement for Contractor's own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 11. SUBCONTRACTORS. With the exception of the individuals identified in the Proposal, Contractor shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Contractor shall comply with Minnesota Statutes §471.425. Contractor must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Contractor’s receipt of payment from City. Contractor must pay interest of one and five-tenths (1.5%) percent per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. ASSIGNMENT. Neither party shall assign this Agreement, nor any interest arising herein, without the written consent of the other party. 13. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 14. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 15. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Dakota County. 16. COPYRIGHT. Contractor shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. 17. PATENTED DEVICES, MATERIALS AND PROCESES. If the contract requires, or Contractor desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, Contractor shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, Contractor shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. Page 391 of 899 5 237432v1 18. RECORDS. Contractor shall maintain complete and accurate records of time and expense involved in the performance of services. 19. AUDIT DISCLOSURE AND DATA PRACTICES. Any reports, information, data, etc. given to, or prepared or assembled by the Contractor under this Agreement which the City requests to be kept confidential, shall not be made available to any individual or organization without the City’s prior written approval. The books, records, documents and accounting procedures and practices of the Contractor or other parties relevant to this Agreement are subject to examination by the City and either the Legislative Auditor or the State Auditor for a period of six (6) years after the effective date of this Agreement. This Agreement is subject to the Minnesota Government Data Practice Act, Minnesota Statutes Chapter 13 (Data Practices Act). All government data, as defined in the Data Practices Act Section 13.02, Subd. 7, which is created, collected, received, stored, used, maintained, or disseminated by Contractor in performing any of the functions of the City during performance of this Agreement is subject to the requirements of the Data Practice Act and Contractor shall comply with those requirements as if it were a government entity. All subcontracts entered into by Contractor in relation to this Agreement shall contain similar Data Practices Act compliance language. 20. NON-DISCRIMINATION. The Contractor agrees during the life of this Agreement not to discriminate against any employee, application for employment, or other individual because of race, color, sex, age, creed, national origin, sexual preference, or any other basis prohibited by federal, state, or local law. The Contractor will include a similar provision in all subcontracts entered into for performance of this Agreement. 21. TERMINATION OF THE AGREEMENT. The City may terminate this Agreement or any part thereof at any time, upon written notice to Contractor, effective upon delivery including delivery by facsimile or email. In such event, Contractor will be entitled to compensation for work performed up to the date of termination based upon a pro rata basis. 22. NOTICES. All notices, demands or requests required or permitted to be made pursuant to or under this Agreement must be in writing and deemed valid if sent by registered mail, return receipt requested, or delivered by overnight delivery service providing written evidence of delivery, or by hand delivery by a reputable independent courier providing written evidence of delivery, addressed as follows: CITY: City of Lakeville 20195 Holyoke Avenue Lakeville MN 55044 Attention: City Administrator CONTRACTOR: Rachel Contracting, LLC 4180 Napier Court, N.E. St. Michael, MN 55376 Attention: ____________ Either party may change the designated recipient of notice by so notifying the other party in writing. [Remainder of page intentionally left blank] [Signature pages to follow] Page 392 of 899 6 237432v1 IN WITNESS WHEREOF, the parties have executed this Agreement on the date first above written. By the signature of its representative below, each party affirms that it has taken all necessary action to authorize said representative to execute the Agreement. CITY OF LAKEVILLE BY: _______________________________________ Luke M. Hellier, Mayor AND Ann Orlofsky, City Clerk RACHEL CONTRACTING LLC BY: Print Name:___________________________ ITS:_______________________________________ Page 393 of 899 701 XENIA AVENUE S | SUITE 300 | MINNEAPOLIS, MN | 55416 | 763.541.4800 | WSBENG.COM October 1, 2025 Zach Johnson, P.E. City Engineer, City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Re: Letter of Recommendation Lakeville CP 25-18 Abatement & Demolition Project 17622 Dodd Boulevard Lakeville, MN 55044 Dear Mr. Johnson: Bids were opened for the above-referenced project on September 30, 2025. Seven bids were received. The bids were checked for mathematical accuracy and tabulated. Please find enclosed the bid abstract indicating the low bid as submitted by Rachel Contracting, LLC (Rachel) of St. Michael, Minnesota in the amount of $74,280.00. We recommend that the City considers these bids and awards a contract in the amount of $74,280.00 to Rachel based on the results of the bids received. Sincerely, WSB Ben Fehr Project Manager Attachments Contractor Bid Abstract Page 394 of 899 Report Date Bid Release Bid Opening9/30/2025 9/8/2025 2025-09-30T20:00:00.000Z Line Number Description Unit Quantity Price Total Price Total Price Total Price Total Price Total Price Total Price Total11HAZARDOUS WASTE REMOVAL (ASBESTOS AND OTHER HAZARDOUS MATERIALS) (P)LS 1 $19,170.00 $19,170.00 $16,250.00 $16,250.00 $17,780.00 $17,780.00 $18,837.44 $18,837.44 $21,260.00 $21,260.00 $20,470.00 $20,470.00 $25,000.00 $25,000.0022BUILDING DEMOLITION, UST REMOVAL, SEPTIC SYSTEM REMOVAL (TWO), AND SITE RESTORATION (P)LS 1 $55,110.00 $55,110.00 $62,250.00 $62,250.00 $63,200.00 $63,200.00 $65,929.71 $65,929.71 $67,005.00 $67,005.00 $78,000.00 $78,000.00 $106,000.00 $106,000.00$74,280.00 $78,500.00 $80,980.00 $84,767.15 $88,265.00 $98,470.00 $131,000.00Urban Companies LLCContract Abatement & Demolition Project - 17622 Dodd Boulevard - Bid AbstractRachel Contracting, LLC JM Hauling LLC Veit & Company, Inc. Frattalone Companies Lloyd's Construction Services, Inc. Ramsey CompaniesPage 395 of 899 Date: 10/6/2025 Supplemental Agreement with Bolton & Menk for Professional Services for Platting of 17622 Dodd Boulevard Proposed Action Staff recommends adoption of the following motion: Move to approve Bolton & Menk supplemental agreement for professional services for platting of 17622 Dodd Boulevard, City Project 25-18. Overview The City Council approved a purchase agreement to acquire the property at 17622 Dodd Boulevard on June 2, 2025. The City closed on the property on June 27, 2025, and the seller has vacated the site. Site planning of the property to optimize its highest and best use, including a potential fire station, satellite water treatment plant and public works facilities is underway. To facilitate redevelopment, the multiple City-owned parcels within and adjacent to 17622 Dodd Boulevard will be preliminary and final platted. Bolton & Menk's proposed tasks include completion of a) a tree survey, b) an administration subdivision and certificate of survey, c) a preliminary plat, and d) a final plat. Bolton & Menk's supplemental agreement identifies the scope of services and estimated cost to provide surveying services for City Project 25-18, and is subject to the Master Services Agreement dated September 20, 2021. Supporting Information 1. 2025.09.22 BMI SA Financial Impact: $35,725 Budgeted: Yes Source: Multiple Sources Envision Lakeville Community Values: Design that Connects the Community Report Completed by: Zach Johnson, City Engineer Page 396 of 899 Submitted by Bolton & Menk, Inc. Platting | City of Lakeville 1 N:\Proposals\$Survey\Burnsville\2025\City\Lakeville\Dodd Blvd ALTA\Platting\BMI Proposal (Plat)_r2.docx September 22, 2025 Zach Johnson, P.E. City Engineer City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 RE: Administrative Subdivision, Preliminary Plat, Tree Survey and Final Plat Address: 17622 Dodd Boulevard, Lakeville, MN 55044 (Parcel ID: 22-00900-79-011 & 22-73370-00-070) 7570 – 179th Street W., Lakeville, MN 55044 (Parcel ID: 22-00900-81-010) Dear Mr. Johnson: The City of Lakeville has requested a scope of services and budget for providing an Administrative Subdivision, Preliminary Plat, Tree Survey and Final Plat on the above-described property. Bolton & Menk, Inc. takes great pride in providing survey services thoroughly, accurately, and efficiently. Our approach to surveying services makes City of Lakeville’s priorities our priorities. We understand what needs to be accomplished for the successful completion of project. We propose to perform the field work with survey staff in our Burnsville office. All work will be managed and supervised by a licensed land surveyor. Bolton & Menk, Inc. puts a high priority on ensuring our efforts are consistent with your needs. Please review the attached documents. If you have any questions, concerns, or comments regarding this proposal, please call me at 952-890-0509 Ext. 2509 or email at Eric.Wilfahrt@bolton-menk.com. Sincerely, BOLTON & MENK, INC. Eric Wilfahrt, L.S. Principal Survey Manager Attachments: Scope of Work Budget (2 pages) Survey Limits (1 page) Tree Services Scope of Work (1 page) Page 397 of 899 Submitted by Bolton & Menk, Inc. Platting | City of Lakeville 2 N:\Proposals\$Survey\Burnsville\2025\City\Lakeville\Dodd Blvd ALTA\Platting\BMI Proposal (Plat)_r2.docx SCOPE OF WORK (Note: See survey limits herein) Administrative Subdivision: • Complete a Certificate of Survey conforming to the 2025 City of Lakeville Administrative Subdivision Checklist for Address: 7570 – 179th Street W., Lakeville, MN 55044 (Parcel ID: 22-00900-81-010) • The Administrative Subdivision is to subdivide Address: 7570 – 179th Street W., Lakeville, MN 55044 (Parcel ID: 22-00900-81-010) into two parcels, one lying northerly and one lying southerly of the south right-of-way line of 179th Street W. Tree Survey: • See included Tree Services Scope of Work Preliminary Plat: • Complete a Preliminary Plat per the City of Lakeville code requirements. Final Plat: • Complete a Final Plat per the City of Lakeville code requirements. • Prepare final mylar copies for recording • Lot Monuments DELIVERABLES We will furnish an electronic PDF copy of the Administrative Subdivision Certificate of Survey and Preliminary Plat along with final mylar of the Final Plat. Paper copies can be furnished upon request. ASSUMPTIONS This proposal is based upon the following assumptions: • City of Lakeville will provide a current title commitment and supporting documents to Bolton & Menk, Inc. • City of Lakeville will complete and submit the application and pay any fees associated with the Administrative Subdivision. • No vertical data is required to be shown on the Administrative Subdivision Certificate of Survey. • Trees will not be located for the Administrative Subdivision. • As-built data will be used to determine pipe invert, size and type within any structures that would require traffic control due to unsafe conditions along 179th Street W. and C.S.A.H. No. 23 (Cedar Avenue) • Bolton & Menk, Inc. maintains professional services and Errors and Omissions insurance. A certificate of insurance can be provided upon request. • The fee included in this proposal allows for one client requested revised survey. If an additional field visit is required for said request, there will be an additional fee to be agreed upon between Bolton & Menk, Inc. and City of Lakeville prior to completing said request. Time is not included for surveyor to address Proforma Title Commitments. Any additional revisions shall be considered “Additional Services” and will be invoiced on an hourly basis in addition to the stated fee arrangement. • Title issues that may arise (gaps/overlaps, poor legal description, etc.) shall be considered “Additional Services” and will be invoiced on an hourly basis in addition to the stated fee arrangement. • Only utilities that are marked in the field along with utility maps provided by utility companies will be graphically shown on the survey map. The proposed costs are based on assumption that field markings by utilities will be made within the time allotted for such requests through Gopher State One Call. No allowance has been included if return trips to the site are required to locate delayed utility markings. If required, an additional trip will be invoiced on an hourly basis in addition to the stated fee arrangement. Page 398 of 899 Submitted by Bolton & Menk, Inc. Platting | City of Lakeville 3 N:\Proposals\$Survey\Burnsville\2025\City\Lakeville\Dodd Blvd ALTA\Platting\BMI Proposal (Plat)_r2.docx FEES Bolton & Menk, Inc.’s hourly not-to-exceed fee is $35,725. Scope of Services Administrative Subdivision Certificate of Survey $10,875 Tree Survey $2,600 Preliminary Plat $16,000 Final Plat (includes $1,375 County plat checking fee & $400 mylar fee) $6,250 SCHEDULE Bolton & Menk, Inc. has the staff to meet any reasonable time frame required. APPROVALS AND SIGNATURES City of Lakeville (Client) acknowledges that it is the client of the property described above or is a legally authorized representative of the property client with sufficient interest and authority to enter into this agreement for the purposes of making improvements to and upon the property. Bolton & Menk, Inc. and Client agree to the Scope of Work as stated. The undersigned represents that it is the Client or has been authorized to accept this Agreement on behalf of Client. Unless also executed by a person(s) or firm guaranteeing payment, the undersigned accepts financial responsibility for all services and costs of collection incurred by Bolton & Menk including reasonable attorney’s fees, in the event of default by Client. Accepted by: Print Name/Title Signature and Date I/We personally guarantee payment of all obligations for services to be provided by Bolton & Menk, Inc. under this Agreement. I/We further agree to pay all costs of collection incurred by Bolton & Menk, Inc., including reasonable attorney’s fees. Print Name/Title Signature and Date Page 399 of 899 Page 400 of 899 City of Lakeville – 17622 Dodd Boulevard & part of 7570 – 179th Street W. Tree Services – 9/12/2025 Bolton & Menk, Inc has been asked to prepare a scope of work for tree services for the City of Lakeville property at 17622 Dodd Boulevard and part of 7570 – 179th Street W. in Lakeville, MN. As such, we will complete the following task: Task 1 – Tree Inventory and Datasheet: Using an ISA Certified Arborist/Minnesota Certified Tree Inspector, we will perform a tree inventory of all trees found within the property located at 17622 Dodd Boulevard including the portion of city owned land directly south of 17622 Dodd Boulevard and north of south right-of-way line of 179th Street W. being part of 7570 – 179th Street W. According to the City of Lakeville Municipal Code Section 11-21-11. E, we will document the size, species, general condition, and location of all significant and heritage trees located within the property. The inventory will be completed using Juniper Geode sub-foot GPS units. The ArcGIS Field Maps software will be used to collect the necessary data to provide the City of Lakeville with a complete tree inventory of the required trees within the inventory areas. Our arborist/inspector will begin by attaching an identification tag and recording the location, size, species, and health condition of each significant tree. The inspector will describe the condition of each tree as Good, Fair, Poor, or Dead based on their current condition. Trees exhibiting signs of disease and/or infestation will be noted. Using the data collected, we will develop a tree inventory map and tree datasheet. The tree inventory and map datasheet will include the location, species, size, and condition of each significant and heritage tree. As such, our proposal for tree services is as follows: Task 1 – Tree Inventory and Datasheet……………………………………….20hrs @$130 - $2,600 Page 401 of 899 Date: 10/6/2025 Marketplace At Cedar Final Plat Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution approving the Marketplace at Cedar final plat. Overview Oppidan Investment Company has submitted an application for a final plat to be known as Marketplace at Cedar for nine commercial lots and three outlots. The property to be platted is located south of 179th Street (CSAH 9), east of Cedar Avenue (CSAH 23), and west of Glacier Way. The platted lots will be sold for the development of a variety of commercial uses. Outlots A and B will be retained by the current property owners for future development. Staff is still working with the Developer and Property Owner on details of the Development Contract and Stormwater Maintenance Agreements. The final plat resolution includes a stipulation that approval of the plat is contingent upon City Council approval of the Development Contract and Stormwater Maintenance Agreements at a future meeting. Supporting Information 1. Final Plat Resolution 2. Planning and Engineering reports Financial Impact: $0 Budgeted: No Source: Envision Lakeville Community Values: Report Completed by: Kris Jenson, Planning Manager Page 402 of 899 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 25-______ RESOLUTION APPROVING THE MARKETPLACE AT CEDAR FINAL PLAT WHEREAS, the owner of the property described as MARKETPLACE AT CEDAR has requested final plat approval; and WHEREAS, the preliminary plat was reviewed by the Planning Commission and the Parks, Recreation and Natural Resources Committee and approved by the City Council; and WHEREAS, the final plat is consistent with the preliminary plat; and WHEREAS, the final plat is acceptable to the City; NOW THEREFORE BE IT RESOLVED by the Lakeville City Council: 1. MARKETPLACE AT CEDAR final plat is approved subject to City Council approval of the development contract, stormwater maintenance agreements, and security requirements. 2. The Mayor and City Clerk are hereby authorized to sign the final plat mylars. 3. The City Clerk is directed to file a certified copy of this resolution with the Dakota County Recorder. Page 403 of 899 2 ADOPTED by the Lakeville City Council this 6th day of October 2025. CITY OF LAKEVILLE Luke M. Hellier, Mayor ATTEST: _______________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) CITY OF LAKEVILLE ) I hereby certify that the foregoing Resolution No. 25-____is a true and correct copy of the resolution presented to and adopted by the City Council of the City of Lakeville at a duly authorized meeting thereof held on the 6th day of October 2025 as shown by the minutes of said meeting in my possession. __________________________ Ann Orlofsky City Clerk (SEAL) Drafted By: City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Page 404 of 899 1 City of Lakeville Community Development Memorandum To: Tina Goodroad, Community Development Director From: Kris Jenson, Planning Manager Date: September 4, 2025 Subject: Marketplace At Cedar Final Plat Application Action Deadline: September 21, 2025 INTRODUCTION Oppidan Investment Company has submitted an application and plans for the final plat of Marketplace At Cedar, which includes nine commercial lots located east of Cedar Avenue (CSAH 23) and south of 179th Street (CSAH 9). The preliminary plat was approved by the City Council on March 17, 2025. The lot, block and street design of the Marketplace At Cedar final plat is consistent with the approved preliminary plat. The final plat plans have been reviewed by Engineering and Parks and Recreation staff. EXHIBITS A. Location Map B. Preliminary Plat C. Final Plat D. April 24, 2025 Plat Commission letter PLANNING A NALYSIS Existing Conditions. The Marketplace At Cedar final plat area consists of one parcel, which was previously used for agricultural purposes (Exhibit A). Zoning. The zoning of the overall Marketplace At Cedar development is M-2, Mixed Use Cedar Corridor District. Page 405 of 899 2 LOT REQUIREMENTS Lot Area. There is no minimum area requirement for lots within the M-2 District. Lot Width. There in no minimum width requirement for lots in the M-2 District. Setbacks. Setback requirements for lots in the M-2 District are outlined below: Front Side Rear Yards abutting a major collector or arterial street 10 feet 10 feet 10 feet 30 feet Outlots. There are three outlots proposed with the Marketplace At Cedar final plat. Outlot A is 6.55 acres in area and will be retained by the property owner for future development. Outlot B is 9.34 acres in area and will be retained by the property owner for future development. Outlot C is 0.43 acres in area and will be deeded to the City for stormwater purposes. Access. Marketplace At Cedar will have access from Cedar Avenue (CSAH 23), 179th Street (CSAH 9), and Glacier Way. An ingress-egress easement for shared access to Lots 1-9, Block 1 is required to be recorded in conjunction with the final plat. Streets & Right-of-Way. Marketplace At Cedar is adjacent to and will include the construction of the following streets: Cedar Avenue (CSAH 23) is a minor arterial highway located west of and adjacent to the Marketplace At Cedar final plat. The Developer is dedicating the necessary right of way per the Dakota County Plat Needs Map. 179th Street (CSAH 9) is a minor arterial highway located north of and adjacent to the Marketplace At Cedar final plat. The Developer is dedicating the necessary right of way per the Dakota County Plat Needs Map. With the Marketplace At Cedar development, a traffic signal will be required at the intersection of 179th Street and Glacier Way. See the August 26, 2025 Engineering memo for more information. Glacier Way is east of the Marketplace At Cedar site and identified as a minor collector street in the City’s Transportation Plan. Glacier Way will provide full access to 179th Street. Glanshaw Avenue will be a local 36-foot-wide street within a 60-foot right of way. A five-foot-wide sidewalk will be constructed on north and west sides of Glanshaw Avenue. Sidewalk on the south and east sides of the street will be constructed when Outlot B is final platted into lots and blocks. Dakota County Plat Commission. The Marketplace At Cedar final was reviewed at the Plat Commission’s August 13, 2025 meeting, where the Marketplace At Cedar final plat was recommended for approval. Page 406 of 899 3 Trails. The developer will construct a 10-foot-wide bituminous trail along the south side of 179th Street from Cedar Avenue to Glacier Way. There is an existing bituminous trail along the east side of Cedar Avenue, between 179th Street and 181st Street. Landscaping. There is no landscaping proposed with the Marketplace At Cedar final plat. All landscaping on site will be installed as part of the development of the individual lots. Park Dedication. The City’s Parks Trails and Open Space Plan does not identify a future neighborhood park within the Marketplace At Cedar plat boundary, so the park dedication requirement will be satisfied through cash contribution of $126,612.72. See the August 26, 2025 engineering memo for more details. Tree Preservation. There are no trees proposed to be removed within the development of this site. All significant trees are located along the south property line, within Outlots A and B and no grading or other site work is proposed in those areas. Wetlands. A wetland delineation was completed for the site on November 11, 2024. There are two small wetlands on the site, one of which will be completely impacted and replaced with wetland banking credits. See the August 26, 2025 Engineering memo for more information. Grading, Drainage and Erosion Control. The final plat includes grading, drainage and erosion control plans. Grading, drainage and erosion control is discussed in more detail in the August 26, 2025 Engineering memo. RECOMMENDATION The Marketplace At Cedar final plat is consistent with the approved preliminary plat and complies with the requirements of the Zoning and Subdivision Ordinances. Community Development Department staff recommends approval of the Marketplace At Cedar final plat subject to the following conditions: 1. The recommendations listed in the August 26, 2025 Engineering memo. 2. A five-foot-wide concrete sidewalk shall be constructed along one side of Glanshaw Avenue at the developer’s expense as shown on the approved final plat plans. 3. The developer shall construct a 10-foot-wide bituminous trail along the south side of 200th Street, between Cedar Avenue (CSAH 23) and Glacier Way. The developer will receive a credit for the City’s 3/8ths portion of the trail, excluding grading and restoration, with the final plat. 4. The developer shall pay $126,612.72 in park dedication fees with the final plat. Page 407 of 899 Dakota County, Maxar, Microsoft±CEDAR AVENUE (CSAH 23)DODD BLV D 179TH ST (CSAH 9) 181ST ST G L A S GOW AVE Marketplace at Cedar City of Lakeville Marketplace at Cedar Final Plat Location Map EXHIBIT AGERDINE PATHPage 408 of 899 BENCHMARK HYDRANT G G GM G G G G FO G G G FOFOV Gas Pump S. Line - SW 1/4 Sec. 10-114-20SW Cnr - SW 1/4 Sec. 10-114-20 METROPOLITAN COUNCILVU FOFO FOG G VVElectric Easement per Document No. 16666401/2" Iron RLS 44076 1/2" Iron Capped/Tipped 1/2" Iron RLS 57366 1/2" Iron RLS 57366 1/2" Iron RLS 44110 1/2" Iron RLS 44110 WET W E T WETWETWET179th STREET W.GLACIER WAYGLACIER WAYGLANSHAW AVECEDAR AVEWETWETWETTHE EDISON AT AVONLEA (APARTMENTS) KJPL AVONLEA LLC EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB EX-SB 9 108,321 SQ FT 2.49 AC 7 56,611 SQ FT 1.30 AC OUTLOT A 37,091 SQ FT 0.85 AC 4 46,524 SQ FT 1.07 AC 3 42,072 SQ FT 0.97 AC 2 48,581 SQ FT 1.12 AC 8 65,718 SQ FT 1.51 AC 1 51,057 SQ FT 1.17 AC 5 31,831 SQ FT 0.73 AC 6 48,937 SQ FT 1.12 AC OUTLOT B 19,654 SQ FT 0.45 AC OUTLOT D OUTLOT E 60'60'291,757 SQ FT 6.70 AC 407,025 SQ FT 9.34 AC OUTLOT C 18,786 SQ FT 0.43 AC5'10'10' 30'10'10' 30'10'30'10' 10' CEDAR AVENUE (CSAH 23) ROW 25,145 SQ FT 0.58 AC GLANSHAW AVENUE ROW 67,994 SQ FT 1.56 AC 179TH STREET W. ROW 17,090 SQ FT 0.39 AC 30'29676 PPLAT DATE REVISION SCHEDULE DESCRIPTION BY SHEET TITLE PROJECT WITHOUT PRIOR WRITTEN CONSENT. INC. AND MAY NOT BE USED, COPIED OR DUPLICATED THIS DOCUMENT IS THE PROPERTY OF I & S GROUP, PROJECT NO. FILE NAME DESIGNED BY ORIGINAL ISSUE DATE DRAWN BY CLIENT PROJECT NO. REVIEWED BY DWG LOCATION: S:\PROJECTS\29000 PROJ\29600-29699\29676 LAKEVILLE RETAIL DEVELOPMENT-LAKEVILLE MN\29676 PRODUCTION FILES\29676 CIVIL 3D\SURVEY PRODUCTION DWGS\29676 PPLAT.DWG SAVED BY: DAYTON.GONYEASHEET NOT VALID UNLESS THIS TEXT IS COLOR. C1-20 - 01/28/25 23-29676 C1-20 PRELIMINARY PLAT ---- ---- C1-20 LAKEVILLE MINNESOTA PRELIMINARY PLAT 0 SCALE IN FEET 60 120 BDT/DWG/LMM BDT/DWG/LMM/MC MC, JF MARKETPLACEAT CEDAR PRELIMINARY NOT FOR CONSTRUCTION PRELIMINARY NOT FOR CONSTRUCTIONPLOT DATE: 1/28/2025 10:30 AMBUILDING SETBACK (TYP)PARKING SETBACK (TYP)PROPOSED PROPERTY LINE (TYP) PROPOSED RIGHT-OF-WAY DEDICATION (TYP) EXISTING PROPERTY LINE GLANSHAW AVE RIGHT-OF-WAY DEDICATION DRAINAGE & UTILITY EASEMENT (TYP) (1)GROSS AREA (ACRES)31.72 (2)NET DEVELOPABLE AREA (ACRES)28.08 (3)COMPREHENSIVE PLAN --LAND USE DESIGNATION CORRIDORMIXED USE (4) EXISTING ZONING M-2 PROPOSED ZONING N/A (5)GROSS UNIT DENSITY N/A (6)NET UNIT DENSITY N/A (7)ROW (ACRES)3.04 (8)WETLAND (ACRES)0.60 (9) OUTLOT AREA (ACRES) A 0.85 B 0.45 C 0.43 D 6.70 E 9.34 NOTE: NO MINIMUM LOT AREA AND NO MINIMUM LOT WIDTH IS REQUIRED PER SECTION 10-3-2.C ABUTTING PROPERTIES COMPREHENSIVE PLAN & ZONING DIRECTION LAND USE PLAN ZONING MAP EAST MDR RM-3 DISTRICT NORTH COMMERCIALHDR PUD DISTRICT WEST PUBLIC/QUASI PUBLIC POS DISTRICT SOUTH PUBLIC/QUASI PUBLIC POS DISTRICT HDR PUD DISTRICT TEMPORARY DRAINAGE EASEMENT EXHIBIT B Page 409 of 899 BLOCK 1 GLANSHAWAVENUE GLANSHAWAVENUE(COUNTY STATE AID HIGHWAY NO. 9 (17 9 T H S T R E E T W E S T ) S84°53'17"E 93.28 L = 4 8 0 . 3 3 R= 5 6 0 . 0 0Δ=49°08'41"S01°02'32"E 171.75173.64 S88°57'28"W 440.36 COUNTY STATE AIDHIGHWAYNO. 23 (CEDAR AVENUE)S00°52'57"E 281.871/2" Iron RLS 44076 1/2" Iron RLS 57366 1/2" Iron Capped/Tipped 1/2" Iron RLS 57366 1/2" Iron RLS 57366 1/2" Iron RLS 57366 1/2" Iron RLS 44110 S. Line - SW 1/4 Sec. 10-114-20 SW CNR- SW 1/4 SEC. 10-T114N-R20W DAKOTA COUNTY MAG NAIL WITH DISK S88°57'28"W 408.92 N88°57'28"E 430.46 70.61329.85 1816 161728 382828 17 1825149.4740.00 266.6010.0025.00170.7630 S01°02'05"E70.11S01°02'05"E125.33S01°02'05"E114.81S88°57'55"W22.33 N88°57'55"E20.181525 N73°00'15" E55.00 N88°57'24"E58.11 DRAINAGE AND UTILITY EASEMENT DRAINAGE AND UTILITY EASEMENT S88°57'28"W 292.88 N46°02'32"W28.28 N01°02'32"W 245.40N43°57'28"E 28.28 N88°57'28"E 292.88 17S88°57'28"W72.56 S88°57'28"W125.94 S43°57'28"W28.28 S01°02'32"E 245.40S46°02'32"E28.28 N89°07'03"E66.14 L=72.42R=182.00Δ=22°47'50" C.Brg=S79°29'02 "E C.=71.94 18100.0025.00 25.00 DRAINAGE AND UTILITY EASEMENT 63.1630.12 S84°53'17"E 93.28 DRAINAGE AND UTILITY EASEMENT 60 60 6060N89°47'08"E75.00 101010101010101010101010N01°02'36"W 626.41187.60 S01°02'32"E 271.95N88°57'24"E 1126.82 130.50 159.54 29.21 166.19 183.52S00°52'57"E 171.75101.71S88°54'20"W 64.07 287.66 S01°02'34"E 183.52152.19288.17 152.19 S1° 02' 36"E 217.9373.4019.40L=131.31Δ=17°05'58"64.10S67°57' 0 5" W L=82.55 R=200.00 Δ=23°38'58" 20.94N67° 1 3 ' 5 9 " W L=83.11 R=200.00 Δ =23°48'33" 80.04N01°02'32"W 320.4030.00 320.40N00°52'57"W 628.60N88°57'28"E 381.75 75.22 N67°57' 0 5" EL=60.05R=440.00Δ= 7 ° 4 9 ' 0 9 " S87°12'16"W 181.88 S00°53'21"E 99.19574.43 L=11.60 Δ=1°11'13"S0° 53' 01"E95.78181.9034.06S00°52'57"E 687.74S89° 47' 08"W 1495.45N01°02'36"W 372.13173.64 S88°57'28"W 162.85 183.52654.1125.00 60.00 N88°57'24"E 1151.82 S01°02'36"E 641.41271.95328.88 279.78407.96L=60.05Δ=7°49'09" L = 1 8 4.8 2 Δ = 2 4 ° 0 3'5 9 " L =46 8.73Δ=47°57'29" S88°57'28"W 328.88 187.59 N89°07'03"E66.19 15.00 S01°02'32"E 275.09S01°02'33"E 271.955555555 5 5 5 555 5 5 5 5 5 10 10 551 8 7 4 9 65 32 15OUTLOT B OUTLOT C OUTLOT A EXISTING DAKOTA COUNTY TRAIL, DRAINAGE AND UTILITY EASEMENT EXISTING DAKOTA COUNTY TRAIL, DRAINAGE AND UTILITY EASEMENT DRAIN A G E A N D U T I L I T Y E A S E M E N T 1010180 SCALE IN FEET 60 120 MARKETPLACE AT CEDAR SHEET 2 OF 2 SHEETS IRON MONUMENT FOUND INDICATES MAG NAIL FOUND INDICATES 1/2" X 18" LONG SOLID IRON PIPE SET WITH PLASTIC CAP MARKED BY ISG, LICENSE NO. 45817 TO BE SET BEFORE TIME OF RECORDING. INDICATES 1/2" X 18" LONG SOLID IRON PIPE SET WITH PLASTIC CAP MARKED BY ISG, LICENSE NO. 45817 TO BE SET WITHIN ONE YEAR OF RECORDING. INDICATES MAG NAIL SET DENOTES RESTRICTED ACCESS TO DAKOTA COUNTY PER THE DAKOTA COUNTY CONTIGUOUS PLAT ORDINANCE LEGEND BEARING NOTE: ORIENTATION OF THIS BEARING SYSTEM IS BASED UPON THE SOUTH LINE OF THE SOUTHWEST QUARTER OF SECTION 10, TOWNSHIP 114 NORTH, RANGE 20 WEST WHICH IS ASSUMED TO BEAR SOUTH 89 DEGREES 47 MINUTES 08 SECONDS WEST. EXHIBIT C Page 410 of 899 Dakota County Surveyor’s Office Western Service Center  14955 Galaxie Avenue  Apple Valley, MN 55124 952.891 -7087  Fax 952.891 -7127  www.co.dakota.mn.us August 15, 2025 City of Lakeville 20195 Holyoke Ave. Lakeville, MN 55044 Re: MARKETPLACE AT CEDAR The Dakota County Plat Commission met on August 13, 2025, to consider the final plat of the above referenced plat. The plat is adjacent to CSAH 23 (Cedar Ave.) and CSAH 9 (179th St. W.) and is therefore subject to the Dakota County Contiguous Plat Ordinance. The proposed final plat includes retail development on the north portion of the Devney property with two future outlots on the south portion of the property. The right-of-way needs along CSAH 23 are 100 feet of half right of way, which is shown on the plat. The right-of-way needs along CSAH 9 (179th Street) are 75 feet of half right of way, which is shown on the plat. There is one access shown on CSAH 9 (179th Street) between Glacier Way and CSAH 23 as a right-in only access. As noted, with the existing median opening at this location, the right-in only access should be modified and reviewed by the County design team to limit left turn movements and cross traffic from Cub Foods into the development. There is one right-in/right-out access along CSAH 23, which does not meet access spacing guidelines; however, the traffic study did show a benefit to the county road system with the existing conditions/traffic along CSAH 9 (179th Street). Restricted access should be shown along all of CSAH 23 except for one access opening and all along CSAH 9 except for one access opening. A quit claim deed to Dakota County is required for access restriction along CSAH 23 and CSAH 9 at the time of recording the plat mylars. The Plat Commission has approved the final plat provided that the described conditions are met and will recommend approval to the County Board of Commissioners meeting on September 9, 2025. Traffic volumes on CSAH 23 and CSAH 9 are 21,800 and to be determined ADT, respectively, and are anticipated to be 39,000 and to be determined ADT by the year 2040. No work shall commence in the County right of way until a permit is obtained from the County Transportation Department and no permit will be issued until the plat has been filed with the County Recorder’s Office. The Plat Commission does not review or approve the actual engineering design of proposed accesses or other improvements to be made in the right of way. Nothing herein is intended to restrict or limit Dakota County’s rights with regards to Dakota County rights of way or property. The Plat Commission highly recommends early contact with the Transportation Department to discuss the permitting process which reviews the design and may require construction of highway improvements, including, but not limited to, turn lanes, drainage features, limitations on intersecting street widths, medians, etc. EXHIBIT D Page 411 of 899 Please contact TJ Bentley regarding permitting questions at (952) 891-7115 or Todd Tollefson regarding Plat Commission or Plat Ordinance questions at (952) 891-7070. Sincerely, Todd B. Tollefson Secretary, Plat Commission c: Jay Moore, Oppidan and Mitchell Cookas, ISG Inc. Page 412 of 899 City of Lakeville Public Works – Engineering Division Memorandum To: Kris Jenson, Planning Manager From: Jon Nelson, Assistant City Engineer McKenzie L. Cafferty, Environmental Resources Manager Joe Masiarchin, Parks and Recreation Director Copy: Zach Johnson, City Engineer Julie Stahl, Finance Director Dave Mathews, Building Official Tina Goodroad, Community Development Director Date: August 26, 2025 Subject: Marketplace At Cedar • Final Plat Review • Grading and Erosion Control Plan Review • Tree Preservation Review • Utility Plan Review BBAACCKKGGRROOUUNNDD Oppidan Investment Company has submitted a final plat application named Marketplace At Cedar. The preliminary plat was approved by the City Council on March 17, 2025. The proposed subdivision is located north of 181st Street, west of and adjacent to Glacier Way, east of and adjacent to Cedar Avenue (CSAH 23), and south of and adjacent to 179th Street (CSAH 9). The parent parcel consists of one metes and bounds parcel (PID No. 220100051014) zoned M-2, Mixed Use Cedar Corridor District. The final plat consists of nine (9) commercial lots, and three (3) outlots on 31.78 acres. The Developer is dedicating 0.58 acres as Cedar Avenue (CSAH 23) right-of-way, 0.39 acres as 179th Street (CSAH 9) right-of-way. The outlots created with the final plat shall have the following use: Outlot A: Future development; to be retained by the developer (6.55 acres) Outlot B: Future development; to be retained by the developer (9.34 acres) Outlot C: Stormwater Management Basin; to be deeded to the city (0.43 acres) Page 413 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 22 OOFF 1100 The proposed development will be completed by: Developer: Oppidan Investment Company Engineer/Surveyor: ISG, Inc. SSIITTEE CCOONNDDIITTIIOONNSS The Marketplace At Cedar site consists of undeveloped agricultural land generally draining northwest to southeast. There is a property access on the west end of the site. There are existing trees on site that will remain in place. There is an existing storm sewer outlet on the southeast of the site. There are three existing water stubs to the site at the north, northeast and southeast of the site. There is one existing sanitary sewer stub to the site to the east. There is one wetland delineated on the site. There is an overhead high-voltage utility line on the west side of the site. Security will be held with the final plat for the removal of the existing driveway. EEAASSEEMMEENNTTSS The Developer shall provide a shared access easement over the private drives to each and every lot prior to recording of the final plat. The Developer shall provide a construction and public access easement over the sidewalk south of the plat boundary prior to recording of the final plat. SSTTRREEEETT AANNDD SSUUBBDDIIVVIISSIIOONN LLAAYYOOUUTT Cedar Avenue (CSAH 23) Marketplace At Cedar is located east of and adjacent to Cedar Avenue, a principal arterial roadway, as identified in the City’s Transportation Plan. Cedar Avenue is constructed as a four- lane divided urban roadway. The current Dakota County Plat Review Needs Map indicates a half right-of-way requirement of 100-feet and designates this roadway as a future six-lane urban divided roadway over its entire length adjacent to the plat. The Developer is dedicating the necessary right-of-way as shown on the final plat. The final plat was reviewed and recommended for approval by the Dakota County Plat Commission at their August 13, 2025 meeting. 179th Street (CSAH 9) Marketplace At Cedar is located south of and adjacent to 179th Street, a minor arterial roadway, as identified in the City’s Transportation Plan. 179th Street is constructed as a four- lane divided urban roadway. The current Dakota County Plat Review Needs Map indicates a half right-of-way requirement of 100-feet and designates this roadway as a four-lane urban divided roadway over its entire length adjacent to the plat. The Developer is dedicating the necessary right-of-way as shown on the final plat. The final plat was reviewed and recommended for approval by the Dakota County Plat Commission at their August 13, 2025 meeting. Page 414 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 33 OOFF 1100 A traffic signal installation is being triggered by the development of Marketplace At Cedar at the intersection of 179th Street and Glacier Way. The development is anticipated to increase traffic volumes by 22% at the P.M. peak hour of intersection operations based on the results of a Traffic Impact Study performed by ISG, Inc. The 2026 build conditions of Marketplace At Cedar show excessively high congestion created at the intersection. As a result – the city and county will be partnering for the installation of a signal system at the intersection of 179th Street and Glacier Avenue and include the improvement in the appropriate Capital Improvement Plans. The development will be responsible for a cash contribution for the anticipated increase in generated traffic to the intersection based on the results of the traffic impact study, calculated as follows: $600,000.00 X 22% = $132,000.00 Signal System Installation Cost Peak Hour Traffic Increase Generated Traffic Signal Cash Requirement Glanshaw Avenue Development of Marketplace At Cedar includes the construction of Glanshaw Avenue, a local roadway. The developer is dedicating the necessary 60-foot-wide right-of-way for the construction of a 36-foot-wide urban section with sidewalk on one side. Sidewalk shall be constructed on the other side of Glanshaw Avenue at the time Outlot B is final platted into lots and blocks. Glacier Way Marketplace At Cedar is located west of and adjacent to Glacier Way, a future minor collector roadway as identified in the City’s Transportation Plan. Glacier Way is currently constructed as a three-lane undivided urban roadway adjacent to the plat. Private Drives Development of Marketplace At Cedar includes the construction of a privately owned and maintained roadway network providing access to various commercial businesses. The Developer shall record a cross access easement over the private roadways to provide access to lots within the plat to Glanshaw Avenue at the time of recording the final plat, in a form approved by the City. The City shall not be responsible for any repairs (including cost) to the private roadways due to maintenance within the easement area. SSPPEECCIIAALL AASSSSEESSSSMMEENNTTSS Special assessment 221407 on the parent parcel for Marketplace At Cedar development for Glacier Way construction shall be be paid in full with the final plat. The assessment shall be paid off in accordance with the public improvement and special assessment agreement made on August 2nd, 2021 between the City of Lakeville and the Devney property. CCOONNSSTTRRUUCCTTIIOONN AACCCCEESSSS Construction traffic access and egress for grading, utility and street construction will be determined with each phase of construction. Page 415 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 44 OOFF 1100 PPAARRKKSS,, TTRRAAIILLSS,, AANNDD SSII DDEEWWAALLKKSS Development of Marketplace At Cedar includes the construction of public sidewalks. Five- foot-wide concrete sidewalks, with pedestrian curb ramps, will be installed along one side of Glanshaw Avenue from Glacier Way to 181St St W. The Developer shall receive a credit to the final plat cash fees for the sidewalk construction outside of the plat boundary. Developer shall obtain a public sidewalk easement over the property located at 7385 181st St West for the sidewalk to be located through the parcel on the west side of Glanshaw Avenue and obtain the necessary construction easement to construct the trail. The Developer shall construct a ten-foot-wide trail along the south side of 179th Street from Cedar Avenue to Glacier Way with the development of Marketplace At Cedar. The City will reimburse the Developer for 3/8th the cost of the trail adjacent to the plat, excluding grading and restoration. The developer shall receive a credit to the final plat cash fees for the City’s 3/8th share (excluding grading and restoration) of the trail construction costs for the trail along 179th Street. The Park Dedication requirement has not been collected on the parent parcels and will be satisfied through a cash contribution to be paid with the final plat, calculated as follows: Park Dedication Summary Gross Area of Marketplace At Cedar 31.78 ac. Less Area of Outlot A (Future Development) Less Area of Outlot B (Future Development) Less Area of right-of-way (-) 6.55 ac. (-) 9.34 ac. (-) 2.53 ac. Total Park Dedication Area = 13.36 ac. 13.36 acres x $9,477.00 = $126,612.72 Total Acreage Marketplace At Cedar 2025 Unit Rate (Commercial) Park Dedication Fee Marketplace At Cedar The Developer shall satisfy the park dedication requirement for Outlots A and B with subsequent phases of the Marketplace At Cedar preliminary plat at the time they are final platted into lots and blocks through a cash contribution at the rate in effect at the time of final plat approval. UUTTIILLIITTIIEESS SSAANN IITTAARRYY SSEE WWEERR Marketplace At Cedar is located within subdistricts NC-20360 and NC-20135 of the North Creek sanitary sewer district, as identified in the City’s Sanitary Sewer Comprehensive Plan. Development of Marketplace At Cedar includes the extension of public sanitary sewer. 8-inch sanitary sewer will be constructed within the subdivision. The wastewater from the development will be conveyed through sanitary sewer to the northern trunk monitored by Page 416 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 55 OOFF 1100 meter M643A and continue to the Empire Wastewater Treatment Facility. Publicly owned and maintained sanitary sewer will be constructed within Block 1, Marketplace At Cedar and placed within drainage and utility easements, all services off the mainline sewer shall be privately owned and maintained. The Sanitary Sewer Availability Charge has not been collected on the parent parcels and must be paid with the building permit application. The Sanitary Sewer Availability Charge for Outlot A and B will be collected with subsequent phases of the Marketplace At Cedar preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. WWAATTEERRMMAAIINN Development of Marketplace At Cedar includes the construction of public watermain. 8-inch watermain will be constructed within the subdivision from 8-inch watermain extended at the existing northern terminus of Glanshaw Avenue and an existing stub at Glacier Way and an existing stub at 179th Street. Publicly owned and maintained watermain will be constructed within Block 1, Marketplace At Cedar and placed within drainage and utility easements, all services off mainline watermain shall be privately owned and maintained. OOVVEERRHHEEAADD LLIINN EESS An overhead electric transmission line and poles are located along the west side of the parent parcel. The transmission line is a high voltage line and is therefore not required to be buried, consistent with the City’s Public Ways and Property Ordinance. DDRRAAIINNAAGGEE AANNDD GGRRAADDIINNGG Marketplace At Cedar is located within subdistricts FO-004, FO-012, and FO-044 of the Farmington Outlet stormwater district, as identified in the City’s Water Resources Management Plan. Development of Marketplace At Cedar includes the construction of one publicly-owned and maintained stormwater management basin and three privately-owned and maintained stormwater management basins to collect and treat the stormwater runoff generated from the site. The basins will ultimately outlet to the storm sewer in Glacier Way at the southeast of the site. The Developer shall enter into a stormwater maintenance agreement and grant a drainage and utility easement to the City over the private basins. All private basins included sump manholes within the development must be inspected and cleaned annually. Annual inspection reports must be submitted to the City. The public stormwater management basin will be located within Outlot C which is deeded to the City with the final plat. The stormwater management design is consistent with City ordinance requirements. The final grading plan shall identify all fill lots in which the building footings will be placed on fill material. The grading specifications shall also indicate that all embankments meet Page 417 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 66 OOFF 1100 FHA/HUD 79G specifications. The Developer shall certify to the City that all lots with footings placed on fill material are appropriately constructed. Building permits will not be issued until a soils report and an as-built certified grading plan have been submitted and approved by City staff. Marketplace At Cedar contains more than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. A copy of the Notice of Stormwater Permit Coverage must be submitted to the City upon receipt from the MPCA. SSTTOORRMM SSEEWWEERR Development of Marketplace At Cedar includes the construction of public storm sewer systems. Public storm sewer will be installed within the subdivision to collect and convey stormwater runoff generated from within the public right-of-way and lots to the public stormwater management basin located within Outlot C. Development of Marketplace At Cedar includes the construction of privately owned and maintained storm sewer. The private storm sewer shall be located within Block 1, Marketplace At Cedar. Developer shall establish a stormwater easement for the stormwater facility located within Lot 7, Block 1 for the benefit of Lots 5, 6, and 7, Block 1 at the time of recording the final plat in a form approved by the City. Developer shall establish a stormwater easement for the stormwater facility located within Lot 8, Block 1 for the benefit of Lots 1-4, 8 and 9, Block 1 at the time of recording the final plat in a form approved by the City. Draintile construction is required in areas of non-granular soils within Marketplace At Cedar for the street sub-cuts and lots. Any additional draintile construction, including perimeter draintile required for building footings, which is deemed necessary during construction shall be the developer’s responsibility to install and finance. The Storm Sewer Charge has not been collected on the parent parcels and is required with the final plat, calculated as follows: Storm Sewer Charge Summary Gross Area of Marketplace At Cedar Less Area of Outlot A (Future Development) 1,384,161.00 s.f. (-) 285,172.00 s.f. Less Area of Outlot B (Future Development) Less Area of Cedar Avenue and 179th Street right-of-way (-) 407,025.00 s.f. (-) 42,357.00 s.f. Total Storm Sewer Charge Area (Commercial) = 649,607.00 s.f. 649,607.00 s.f. x $0.250/s.f. = $162,401.75 Net Area Marketplace At Cedar 2025 Unit Rate (Commercial and Industrial) Storm Sewer Charge Marketplace At Cedar Page 418 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 77 OOFF 1100 The Developer shall satisfy the storm sewer charge requirement for Outlots A and B with subsequent phases of the Marketplace At Cedar preliminary plat at the time they are final platted into lots and blocks through a cash contribution at the rate in effect at the time of final plat approval. FEMA FLOODPLAIN ANALYSIS Marketplace At Cedar is shown on the Flood Insurance Rate Map (Map No. 27037C0204E; Eff. Date 12/2/2011) as Zone X by the Federal Emergency Management Agency (FEMA). Based on this designation, there are no areas in the plat located within a Special Flood Hazard Area (SFHA), as determined by FEMA. WWEETTLLAANNDDSS A wetland delineation was reviewed and approved for the site on November 11, 2024. The wetland delineation identified two wetlands on the site. Wetland A is a degraded farmed Type 1 wetland (0.52 acres) located on the north side of the site. Wetland B is a small Type 2 wetland (0.02 acres) located along Cedar Ave. The development plan is proposing to impact all of Wetland A. A TEP meeting was held to review the replacement plan application no comments were received. The replacement plan was approved February 12, 2025. The applicant will be replacing the impacted wetlands with wetland bank credits. No impacts to the wetland can take place until the city receives the approved wetland bank credit withdrawal form. A security of $65,000 will be held with the final plat until the City receives documentation that the credits have been purchased. TTRREEEE PPRREESSEERRVVAATTIIOONN No trees are proposed to be removed with the construction of Marketplace At Cedar. All “save” trees that are damaged or removed will require replacement at a ratio of 2:1 as per the Lakeville Subdivision Ordinance. Significant trees, as identified in the Lakeville Subdivision Ordinance, shall be protected and preserved through termination of all grading and construction activities. EERROOSSIIOONN CCOONNTTRROOLL The Developer is responsible for obtaining a MPCA Construction Permit for the site. Changes made throughout construction must be documented in the SWPPP. No grading can take place on the site until a complete SWPPP is submitted to the City for review and approval. Additional erosion control measures may be required during construction as deemed necessary by City staff. Any additional measures required shall be installed and maintained by the developer. Page 419 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 88 OOFF 1100 The MS4 Administration Fee has not been collected on the parent parcels and is required with the final plat, calculated as follows: $490,154.40 x 2% Grading Costs = $9,803.09 Grading Cost Marketplace At Cedar 2025 Rate MS4 Administration Fee Marketplace At Cedar SECURITIES The Developer shall provide a Letter of Credit as security for the Developer-installed improvements relating to Marketplace At Cedar. Construction costs are based upon a cost estimate submitted by the Developer’s engineer on July 21, 2025 (amended July 24, 2025). CONSTRUCTION COSTS Sanitary Sewer $ 177,104.55 Watermain 249,248.80 Storm Sewer 390,156.00 Streets 269,518.60 Grading, Drainage, Erosion Control and Restoration Wetland Mitigation Cedar Avenue and 179th Street Turn Lanes 153,525.40 65,000.00 107,884.01 SUBTOTAL - CONSTRUCTION COSTS $ 1,412,437.36 OTHER COSTS Developer’s Design (3.0%) $ 42,373.12 Developer’s Construction Survey (2.5%) 35,310.93 City’s Legal Expense (0.5%) 7,062.19 City Construction Observation (5.0%) 70,621.87 Developer’s Record Drawing (0.5%) Driveway Removal 7,062.19 5,000.00 Streetlights 7,400.00 Lot Corners/Iron Monuments 1,200.00 SUBTOTAL - OTHER COSTS $ 176,030.30 TOTAL PROJECT SECURITY $ 1,588,467.66 The street light security totals $7,400 which consists of one (1) mast-arm streetlight at $1,400 each and five (5) post-top streetlights at $1,200 each. The Developer shall post a security to ensure the final placement of iron monuments at property corners with the final plat. The security is $100.00 per lot and outlot for a total of $1,200.00. The City shall hold this security until the Developer’s Land Surveyor certifies that all irons have been placed following site grading, street, and utility construction. CASH FEES Page 420 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 99 OOFF 1100 A cash fee of $8,675.00 for traffic control signs shall be paid with the final plat. If street signs are installed during frost conditions, the Developer shall pay an additional $150.00 for each traffic control sign location. If multiple mobilizations are needed, the Developer shall pay an addition $300.00 for each mobilization. A cash fee for one-year of streetlight operating expenses shall be paid with the final plat and is calculated as follows: 2880 feet x $0.2832/front foot/quarter x 4 quarters = $3,262.46 Total Front Foot Marketplace At Cedar 2025 Rate Streetlight Operating Fee Marketplace At Cedar A cash fee for one-year of environmental resources management expenses shall be paid with the final plat and is calculated as follows: 9 units x $61.52/unit x 4.20 = $2,325.46 Total Units (Commercial) Marketplace At Cedar 2025 Rate Conversion Factor (Commercial) Environmental Resources Fee Marketplace At Cedar A cash fee for the preparation of addressing, property data, and City base map updating shall be paid with the final plat and is calculated as follows: 12 lots/outlots x $90.00/unit = $1,080.00 Lots/Outlots Marketplace At Cedar 2025 Rate Property Data & Asset/Infrastructure Mgmt. Fee Marketplace At Cedar The Developer shall submit the final plat and construction drawings in an electronic format. The electronic format shall be in .pdf and either .dwg/.dxf or .shx format. The Developer shall also pay a cash fee for City Engineering Administration. The fee for City Engineering Administration will be based on three percent (3.00%) of the estimated construction cost, or $42,373.12. CASH REQUIREMENTS Park Dedication $ 126,612.72 Traffic Signal – Glacier and 179th Special Assessment 221407 – Glacier Way 132,000.00 249,414.00 Storm Sewer Charge 162,401.75 MS4 Administration Fee 9,803.09 Traffic Control Signs 8,675.00 Streetlight Operating Fee 3,262.46 Environmental Resources Management Fee 2,325.46 Property Data and Asset/Infrastructure Management Fee 1,080.00 City Engineering Administration (3.00%) SUBTOTAL – CASH REQUIREMENTS 42,373.12 $ 737,947.60 Page 421 of 899 MMAARRKKEETTPPLLAACCEE AATT CCEEDDAARR FFIINNAALL PPLLAATT AAUUGGUUSSTT 2266,, 22002255 PPAAGGEE 1100 OOFF 1100 CREDITS TO CASH REQUIREMENTS City 3/8th Trail Cost – 179th Street City Sidewalk – Glanshaw Avenue SUBTOTAL – CREDITS TO CASH REQUIREMENTS $ 9,020.06 16,714.80 $ 25,734.86 TOTAL CASH REQUIREMENTS $ 712,212.74 RREECCOOMMMMEENNDDAATTIIOONN Engineering recommends approval of the final plat, grading and erosion control plan, tree preservation, and utility plan for Marketplace At Cedar, subject to the requirements and stipulations within this report. Page 422 of 899 Date: 10/6/2025 Acknowledge Receipt of 2024 Annual Comprehensive Financial Report Proposed Action Staff recommends adoption of the following motion: Move to acknowledge receipt of City of Lakeville Annual Comprehensive Finacial Report for the Year Ended December 31, 2024 Overview Final copies of the City of Lakeville Annual Comprehensive Financial Report (ACFR) for the Year Ended December 31, 2024 and auditor communications are attached for City Council review and formal approval. The certified public accounting firm of CliftonLarsonAllen, LLP (CLA) has audited the financial report. In their opinion, the financial statements fairly present the financial position of City of Lakeville as of December 31, 2024 and the results of its operations for the year then ended. Mr. Ezra Koetz (Manager with CLA) will present an overview at the October 6 Council meeting. An overview of the financial operations is provided in the Letter of Transmittal and Management’s Discussion and Analysis. Due to delays in the audit process, staff requested and received two deadline extensions. The 2024 Annual Comprehensive Financial Report was finalized and submitted to both the Minnesota State Auditor’s Office and the Government Finance Officers Association (for the Certificate of Achievement in Excellence in Financial Reporting Award) by the extended deadline of September 30, 2025. Following formal Council approval, the report will also be made available on the City website. The audit delay was due to transitions we went through — both with changes in our front-line finance staff and with new staff on the auditor’s side. At the same time, we were in the middle of the ERP conversion, which added extra time to get everything reconciled and finalized. We worked through those challenges, requested extensions, and still met the extended September 30th filing date. We expect the 2025 reports to be back on schedule. Staff is already finding efficiencies with the new system, so we anticipate being on time moving forward. Supporting Information 1. 2024 Annual Comprehensive Financial Report 2. 2024 Executive Audit Summary 3. 2024 Governance Communication 4. 2024 Internal Control Communication 5. 2024 Legal Compliance Letter Page 423 of 899 Financial Impact: $ N/A Budgeted: No Source: N/A Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Julie Stahl, Finance Director Page 424 of 899 Page 425 of 899 CITY OF LAKEVILLE, MINNESOTA ANNUAL COMPREHENSIVE FINANCIAL REPORT YEAR ENDED DECEMBER 31, 2024 PREPARED BY THE FINANCE DEPARTMENT Page 426 of 899 CITY OF LAKEVILLE TABLE OF CONTENTS YEAR ENDED DECEMBER 31, 2024 INTRODUCTORY SECTION LETTER OF TRANSMITTAL 1 ELECTED AND APPOINTED OFFICIALS 11 ORGANIZATIONAL CHART 12 CERTIFICATE OF ACHIEVEMENT FOR EXCELLENCE IN FINANCIAL REPORTING 13 FINANCIAL SECTION INDEPENDENT AUDITORS’ REPORT 14 MANAGEMENT’S DISCUSSION AND ANALYSIS 18 BASIC FINANCIAL STATEMENTS STATEMENT OF ACTIVITIES 36 BALANCE SHEET –GOVERNMENTAL FUNDS 37 RECONCILIATION OF THE BALANCE SHEET TO THE STATEMENT OF NET POSITION –GOVERNMENTAL ACTIVITIES 38 STATEMENT OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES –GOVERNMENTAL FUNDS 39 RECONCILIATION OF THE STATEMENT OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES TO THE STATEMENT OF ACTIVITIES –GOVERNMENTAL ACTIVITIES 40 STATEMENT OF NET POSITION –PROPRIETARY FUNDS 41 STATEMENT OF NET REVENUES, EXPENSES, AND CHANGES IN NET POSITION –PROPRIETARY FUNDS 42 STATEMENT OF CASH FLOWS –PROPRIETARY FUNDS 43 STATEMENT OF FIDUCIARY NET POSITION –CUSTODIAL FUND 44 STATEMENT OF CHANGES IN FIDUCIARY NET POSITION –CUSTODIAL FUND 45 NOTES TO BASIC FINANCIAL STATEMENTS 46 REQUIRED SUPPLEMENTARY INFORMATION GENERAL FUND SCHEDULE OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES –BUDGETARY COMPARISON 103 NOTE TO REQUIRED SUPPLEMENTARY INFORMATION 108 PERA –GENERAL EMPLOYEES RETIREMENT FUND 109 PERA –PUBLIC EMPLOYEES POLICE AND FIRE FUND 110 NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS 111 NET PENSION LIABILITY (ASSET) AND RELATED RATIOS –LAKEVILLE FIRE RELIEF ASSOCIATION 118 SCHEDULE OF CHANGES IN THE CITY’S TOTAL OPEB LIABILITY AND RELATED RATIOS 119 Page 427 of 899 CITY OF LAKEVILLE TABLE OF CONTENTS YEAR ENDED DECEMBER 31, 2024 COMBINING AND INDIVIDUAL FUND STATEMENTS AND SCHEDULES NONMAJOR GOVERNMENTAL FUNDS SPECIAL REVENUE FUNDS (NONMAJOR) –COMBINING BALANCE SHEET 122 SPECIAL REVENUE FUNDS (NONMAJOR) –COMBINING STATEMENT OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES 123 PROPRIETARY FUNDS -INTERNAL SERVICE FUNDS INTERNAL SERVICE FUNDS –COMBINING STATEMENT OF NET POSITION 125 INTERNAL SERVICE FUNDS –COMBINING STATEMENT OF REVENUES, EXPENSES, AND CHANGES IN NET POSITION 126 INTERNAL SERVICE FUNDS –COMBINING STATEMENT OF CASH FLOWS 127 STATISTICAL SECTION (UNAUDITED) NET POSITION BY COMPONENT –GOVERNMENT WIDE 129 CHANGES IN NET POSITION BY COMPONENT –GOVERNMENTAL ACTIVITIES 131 CHANGES IN NET POSITION BY COMPONENT –BUSINESS-TYPE ACTIVITIES 133 CHANGES IN NET POSITION BY COMPONENT –TOTAL GOVERNMENTAL AND BUSINESS-TYPE ACTIVITIES 135 FUND BALANCES –GOVERNMENTAL FUNDS 137 CHANGES IN FUND BALANCES –GOVERNMENTAL FUNDS 139 TAX CAPACITY VALUATION AND ASSESSOR’S TAXABLE MARKET VALUE OF TAXABLE PROPERTY 141 PROPERTY TAX RATES –DIRECT AND OVERLAPPING GOVERNMENTS 143 PRINCIPAL PROPERTY TAXPAYERS 144 PROPERTY TAX LEVY AND COLLECTIONS 145 RATIO OF TOTAL DEBT BY TYPE 146 RATIO OF NET BONDED DEBT OUTSTANDING 147 DIRECT AND OVERLAPPING GOVERNMENTAL DEBT 148 LEGAL DEBT MARGIN 149 PLEDGED REVENUE COVERAGE 150 DEMOGRAPHIC AND ECONOMIC STATISTICS 151 PRINCIPAL EMPLOYERS 152 COMMERCIAL AND INDUSTRIAL BUILDING PERMITS ISSUED 153 EMPLOYEES BY FUNCTION/PROGRAM (FULL-TIME EQUIVALENT)154 OPERATING INDICATORS BY FUNCTION 155 CAPITAL ASSET STATISTICS BY FUNCTION 156 Page 428 of 899 INTRODUCTORY SECTION Page 429 of 899 (1) September 30, 2025 The Honorable Mayor and Council Members 20195 Holyoke Avenue Lakeville, Minnesota 55044 Honorable Mayor, Members of the City Council and Citizens of the City of Lakeville: The Annual Comprehensive Financial Report is hereby presented for the purpose of providing you, the reader, with a thorough overview of the financial affairs of the City for the year ended December 31, 2024. The Report was prepared in accordance with Minnesota Statutes and Generally Accepted Accounting Principles (GAAP). This report was prepared by the City’s Finance Department and consists of management’s representations concerning the finances of the City. Consequently, management assumes full responsibility for the completeness and reliability of all information presented in this report. To provide a reasonable basis for making these representations, management of the City has established internal controls designed to protect the City’s assets from loss, theft or misuse and to provide sufficient reliable information for the preparation of these financial statements in conformity with GAAP. Because the cost of internal controls should not outweigh their benefits, the City’s internal controls have been designed to provide reasonable rather than absolute assurance that the financial statements will be free from material misstatements. As management, we assert that to the best of our knowledge and belief this report is complete and reliable in all material respects. The City of Lakeville’s financial statements have been audited by CliftonLarsonAllen LLP, a professional firm of certified public accountants. The independent auditor’s report is included in the Financial Section of this report. The auditors have given this report an unmodified (“clean”) opinion, meaning that the financial statements fairly present the City’s financial position at December 31, 2024 and the changes in financial position for the year then ended. Management’s discussion and analysis (MD&A) immediately follows the independent auditors’ report and provides a narrative introduction, overview, and analysis of the basic financial statements. MD&A complements this letter of transmittal and should be read in conjunction with it. 20195 Holyoke Avenue, Lakeville, MN 55044 952-985-4400 952-985-4499 fax www.lakevillemn.gov Page 430 of 899 (2) Profile of Government The City of Lakeville is a suburban community located 20 miles south of downtown Minneapolis in the southeast corner of the Twin Cities metropolitan area within Dakota County. Lakeville enjoys an excellent location, with convenient access to the Minneapolis- Saint Paul metropolitan area via interstate highway I-35. The City is also just 25 minutes from the Minneapolis-Saint Paul International Airport. Lakeville continues to be one of the fastest growing cities in Minnesota with a population that has grown from 69,490 in 2020 to 76,746 in 2024. The City of Lakeville operates under the Mayor-Council form of organization. The governing City Council consists of the Mayor and four other Council members. The City Council is responsible for, among other things, passing ordinances, adopting the budget, appointing members to the various committees and commissions, and hiring the City Administrator. The City Administrator is responsible for carrying out the policies, directions, and ordinances of the City Council and for overseeing the day-to-day operations of the City. The City Council is elected on a non-partisan at-large basis. The Mayor is elected to serve a four-year term, while Council Members serve four-year staggered terms, with two Council Members elected every two years. The City provides its residents and businesses with a full range of municipal services consisting of public safety (police and fire), public works, parks and recreation, and general government administration. The City also operates two enterprises: utilities (public water, sanitary sewer, streetlights and environmental resources) and off-sale liquor stores. Sewage treatment and disposal is operated on a regional basis by the Metropolitan Council Environmental Services (MCES) and refuse collection and disposal are handled on a private basis through contractual arrangements by City residents with private haulers. Further information regarding city services can be obtained from the City’s website at www.lakevillemn.gov The City is financially accountable for the Housing and Redevelopment Authority (HRA), which is included in the City’s financial statement. Additional information on the HRA can be found in Note 1A. –Summary of Significant Accounting Policies of the Notes to Basic Financial Statements. The annual budget serves as the foundation for the City of Lakeville’s financial planning and control. The budgetary process is outlined in the notes within the required supplementary information section of this report. The City applies budgetary controls to ensure compliance with legal provisions of the laws of Minnesota. Budgets are adopted on a basis consistent with GAAP. Annual budgets are adopted for the general fund and special revenue funds. The general fund budgetary comparison schedules are presented within the required supplementary information section and the special revenue funds budgetary comparison schedules are presented in the nonmajor governmental funds subsection of this report. Page 431 of 899 (3) Factors Affecting Financial Condition The City of Lakeville is committed to maintaining a strong financial condition, while continuing to provide quality public services to its residents and businesses. The City’s financial position, as reflected in the financial statements presented in this report, is perhaps best understood when it is considered from the broader perspective of the environment within which the City operates. Local Economy The City’s tax base is primarily residential and consists of mostly single-family homes. Commercial and industrial properties make up approximately eleven percent of the tax base. Following a post-2008 recession decline to a 2013 low of $4.8M, the City’s taxable valuation has steadily risen –reaching a new a new peak of $13M –driven by new construction and rising property values. Since 2015, the population has grown by 16,755 (28%), while City staff has increased by 24.7%. The City has a land area of 38 square miles with approximately 22% of its land available for development. In 2024, final plats were approved for 205 single-family units, 210 detached townhomes, 171 attached townhomes, 88 twin homes, three commercial, one industrial and 167-unit apartments. The trend for building permit activity for single-family homes is steady with building permits for single family homes/detached townhomes increasing from 367 in 2023 to 385 in 2024. The 2025 budget is premised on conservative modest growth of new single-family homes in the coming year. Act ual Re si dent ial Un its Es timated Re si dent ial Un its Act ual Si ngl e Fa mi ly Es timated Si ngl e Fa mi ly Page 432 of 899 (4) In 2024, the City issued $75 million in building permits for new or expanded commercial and industrial buildings. Commercial construction in 2024 included construction of a new three-story Allina Health Specialty Center and MNGI Digestive Health consisting of 100,000 square feet. This multi- specialty center is located along 185th Street near I-35 and brings the full Allina Health ambulatory platform to the south metro (along with MNGI Digestive Health). This investment in the Lakeville community includes more than 20 specialties, such as orthopedics, oncology, women’s health and cardiology, in addition to an ambulatory surgery center. Action Behavior Centers opened at 20890 Kenbridge Court, providing autism therapy services for early learners, school-age children and teens. Goodwill opened its’ new 20,000 sq.ft. facility at 207th Street West. Industrial growth continued in 2024 with groundbreaking of a 276,480 square-foot cold storage warehouse facility (RL Cold) located east of Cedar and south of 215th Street. Adjacent to this site, Sweet Harvest Foods (existing business that is expanding) celebrated their ribbon cutting ceremony on June 25, 2024, on their new 360,000 square-foot office, manufacturing and warehouse facility. Dalsin Industries, a custom metal fabrication and design manufacturer, celebrated their ribbon cutting on April 9, 2024. Jacquard Distribution Center completed construction of its 168,000 sq.ft. multi-tenant industrial warehouse on 217th Street West. New dining options for Lakeville in 2024 included LBC on the Lake, LaMichoacana Purepecha, Donut Star, Taco Bell, Kyiv Cakes and the Farmer’s Grandson Eatery. Grand Prairie Park was issued multiple building permits in 2024 and construction started on the main park building, challenge course, covered grandstand, dugouts for the new baseball stadium and pickleball courts. This new destination park will include a splash pad, baseball field with seating, pickleball courts, and several multi-purpose fields, including the City’s first cricket pitch. Some of the amenities are expected to be ready for use in the summer of 2025. Lakeville is served by Independent School District No. 192, Farmington, Independent School District No. 194, Lakeville, and Independent School District No. 196, Rosemount- Apple Valley-Eagan. Non-Public education is provided by All Saints Catholic School, Christian Heritage Academy, Southview Christian and Glory Academy. According to the Dakota County Assessor’s office, the estimated market value for the median value home increased by 1.38% as of March 2025 (for taxes payable 2025) to $451,150. For taxes payable 2026, the median value home has increased by 3.73% to $468,000. According to the Bureau of Labor Statistics, Lakeville’s unemployment rate is favorable compared to the State and National rates. Page 433 of 899 (5) Source: https://mn.gov/deed/data Major Initiatives Pressures and issues confronting the City were taken into account with the 2024 adopted budget including community growth, aging infrastructure, inflationary pressures, innovation and efficiencies, entrepreneurial efforts and preparing for the future. Community Growth.New residential housing construction continues to rise due in large part to improved economic conditions. The resumption of growth will result in increased demands for infrastructure enhancements as well as service delivery such as inspections, code enforcement, police, fire, streets, and parks. Commercial Growth.The City utilizes targeted tax abatement agreements to encourage investment, job creation, and redevelopment of underutilized areas. While these agreements temporarily reduce certain tax revenues, they are expected to provide long- term benefits by expanding the tax base, supporting economic growth, and enhancing the quality of life for residents. Additional details are presented in the notes to the financial statements. Page 434 of 899 (6) Addressing Aging Infrastructure.Our City has more than $400 million of investment in infrastructure such as roads, water mains, parks, trails, facilities, equipment, and other assets. The assets have maintenance, and in certain situations, replacement requirements. The 2024 budget addressed the short-term plan while the Capital Improvement Plan addressed the anticipated intermediate and long-term needs. The most significant 2024 projects included: Annual pavement maintenance program to improve city-wide pavement management index 2024 Street Reconstruction Collector Road Rehabilitation (Ipava Ave/Indiana Ave/175th St) Well #23 construction CMF water tower painting Grand Prairie Park construction Inflationary Pressures.As the economy improves there will be upward pressure on commodities, services, and personnel costs. Inflation has increased significantly recently due to supply chain disruptions, etc. The budget anticipated modest price increases in the near term. Innovation and Efficiencies.Lakeville has a long-standing history of being fiscally conservative and prudent. Although the City of Lakeville receives no state aid for property tax relief, per capita current expenditures for operations are still amongst the lowest in the twin cities according to the Minnesota State Auditor’s Office. The adopted budget included several initiatives which continued the focus on a commitment to cost effectiveness and efficiencies. Effective application of technology is a major factor in optimizing organizational efficiencies. The City converted the water meter system to a fixed-based system utilizing existing water towers as collectors. This ensures accurate water monitoring and provides residents with timely information regarding their water usage. Entrepreneurial Efforts.Continued marketing initiatives are proposed to promote economic developments. Several years ago, property was acquired in southwestern Lakeville for what is now known as the Keokuk liquor store, the City’s fourth liquor store. The excess land adjacent to the Keokuk liquor store is currently being marketed for sale for a complementary business to further improve revenues and sales opportunities. Preparing for the Future.As a Community that embraces a high quality of life and a pro- business attitude, Lakeville is “Positioned to Thrive.” It is an objective that embraces a vision for the future and a commitment to preparing for it. Page 435 of 899 (7) Long-term Financial Planning There is an interrelationship between a community’s physical development and its long-term financial plan. A comprehensive plan provides the guidance for current and future land use and public infrastructure decisions to provide managed growth throughout the community. The City of Lakeville completes an update of its Comprehensive Plan every ten years. The City prepares an annually updated Capital Improvement Plan (CIP) which is a flexible, five-year plan that identifies the City’s infrastructure, development objectives and allocation of financial resources. The CIP identifies funding for the projects and provides policy makers and the community with a strategic (documented) approach to implementation and administration of improvement projects. The City will invest $246 million in transportation, utility, equipment, technology, facilities, and parks over the next five years to achieve program objectives. The City has also implemented long-term financial planning models for its governmental funds, utility funds and debt funds. This effort of forecasting operating and capital budgets has positioned the City to better handle the growing demand for City services, increased infrastructure, and the economic impact of unforeseen events such as COVID-19. Moody’s Investors Service upgraded the City’s bond rating from Aa1 to Aaa in June, 2021, citing the City’s robust economic and financial performance that were exceptionally resilient throughout the coronavirus pandemic coupled with continued solid management practices that are expected to support strong credit fundamentals over the long-term. This top rating from Moody’s is shared by only twelve other Minnesota cities. There are 31 MN cities with either Moody’s Aaa and/or S&P Global’s AAA rating. Page 436 of 899 (8) As of December 31, 2024, the City of Lakeville had approximately $155.450 million of debt outstanding. The City will issue approximately $35 million general obligation improvement bonds in the coming years to finance street reconstruction projects, and facility expansion. Relevant Financial Policies The City has multiple policies which are utilized in the management of its fiscal affairs. The primary policies include, but are not limited to, operating budget policy, budget amendment process, revenue, debt, investment, and fund balance. The City also adopted a Financial Sustainability and Resiliency policy in January 2020. Operating Budgets. The City’s operating budget policy sets forth guidance with respect to balanced operating budgets, with an overriding goal of achieving structural balance over a longer-term period, while recognizing that in certain periods, revenues and expenditures may not be equal. A balanced budget for the General Fund is defined as revenues and other sources equal to or exceeding operating expenditures and other uses. Other sources can include that portion of General Fund balance that is allowed to be budgeted for use per the City’s fund balance policy. The budget will provide for adequate maintenance of capital facilities and equipment and for their orderly replacement. Balanced budgets for the proprietary enterprise funds are defined as providing sufficient revenues to support the operations of those funds, without subsidy from the General Fund or property taxes. Charges from the Proprietary Internal Service Funds shall be sufficient to support such activities, with no trend of operating deficits. The legal level of budgetary control (i.e., the level at which expenditures may not legally exceed appropriations) is at the fund level for the General Fund and Special Revenue Funds. The City Administrator has authorization to expend funds in excess of the appropriation for each department and to approve budget amendments between departments within a budgeted fund pursuant to all adopted financial policies. Budgeted expenditure appropriations lapse at year-end. Supplementary appropriations can be carried forward to the following year if approved by the City Council. Revenue Policies. The City will project its annual revenues by a conservative objective and thorough analytical process. The City will endeavor to maintain a diversified and stable revenue system to shelter it from annual fluctuations in any one revenue source. All existing and potential revenue sources will be reexamined annually. New sources of non-property-tax revenue should always be actively explored. Where appropriate and not contrary to accepted public policy or statutes, emphasis will be directed toward full cost recovery through user fees. User fees and cost allocation formulas will be updated periodically (annually, if needed). Ongoing, the City will review the full cost of activities supported by user fees to identify the impact of inflation and other factors. The fees along with the resulting net property tax costs will be reviewed with the City Council during the budget process. Sensitivity to market rates will also be considered in setting fees. Intergovernmental grant requests are subject to fiscal review before the application is submitted. This review is to ensure that the grants do not create an obligation for unfunded expenditures by the City relating to the grant’s purpose and to provide an overall budgetary review of grant proposals. Page 437 of 899 (9) Debt. The City’s debt policy provides guidance to ensure that long-term debt is utilized appropriately and in a fiscally prudent manner. Limiting long-term borrowing to capital improvements or other long-term projects which cannot, and appropriately should not, be financed from current revenues. Final maturity of bonds and notes should not exceed the expected useful life of the underlying project for which it is being issued. Where possible, the City will endeavor to pledge special assessments, State-aid or other non- tax revenues to debt service payments. Investments.The City’s policy is to invest all available monies at competitive interest rates, coordinated with projections of the City’s operating and program cash flow needs. Interest earnings will be distributed to the funds based on the average cash balances. Investments will take into consideration safety, liquidity and yield as well as complying with State regulations. Fund Balance. Fund balance or net position are terms used to define the difference between a fund’s assets, deferred outflows of financial resources, liabilities, and deferred inflows of financial resources. Fund balance is used in governmental fund types and net position is used in proprietary fund types and the government-wide financial statements. Financial Sustainability and Resiliency Policy.The City Council adopted this new policy in January 2020. The purpose of this policy is to establish strategic financial sustainability and resiliency principles for the City of Lakeville, which may be used when developing the annual budget, long-term financial plans, and when making critical financial, economic development and community development decisions. Awards Certificate of Achievement The Government Finance Officers Association (GFOA) of the United States awarded a Certificate of Achievement for Excellence in Financial Reporting to the City of Lakeville, Minnesota, for its annual comprehensive financial report for the fiscal year ended December 31, 2023. This is the thirty-sixth consecutive year that the City of Lakeville has received this prestigious award. To be awarded a Certificate of Achievement for Excellence, a government must publish an easily readable and efficiently organized annual comprehensive financial report, and the contents must conform to the program standards. Such reports must satisfy both generally accepted accounting principles and applicable legal requirements. A Certificate of Achievement for Excellence in Financial Reporting is valid for a period of one year only. We believe our current annual comprehensive financial report continues to conform to the Certificate of Achievement for Excellence program requirements, and we are submitting it to the GFOA to determine its eligibility for another certificate. Page 438 of 899 (10) Financial Policy Challenge The City also earned recognition as a winner of the Financial Policy Challenge from the Government Finance Officers Association (GFOA) in 2021 for its Financial Sustainability and Resiliency Policy. The GFOA launched this Challenge as an opportunity for GFOA members to adopt and share financial policies that are essential to a strong financial foundation. Acknowledgements The preparation of this report could not have been accomplished without the professional, efficient, and dedicated services of the entire staff of the Finance Department. We would like to express our appreciation to all members of the department, with special recognition to Senior Financial Analysts Tom Nesseth, Laura Miller, and Julie Werner. We would also like to express our sincere gratitude to the City Council for its sincere commitment and progressive leadership in the financial affairs of our community. Respectfully submitted, Justin Miller Julie Stahl City Administrator Finance Director/Treasurer Page 439 of 899 CITY OF LAKEVILLE ELECTED AND APPOINTED OFFICIALS YEAR ENDED DECEMBER 31, 2024 (11) Term Expires Elected Officials December 31, Luke Hellier Mayor 2026 John Bermel Council Member 2024 Dan Wolter Council Member 2024 Joshua Lee Council Member 2026 Michelle Volk Council Member 2026 APPOINTED PERSONNEL Justin Miller City Administrator Julie Stahl Finance Director/Treasurer Ann Orlofsky City Clerk Page 440 of 899 CITY OF LAKEVILLE ORGANIZATIONAL CHART YEAR ENDED DECEMBER 31, 2024 (12) Page 441 of 899 CITY OF LAKEVILLE CERTIFICATE OF ACHIEVEMENT FOR EXCELLENCE IN FINANCIAL REPORTING DECEMBER 31, 2024 (13) Page 442 of 899 FINANCIAL SECTION Page 443 of 899 CLA (CliftonLarsonAllen LLP) is an independent network member of CLA Global. See CLAglobal.com/disclaimer. CliftonLarsonAllen LLP CLAconnect.com (14) INDEPENDENT AUDITORS’REPORT Honorable Mayor and the City Council City of Lakeville, Minnesota Report on the Audit of the Financial Statements Opinions We have audited the accompanying financial statements of the governmental activities, the business- type activities, each major fund, and the aggregate remaining fund information of the City of Lakeville, as of and for the year ended December 31, 2024, and the related notes to the financial statements, which collectively comprise the City of Lakeville’s basic financial statements as listed in the table of contents. In our opinion, the financial statements referred to above present fairly, in all material respects, the respective financial position of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City of Lakeville as of December 31, 2024, and the respective changes in financial position and, where applicable, cash flows thereof for the year then ended in accordance with accounting principles generally accepted in the United States of America. Basis for Opinions We conducted our audit in accordance with auditing standards generally accepted in the United States of America (GAAS) and the standards applicable to financial audits contained in Government Auditing Standards,issued by the Comptroller General of the United States. Our responsibilities under those standards are further described in the Auditors’Responsibilities for the Audit of the Financial Statements section of our report. We are required to be independent of the City of Lakeville and to meet our other ethical responsibilities, in accordance with the relevant ethical requirements relating to our audit. We believe that the audit evidence we have obtained is sufficient and appropriate to provide a basis for our audit opinions. Emphasis of Matter –Change in Accounting Principle We draw attention to Note 22 of the financial statements, which describes the City’s restatement due to a change in accounting principle. Our opinions are not modified with respect to this matter. Responsibilities of Management for the Financial Statements Management is responsible for the preparation and fair presentation of the financial statements in accordance with accounting principles generally accepted in the United States of America, and for the design, implementation, and maintenance of internal control relevant to the preparation and fair presentation of financial statements that are free from material misstatement, whether due to fraud or error. Page 444 of 899 Honorable Mayor and the City Council City of Lakeville, Minnesota (15) In preparing the financial statements, management is required to evaluate whether there are conditions or events, considered in the aggregate, that raise substantial doubt about the City of Lakeville’s ability to continue as a going concern for twelve months beyond the financial statement date, including any currently known information that may raise substantial doubt shortly thereafter. Auditors’ Responsibilities for the Audit of the Financial Statements Our objectives are to obtain reasonable assurance about whether the financial statements as a whole are free from material misstatement, whether due to fraud or error, and to issue an auditors’report that includes our opinions. Reasonable assurance is a high level of assurance but is not absolute assurance and therefore is not a guarantee that an audit conducted in accordance with GAAS and Government Auditing Standards will always detect a material misstatement when it exists. The risk of not detecting a material misstatement resulting from fraud is higher than for one resulting from error, as fraud may involve collusion, forgery, intentional omissions, misrepresentations, or the override of internal control. Misstatements are considered material if there is a substantial likelihood that, individually or in the aggregate, they would influence the judgment made by a reasonable user based on the financial statements. In performing an audit in accordance with GAAS and Government Auditing Standards, we: Exercise professional judgment and maintain professional skepticism throughout the audit. Identify and assess the risks of material misstatement of the financial statements, whether due to fraud or error, and design and perform audit procedures responsive to those risks. Such procedures include examining, on a test basis, evidence regarding the amounts and disclosures in the financial statements. Obtain an understanding of internal control relevant to the audit in order to design audit procedures that are appropriate in the circumstances, but not for the purpose of expressing an opinion on the effectiveness of City of Lakeville’s internal control. Accordingly, no such opinion is expressed. Evaluate the appropriateness of accounting policies used and the reasonableness of significant accounting estimates made by management, as well as evaluate the overall presentation of the financial statements. Conclude whether, in our judgment, there are conditions or events, considered in the aggregate, that raise substantial doubt about City of Lakeville’s ability to continue as a going concern for a reasonable period of time. We are required to communicate with those charged with governance regarding, among other matters, the planned scope and timing of the audit, significant audit findings, and certain internal control related matters that we identified during the audit. Page 445 of 899 Honorable Mayor and the City Council City of Lakeville, Minnesota (16) Required Supplementary Information Accounting principles generally accepted in the United States of America require that the management’s discussion and analysis, budgetary comparison information, schedule of changes in the City’s total OPEB liability and related ratios, schedule of the City’s proportionate share of net pension liability, schedule of the City’s pension contributions, and the schedule of changes in net pension liability and related ratios be presented to supplement the basic financial statements. Such information is the responsibility of management and, although not a part of the basic financial statements, is required by the Governmental Accounting Standards Board who considers it to be an essential part of financial reporting for placing the basic financial statements in an appropriate operational, economic, or historical context. We have applied certain limited procedures to the required supplementary information in accordance with GAAS, which consisted of inquiries of management about the methods of preparing the information and comparing the information for consistency with management’s responses to our inquiries, the basic financial statements, and other knowledge we obtained during our audit of the basic financial statements. We do not express an opinion or provide any assurance on the information because the limited procedures do not provide us with sufficient evidence to express an opinion or provide any assurance. Supplementary Information Our audit was conducted for the purpose of forming opinions on the financial statements that collectively comprise the City of Lakeville’s basic financial statements. The combining and individual fund statements and schedules are presented for purposes of additional analysis and are not a required part of the basic financial statements. Such information is the responsibility of management and was derived from and relates directly to the underlying accounting and other records used to prepare the basic financial statements. The information has been subjected to the auditing procedures applied in the audit of the basic financial statements and certain additional procedures, including comparing and reconciling such information directly to the underlying accounting and other records used to prepare the basic financial statements or to the basic financial statements themselves, and other additional procedures in accordance with GAAS. In our opinion, the combining and individual fund statements and schedules is fairly stated, in all material respects, in relation to the basic financial statements as a whole. Other Information Management is responsible for the other information included in the annual report. The other information comprises the introductory and statistical sections but does not include the basic financial statements and our auditors’report thereon. Our opinions on the basic financial statements do not cover the other information, and we do not express an opinion or any form of assurance thereon. In connection with our audit of the basic financial statements, our responsibility is to read the other information and consider whether a material inconsistency exists between the other information and the basic financial statements, or the other information otherwise appears to be materially misstated. If, based on the work performed, we conclude that an uncorrected material misstatement of the other information exists, we are required to describe it in our report. Page 446 of 899 Honorable Mayor and the City Council City of Lakeville, Minnesota (17) Other Reporting Required by Government Auditing Standards In accordance with Government Auditing Standards, we have also issued our report dated September 30, 2025,on our consideration of the City of Lakeville’s internal control over financial reporting and on our tests of its compliance with certain provisions of laws, regulations, contracts, and grant agreements and other matters. The purpose of that report is solely to describe the scope of our testing of internal control over financial reporting and compliance and the results of that testing, and not to provide an opinion on the effectiveness of the City of Lakeville’s internal control over financial reporting or on compliance. That report is an integral part of an audit performed in accordance with Government Auditing Standards in considering City of Lakeville’s internal control over financial reporting and compliance. CliftonLarsonAllen LLP Minneapolis, Minnesota September 30, 2025 Page 447 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (18) As management of the City of Lakeville (the City), we offer readers of the City’s financial statements this narrative overview and analysis of the financial activities of the City for the fiscal year ended December 31, 2024. The discussion and analysis is intended to be considered in conjunction with the additional information that we have furnished in our letter of transmittal, located earlier in this report, and the City’s financial statements contained within this report. Financial Highlights The assets and deferred outflows of resources of the City exceeded liabilities and deferred inflows of resources by $586,716,381 (net position) at the close of the most recent fiscal year. Of this amount, $55,735,393 (unrestricted net position) may be used to meet the government’s ongoing obligations to citizens and creditors. The City’s total net position increased by $29,137,011 in 2024. The City’s governmental funds reported combined ending fund balances of $128,104,741. Of this total amount, $68,639,377 or 53.6% is not restricted or nonspendable and is available for use within the City’s constraints and policies. As of the end of the current fiscal year, the City’s total unassigned fund balance for the general fund was $20,668,085 or 52.8% of total general fund expenditures of $39,129,789. Overview of the Financial Statements This discussion and analysis is intended to serve as an introduction to the City’s basic financial statements. The City’s basic financial statements are comprised of three components: 1)government- wide financial statements, 2)fund financial statements, and 3)notes to basic financial statements. This report also contains other required supplementary information in addition to the basic financial statements themselves. Government-wide financial statements.The government-wide financial statements are designed to provide readers with a broad overview of the City’s finances, in a manner similar to a private-sector business. The government-wide financial statements include not only the City itself (known as the primary government), but also a legally separate housing and redevelopment authority (HRA) for which the City is considered to be financially accountable or for which the nature and significance of their relationship with the City is such that the exclusion would cause the City’s financial statements to be misleading or incomplete. Financial information for this component unit is blended within the financial information presented for the primary government itself. The Statement of Net Position presents information on all of the City’s assets, deferred outflows of resources, liabilities,and deferred inflows of resources, with the difference reported as net position. Over time, increases or decreases in net position may serve as a useful indicator of whether the financial position of the City is improving or deteriorating. Page 448 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (19) The Statement of Activities presents information showing how the City’s net position changed during the most recent fiscal year. All changes in net position are reported as soon as the underlying event giving rise to the change occurs, regardless of the timing of related cash flows. Thus, revenues and expenses are reported in this statement for some items that will only result in cash flows in future fiscal periods (e.g., uncollected taxes and earned but unused vacation leave). Both of the government-wide financial statements distinguish functions of the City that are principally supported by taxes and intergovernmental revenues (governmental activities) from other functions that are intended to recover all or a significant portion of their costs through user fees and charges (business-type activities). The governmental activities of the City include general government, public safety, public works, and parks and recreation. The business-type activities of the City include the enterprise activities of the liquor operation and utility operation. Fund financial statements.A fund is a grouping of related accounts that is used to maintain control over resources that have been segregated for specific activities or objectives. The City, like other state and local governments, uses fund accounting to ensure and demonstrate compliance with finance- related legal requirements. All of the funds of the City can be divided into three categories: governmental funds, proprietary funds, and fiduciary funds. Governmental funds.Governmental funds are used to account for essentially the same functions reported as governmental activities in the government-wide financial statements. However, unlike the government-wide financial statements, governmental fund financial statements focus on near-term inflows and outflows of spendable resources, as well as on balances of spendable resources available at the end of the fiscal year. Such information may be useful in evaluating a government’s near-term financing requirements. Because the focus of governmental funds is narrower than that of the government-wide financial statements, it is useful to compare the information presented for governmental funds with similar information presented for governmental activities in the government-wide financial statements. By doing so, readers may better understand the long-term impact of the government’s near-term financing decisions. Both the governmental fund balance sheet and the governmental fund statement of revenues, expenditures, and changes in fund balances provide a reconciliation to facilitate this comparison between governmental funds and governmental activities. The City maintains 4 individual governmental funds. Information is presented separately in the governmental fund balance sheet and in the governmental fund statement of revenues, expenditures, and changes in fund balances for the general fund, debt service fund, and the capital projects fund, all of which are considered to be major funds. Data from the other governmental funds is combined into a single, aggregated presentation. Individual fund data for each of these nonmajor governmental funds is provided in the form of combining statements following the required supplementary information. Page 449 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (20) The City adopts annual appropriated budgets for its general fund and special revenue funds. A budgetary comparison schedule has been provided as required supplementary information for the general fund to demonstrate compliance with this budget. Proprietary funds.The City maintains two different types of proprietary funds. Enterprise funds are used to report the same functions presented as business-type activities in the government-wide financial statements. The internal service fund is an accounting device used to accumulate and allocate costs internally among the City’s various functions. The City uses enterprise funds to account for its off-sale liquor and utility (water, sanitary sewer, streetlight, and environmental resources) operations. The City uses two internal service funds to account for its risk management insurance liability program and the compensated leave balances of governmental activities. These services benefit the governmental and business-type functions; therefore, they have been included within governmental and business-type activities in the government- wide financial statements. Proprietary funds provide the same type of information as the government-wide financial statements, only in more detail. The proprietary fund financial statements provide separate information for each of the enterprise funds, all of which are considered to be major funds of the City. The internal service funds are presented in a single aggregated presentation in the proprietary fund financial statements. Fiduciary funds.Fiduciary funds are used to account for resources held for the benefit of parties outside the government. Fiduciary funds are not reflected in the government-wide financial statement because the resources of those funds are not available to support the City’s own programs. The accounting used for fiduciary funds is much like that used for proprietary funds. Notes to basic financial statements. The notes provide additional information that is essential to a full understanding of the data provided in the government-wide and fund financial statements. Other information.In addition to the basic financial statements and accompanying notes, this report also presents certain required supplementary information. This section includes a budgetary comparison schedule and related notes for the general fund, a schedule of funding progress for the other postemployment benefits plan of the City,and schedules related to the City’s participation in defined benefit pension plans administered by the Minnesota Public Employees Retirement Association (PERA) and the Lakeville Fire Relief Association. The combining statements referred to earlier in connection with nonmajor governmental funds are presented immediately following the required supplementary information. . Page 450 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (21) Government-wide Financial Analysis An analysis of the City’s financial position begins with a review of the Statement of Net Position and the Statement of Activities. These two statements report the City’s net position and changes in net position. It should be noted that the financial position can also be affected by nonfinancial factors, including economic conditions, population growth, and new regulations. As noted earlier, net position may serve over time as a useful indicator of the City’s financial position. As presented in the following condensed version of the Statement of Net Position, the City’s assets and deferred outflows of resources exceeded liabilities and deferred inflows of resources by $586,716,381 at December 31, 2024. By far the largest portion,or 78.2% of net position,is reflected in its net investment in capital assets (e.g. land, buildings and improvements, machinery and equipment, infrastructure, and construction in process) less any related debt used to acquire those assets that is still outstanding. The City uses these capital assets to provide services to citizens; consequently, these assets are not available for future spending. Although the City’s net investment in capital assets is reported net of related debt, it should be noted that the resources needed to repay this debt must be provided from other sources, since the capital assets themselves cannot be used to liquidate these liabilities. 2024 2023 2024 2023 2024 2023 Current and Other Assets 175,502,378$ 169,696,521$ 42,537,109$ 39,242,638$ 218,039,487$ 208,939,159$ Capital Assets 387,482,576 373,067,888 211,014,799 206,302,217 598,497,375 579,370,105 Total Assets 562,984,954 542,764,409 253,551,908 245,544,855 816,536,862 788,309,264 Deferred Outflows of Resources 15,072,562 19,363,267 490,953 955,128 15,563,515 20,318,395 Current and Other Liabilities 16,320,363 18,975,527 1,650,902 2,521,017 17,971,265 21,496,544 Other Liabilities 181,819,713 182,219,323 14,548,818 17,415,261 196,368,531 199,634,584 Total Liabilities 198,140,076 201,194,850 16,199,720 19,936,278 214,339,796 221,131,128 Deferred Inflows of Resources 29,663,812 28,915,650 1,380,388 1,001,511 31,044,200 29,917,161 Net Position: Net Investment in Capital Assets 259,538,899 240,978,608 199,011,990 192,611,852 458,550,889 433,590,460 Restricted 72,430,099 73,224,358 - - 72,430,099 73,224,358 Unrestricted 18,284,630 17,814,210 37,450,763 32,950,342 55,735,393 50,764,552 Total Net Position 350,253,628$ 332,017,176$ 236,462,753$ 225,562,194$ 586,716,381$ 557,579,370$ Governmental Activities TotalBusiness-Type Activities The City’s total restricted net position of $72,430,099 comprises 12.3% of total net position at the close of the fiscal year ended December 31, 2024. These assets are subject to external restrictions on how they may be used. The 2024 remaining balance of $55,735,393 (9.5% of total net position), in unrestricted net position may be used to meet the government’s ongoing obligations to citizens and creditors. The unrestricted net position of the City increased a total of $4,970,841 primarily due to a decrease in net pension liability as well as an increase in property taxes. Page 451 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (22) Change in net position.The City’s 2024 total net position during the current fiscal year increased by $29,137,011 as shown in the following table. This increase is primarily attributed to economic conditions and community growth. Additional details that account for the change in net position are provided in the following analysis of the governmental and business-type activities. 2024 2023 2024 2023 (as restated)2024 2023 (as restated) REVENUES Program Revenues: Charges for Services $ 18,843,137 $ 15,948,865 $ 43,934,809 $ 45,408,259 $ 62,777,946 61,357,124$ Operating Grants and Contributions 2,368,016 9,393,087 217,437 1,028,439 2,585,453 10,421,526 Capital Grants and Contributions 19,478,574 17,429,101 9,866,907 5,739,878 29,345,481 23,168,979 General Revenues: Property Taxes 44,289,880 40,247,761 - - 44,289,880 40,247,761 Franchise Taxes 531,252 601,288 - - 531,252 601,288 Unrestricted Investment Earnings 5,630,680 5,834,294 1,368,137 1,322,619 6,998,817 7,156,913 Total Revenues 91,141,539 89,454,396 55,387,290 53,499,195 146,528,829 142,953,591 EXPENSES General Government 9,524,931 9,899,710 - - 9,524,931 9,899,710 Public Safety 21,818,556 20,139,088 - - 21,818,556 20,139,088 Public Works 27,274,347 29,136,552 - - 27,274,347 29,136,552 Parks and Recreation 11,644,154 10,117,834 - - 11,644,154 10,117,834 Interest on Long-Term Debt 3,535,602 2,903,304 - - 3,535,602 2,903,304 Municipal Liquor - - 21,357,518 21,726,194 21,357,518 21,726,194 Utility - - 22,236,710 22,854,878 22,236,710 22,854,878 Total Expenses 73,797,590 72,196,488 43,594,228 44,581,072 117,391,818 116,777,560 CHANGE IN NET POSITION BEFORE TRANSFERS 17,343,949 17,257,908 11,793,062 8,918,123 29,137,011 26,176,031 Transfers and Contributions 892,503 (2,789,942) (892,503) 2,789,942 - - CHANGE IN NET POSITION 18,236,452 14,467,966 10,900,559 11,708,065 29,137,011 26,176,031 Net Position - Beginning of Year 332,017,176 317,549,210 225,562,194 213,854,129 557,579,370 531,403,339 NET POSITION - END OF YEAR 350,253,628$ 332,017,176$ 236,462,753$ 225,562,194$ 586,716,381$ 557,579,370$ Governmental Activities Business-Type Activities Total Change in Net Position Governmental activities.The governmental activities change in net position before transfers was an increase of $18,236,452. The governmental revenue increase in charges for services is directly related to an increase in economic, development and community growth. Operating grants decreased in 2024 mostly due to the timing of payments received and additional funds received in 2023 compared to 2024 for state-aid funded street maintenance and improvement projects in 2023. Capital grants and contributions increased due to additional new special assessments being assessed in 2024 and an increase in developer-installed assets reported during 2024 than in 2023. Page 452 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (23) Revenues The City’s 2024 total revenues for governmental activities increased by $1,687,143. Charges for services increased a total of $2,894,272 primarily attributable to continued economic development and community growth, as demonstrated by higher collections of park dedication fees, building permit revenues, and connection and area charges.A summary of the various decreases are shown as follows: 2024 2023 Increase / (Decrease) Charges for services Licenses and building permit fees 3,052,954$ 3,489,815$ (436,861)$ Connection and area charges 4,515,007 4,920,155 (405,148) Engineering fees - reconstruction projects 1,294,484 979,981 314,503 Park dedication fees 3,338,496 1,331,097 2,007,399 Other 6,642,196 5,227,817 1,414,379 Total charges for services 18,843,137$ 15,948,865$ 2,894,272$ Operating grants and contributions experienced an overall decrease of $7,025,071. Operating grants decreased in 2024 mostly due to the City receiving $3,156,649 of local public safety aid in 2023. Also, the level of state-aid funded street maintenance projects decreased compared to the prior year.A summary of the various operating grants and contributions are shown as follows: 2024 2023 Increase / (Decrease) Operating grants and contributions State-aid for street maintenance 238,712$ 3,636,809$ (3,398,097)$ State-aid for street revenue bonds 60,572 336,394 (275,822) State local public safety aid - 3,156,649 (3,156,649) Other grants, contributions and donations 2,068,732 2,263,235 (194,503) Total Operating grants and contributions 2,368,016$ 9,393,087$ (7,025,071)$ Page 453 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (24) Capital grants and contributions increased by $2,049,473. Contributed infrastructure from private land developers increased $1.6 million; the infrastructure consists of street, storm water, and park and trail capital assets. The summary of capital grants and contributions are shown as follows: 2024 2023 Increase / (Decrease) Capital grants and contributions Contributed infrastructure from developers 11,527,671$ 9,870,707$ 1,656,964$ Special assessments 1,434,675 1,148,080 286,595 Other grants and contributions 6,478,030 6,365,932 112,098 PEG fees 38,198 44,382 (6,184) Total capital grants and contributions 19,478,574$ 17,429,101$ 2,049,473$ Property tax revenue increased $4,042,119 or 10.0% primarily due to an increase in the overall tax levy.A higher collection rate also contributed to the increase. Cable franchise taxes of $531,252 were received in 2024 versus $601,288 in 2023. Investment income earnings decreased by $203,614. The decrease is the combination of earnings and changes in investment asset values which are inversely related to the changes in market rates. General revenues 2024 2023 Increase / (Decrease) Property taxes 44,289,880$ 40,247,761$ 4,042,119$ Franchise taxes 531,252 601,288 (70,036) Investment income 5,630,680 5,834,294 (203,614) Total general revenues 50,451,812$ 46,683,343$ 3,768,469$ Page 454 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (25) A summary of 2024 revenues by source for governmental activities is shown as follows: Cha rges f or Services , $18,843,137 , 21% Oper ating Gr ants and Contri butions , $2,368,016 , 3% Ca pi ta l Gr ants a nd Contributions , $19,478,574 , 21% Property Ta xes , $44,289,880 , 49% Unrestri cted Investmen t Ea rni ngs , $5,630,680 , 6% Franchi se T axes , $531,252 , 0% Revenue s by Source -Governme ntal A ctivit ie s Expenses The City’s 2024 total governmental activities expenses (before depreciation on capital assets and interest on long-term debt) decreased by $1,603,995 or 3.2%. Total governmental activities expenses increased by $1,601,102 or 2.2%, shown as follows: 2024 2023 Increase / (Decrease) Governmental activities expenses General government 9,062,867$ 9,491,848$ (428,981)$ Public safety 20,227,705 18,817,348 1,410,357 Public works 11,749,033 14,842,043 (3,093,010) Parks and recreation 6,998,916 6,491,277 507,639 Total before depreciation and interest 48,038,521 49,642,516 (1,603,995) Depreciation on capital assets 22,223,467 19,650,668 2,572,799 Interest on long-term debt 3,535,602 2,903,304 632,298 Total governmental activities expenses $ 73,797,590 $ 72,196,488 $ 1,601,102 Page 455 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (26) Following are explanations of various increases and (decreases) in expenses by governmental function as shown above. General government expenses decreased slightly by $428,981, or 4.5%primarily due to employees in key positions taking advantage of the advanced resignation policy which provides the City up to six months’ notice to hire and train the respective replacements. Savings also resulted from staff vacancies, restructuring, the completion of the ERP implementation, and delayed projects. Public safety expenses increased by $1,410,357,or 7.5%,primarily due to new hires in Police and Fire, including 6 full-time firefighters added mid-year as the city transitions to a hybrid fire staffing model. Public works expenses decreased by $3,093,010,or 20.8%,primarily due to fewer non-City asset improvement and maintenance projects in 2024 compared to 2023. Parks and recreation expenses increased $507,639,or 7.8%,primarily due to staffing transitions and expanded Arts Center programming funded by late-2023 Arts Board Grant. Seasonal costs are higher than the same period in 2023 due to the City's continued growth and increased seasonal positions. Depreciation on capital assets increased by $2,572,799 or 13.1%;primarily due to depreciation starting on recently completed projects. Interest on long-term debt increased by $632,298,or 21.8%; primarily due to current amortization of bond premiums. A summary of 2024 expenses by function for governmental activities is shown as follows: General go vernment, $9,062,867 , 12% Publ ic safety, $20,227,705 , 27% Publ ic works, $11,749,033 , 16% Parks a nd recreation, $6,998,916 , 10% Depreciation on capi ta l assets , $22,223,467 , 30% Inter es t on l ong-term debt, $3,535,602 , 5% Expens es by Function -Governmental Activit ie s Page 456 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (27) Business-type activities.Business-type activities increased the City’s 2024 total net position by $10,900,559. Key elements of the increase in net position along with a comparison of revenues, expenses, and changes in net position during fiscal years 2024 and 2023 are shown as follows: 2024 2023 Increase / (Decrease) Revenues Charges for services Liquor 22,647,127$ 22,692,555$ (45,428)$ Utility 21,287,682 22,715,704 (1,428,022) Operating grants and contributions Liquor 38,882 163 38,719 Utility 178,555 1,028,276 (849,721) Capital contributions Utility 9,866,907 5,739,878 4,127,029 Investment earnings 1,368,137 1,322,619 45,518 Total revenues 55,387,290 53,499,195 1,888,095 Expenses Liquor 21,357,518 21,726,194 (368,676) Utility 22,236,710 22,854,878 (618,168) Total expenses 43,594,228 44,581,072 (986,844) Change in net position before transfers 11,793,062 8,918,123 2,874,939 Transfers (892,503) 2,789,942 (3,682,445) Change in net position 10,900,559 11,708,065 (807,506) Net position - beginning, as restated 225,562,194 213,854,129 11,708,065 Net position - ending $ 236,462,753 $ 225,562,194 10,900,559$ The City’s 2024 business-type total revenues increased by $1,888,095 or 3.53%; the various revenue components are discussed in detail in the following paragraphs. The liquor fund 2024 charges for services stayed relatively consistent due to all four stores operating for the full 12 months in 2023 and 2024. The 2024 cost of goods sold as a percentage of sales were 72.1%, compared to 72.7% in 2023. The overall utility revenue charges for services decreased by $1,428,022. This overall decrease is represented by a water revenue decrease of $2,275,571, sanitary sewer revenue increase of $633,387, streetlight revenue increase of $66,069, and environmental resources revenue increase of $148,093. The decrease in water and increase in sanitary sewer are due to customer consumption because of changes in weather patterns, rate increases, and change in in the number of customers. The streetlight and environmental resources funds increases are due to an increase in customers. Investment earnings increased $45,518. The increase is the combination of increased earnings and changes in investment asset values which are inversely related to the changes in market rates. Page 457 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (28) The utility fund experienced a total increase of $4,127,029 in capital contributions. The majority of the increase is derived from water and sanitary sewer contributed from developer improvement projects (greater number of contributions during 2024). City improvement project infrastructure assets of $1,264,516 were contributed to the utility fund which is within the net transfer in amount of $892,503 on the Statement of Activities. The total amount of contributed infrastructure assets received by the utility fund varies yearly. The City’s 2024 business-type total expenses decreased by $986,844 or 2.2% as follows: Liquor Fund Utility Fund Total Business-type activities expenses Cost of Goods Sold (143,610)$ -$ (143,610)$ Personnel services (180,513) (76,612) (257,125) Commodities (38,776) (35,376) (74,152) Other charges and services (114,286)(1,485,536) (1,599,822) Sanitary sewage treatm ent and disposal - 315,535 315,535 Depreciation on capital assets 41,648 696,775 738,423 Interest, fiscal charges, bond premium (net)(3,035) (12,749) (15,784) Loss on Disposal of Capital Assets 69,896 (20,205) 49,691 Total Business-type Expenses $ (368,676) $ (618,168) $ (986,844) Increase (Decrease) from 2023 The liquor fund cost of goods sold decreased $143,610 which is proportionate to the decrease in sales. Liquor fund personnel services expenses decreased $180,513, while utility fund personnel services expenses decreased $76,612. The liquor decrease was the result of staff restructuring. The utility decrease reflects the replacement of retiring employees with employees at the lower end of the pay grade . Utility fund other charges and services expenses decreased by $1,485,536 while the liquor fund decreased by $114,286. Water expenses decreased primarily due to a drop in major maintenance projects including, watermain repairs (costs to fix watermain breaks are not capitalizable). Sewer expenses increased due to higher sanitary sewer costs incurred on the annual street projects in 2024 as compared to 2023. The utility fund sanitary sewage treatment and disposal expenses increased by $315,535 primarily due to the change in factors used by MCES in their pass-through cost allocation to the City. The City’s annual cost increased 6.2% to $5,382,250 and the City’s wastewater accounts for 1.91% of the total flow through the regional system. Utility fund depreciation increased 696,775 due to additional machinery, equipment and infrastructure assets that are depreciated in 2024 in comparison to 2023. Page 458 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (29) Financial Analysis of the City’s Funds As noted earlier, the City uses fund accounting to ensure and demonstrate compliance with finance- related legal requirements. Some funds are required statutorily while others are established internally to assist management in accounting for certain activities. Governmental funds.The focus of the City’s governmental funds is to provide information on near- term inflows, outflows, and balances of spendable resources. Such information is useful in assessing the City’s financing requirements. In particular, unrestricted fund balance may serve as a useful measure of a government’s net resources available for spending at the end of the fiscal year. As of the end of the current fiscal year, the City’s governmental funds reported combined ending fund balances of $128,104,741. Of this amount, $68,639,377 or 53.6%of this combined ending fund balance constitutes fund balance that is available for spending at the government’s discretion.Nonspendable fund balances of $352,765 are amounts that are not in a spendable form, such as prepaid items and inventory. The remaining fund balance is restricted for (a)debt service of $23,590,844, (b)capital acquisition of $19,809,666, (c) Parks Bond Referendum of $12,015,427, (d) public safety aid of $3,156,649,and (e)other restricted purposes of $540,013. The general fund is the chief operating fund of the City. At the end of the current fiscal year, the fund balance was $23,186,629, an increase from the prior year of $813,632, resulting from $737,498 of revenues over expenditures, net transfers out of $11,998,and a change in supplies inventory of $64,136. The debt service fund balance increased by $1,399,550 due to the related debt service fund revenues, bond issuance proceeds and net transfers in exceeding debt service requirements.Even though debt requirements exceeded property tax and special assessment revenues, transfers in of excess bond proceeds from improvement projects helped to offset this deficiency. The capital project fund accounts for infrastructure reconstruction projects that require debt issuance for financing purposes, the accumulation and disbursement of funds for the construction or improvement of public buildings, the City’s municipal state aid projects and financing, and various other capital activity. The activity of this fund fluctuates from year to year depending on the scope of the project, based on state aid allotments and projects completed, and based on the City’s building improvement needs. The fund balance increased by $3,589,859 due to the influx of bond proceeds in 2024. Page 459 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (30) General Fund Budgetary Highlights With the exception of the police and arts center departments, all other general fund departments expended their 2024 budget appropriations at or below the final adopted budget.A schedule of revenues, expenditures and changes in fund balances –budgetary comparison is disclosed in the required supplemental information section of this report. A summary of general fund revenues, expenditures, other financing sources (uses), variance with final budget, and net change in fund balance is as follows: Budget As Originally Adopted Final Budget Actual Variance with Final Budget Revenues Property taxes 29,821,150$ 29,821,150$ 29,513,138$ (308,012)$ Licenses and perm its 3,262,810 2,962,810 3,052,954 90,144 Intergovernm ental 1,596,841 1,904,208 2,172,655 268,447 Charges for services 3,059,510 3,224,220 3,870,497 646,277 Special assessments - - 9,321 9,321 Fines 240,000 240,000 222,790 (17,210) Interest income 311,190 611,190 470,764 (140,426) Change in value of investments - - 398,037 398,037 Donations 45,200 45,200 76,290 31,090 Miscellaneous 38,884 61,284 80,841 19,557 Total revenues 38,375,585 38,870,062 39,867,287 997,225 Expenditures Personnel services 30,448,662 30,094,373 29,675,508 (418,865) Commodities 2,372,867 2,356,432 2,127,178 (229,254) Other charges and services 7,822,296 7,865,334 7,235,048 (630,286) Capital outlay 71,745 81,745 92,055 10,310 Other 250,000 - - - Total expenditures 40,965,570 40,397,884 39,129,789 (1,268,095) Other financing sources (uses) 1,061,571 11,998 11,998 - Net change in fund balance $ (1,528,414) $ (1,515,824)749,496$ 2,265,320$ The 2024 actual general fund revenues were over the final budget by $997,225 and expenditures were under final adopted budget by $1,268,095. Other financing sources (uses) came in at the final budgeted amount. The general fund actual net change in fund balance surpassed final budget by $2,265,320. The General Fund budget was amended to reflect higher state aid grants, program and investment revenues, while building permit revenues were reduced due to lower-than-expected projections. Expenditures were adjusted for personnel contingency allocation, additional recreation and arts programs, election services, and timing shifts in professional services. Page 460 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (31) The following is a brief summary explanation of the various budgets to actual variances for revenues: Property taxes were lower than anticipated by $308,012 due in part to slightly lower than anticipated current tax collection rates and moderately lower than expected delinquent tax collections. All delinquent taxes are recorded in the General Fund and the other funds receive 100 percent of their current levy. Licenses and permits exceeded estimates by $90,144 due to change in the mix of building permits from single family to multi-family homes. The number of residential building permits budgeted were 300 compared to 285 actual. Permits for townhomes were budgeted at 140 units compared to 149 actual units. Intergovernmental revenues exceeded estimates by $268,447 mainly due to the City's receipt of $131,962 in state aid contributions to PERA, federal grants of $53,869 and state grants of $91,699. Charges for services experienced a variance of $646,277 mainly due to engineering-related services with developer construction administration. Fines were less than final budgeted amounts by $17,210. Interest income and the change in value of investments were higher than the final budget amount by $257,611 due to favorable market conditions. The City’s Management employs prudent investment practices and cash management techniques to maximize investment income while protecting the City’s treasury. Investments are typically held to maturity. Donations and miscellaneous revenues experienced positive variances of $31,090 and $19,557, respectively. The following is a brief summary explanation of the various budgets to actual variances for expenditures: Personnel costs including benefits were $418,865 below budget estimates due to vacancies in inspections and construction services as well as employee transition costs in community development. Commodities were $229,254 under budget due to reduced maintenance supplies, snow/ice control materials, and street signs. Other charges and services were $630,286 below budget which is attributed to several factors. Departments under budget in this area saved costs due to either internal staff handling the services, or reduced service needs from lower development activity. Capital outlay was $10,310 over budget costs incurred for the Arts Board Grant awarded in late 2023. Page 461 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (32) Capital Asset and Debt Administration Capital assets.The City’s capital assets for governmental and business-type activities as of December 31, 2024 are $598 million (net of accumulated depreciation and amortization).This amount represents an increase (including additions, deletions, and depreciation and amortization) of approximately $19 million from 2023. The net investment in capital assets including land, historical treasures, buildings, machinery and equipment, other improvements, infrastructure, and construction in process is shown as follows: Governmental Activities Business-Type Activities Total Land 37,683,547$ 3,672,969$ 41,356,516$ Historical treasures 218,700 - 218,700 Construction in process 14,128,422 37,894 14,166,316 Buildings and improvem ents 77,751,280 34,490,655 112,241,935 Machinery and equipment 31,499,293 9,071,740 40,571,033 Other improvements 22,782,454 - 22,782,454 Right-to-use assets - buildings - 3,989,676 3,989,676 Infrastructure Streets 240,482,212 - 240,482,212 Storm sewer 144,176,648 - 144,176,648 Parks 45,799,613 - 45,799,613 Environmental resources - 563,963 563,963 Water - 156,657,556 156,657,556 Sanitary sewer - 106,933,457 106,933,457 Total Capital Assets 614,522,169 315,417,910 929,940,079 Less: Accumulated Depreciation/ Amortization (227,039,593) (104,403,111) (331,442,704) Total Capital Assets, Net 387,482,576$ 211,014,799$ 598,497,375$ Capital Assets at Year-End (Net of Accumulated Depreciation) The City’s 2024 amended budget provides funding for $65.6 million in infrastructure capital assets, public building improvements and upgrades, equipment capital assets such as vehicle replacements for public safety and public works, and technology equipment. Refer to Note 3 –Capital Assets, of the Notes to Basic Financial Statements for additional information. Page 462 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (33) Debt administration.At the end of the current fiscal year, the City of Lakeville had total bonded debt and long-term lease liabilities outstanding of $158.497 million, which is a net increase of $8.363 million compared to the prior year. The increase is due to the issuance of the $21.53 million 2024A General Obligation bonds exceeding payments on existing bonded debt. The City manages its debt structure by utilizing approaches that take full advantage of its financial position, revenue trends,and conditions in municipal bond markets. Refer to Note 5 –Long-Term Liabilities, of the Notes to Basic Financial Statements for additional information about the City’s governmental and business-type long-term debt activity. The City’s outstanding bonded obligation debt as of December 31, 2024 is shown as follows: Balance January 1 Issued Redeem ed Balance December 31 Governm ental Activities G.O. bonds General obligation bonds $ 53,025,000 $ 15,075,000 $ 3,525,000 $ 64,575,000 G.O. improvement 57,630,000 6,455,000 6,285,000 57,800,000 State-aid street revenue 3,470,000 - 210,000 3,260,000 Water revenue 5,590,000 - 465,000 5,125,000 Tax abatement 17,310,000 - 1,020,000 16,290,000 Total governmental activities 137,025,000 21,530,000 11,505,000 147,050,000 Business-Type Activities Water revenue 8,380,000 - 965,000 7,415,000 Sewer revenue 135,000 - 65,000 70,000 Street light revenue 145,000 - 45,000 100,000 Financed purchase arrangement 1,075,000 - 260,000 815,000 Lease liability 3,374,280 - 327,201 3,047,079 Total business-type activities 13,109,280 - 1,662,201 11,447,079 Total bonds payable 150,134,280$ 21,530,000$ 13,167,201$ 158,497,079$ Bonds and Leases Payable Outstanding Debt Credit Rating The City of Lakeville's general obligation bond rating as of December 31, 2024 is "Aaa" as rated by Moody's Ratings. On May 31, 2024 Moody's Ratings affirmed the city's Aaa issuer rating, Aaa GOULT (General Obligation Unlimited Tax) ratings, and Aa2 lease revenue rating. Moody's Ratings' May 2024 Credit Opinion summary stated "The City of Lakeville benefits from a growing economy in the Twin Cities metro area with very strong resident income, a robust financial position and low fixed-costs. Leverage will likely remain moderate despite some future capital needs." Page 463 of 899 CITY OF LAKEVILLE MANAGEMENT’S DISCUSSION AND ANALYSIS YEAR ENDED DECEMBER 31,2024 (34) State statutes limit the amount of general obligation debt a Minnesota city may issue to 3% of total assessor’s taxable market valuation. The City has $73,548,737 of net bonded debt, which is subject to the $376,398,316 current debt limitation, thereby resulting in a legal debt margin of $302,849,579. Refer to the Statistical Section of this report for a detailed computation of the City’s legal debt margin. Economic Conditions and Next Year’s Budget The City of Lakeville remains one of the top growth cities in the Minnesota twin city metro area. The trend for building permit activity for single family homes is steady and increased from last year. The building permits for single family homes/detached townhomes increased from 367 in 2023 compared to 385 permits in 2025. The budget and five-year capital improvement plan are premised on the assumption growth will continue at a subdued level for the foreseeable future. The adopted 2025 budget meets the city's growing program and service levels, adding 16 new positions -15 full-time firefighters (funded by a new SAFER grant) and one police officer. The 2025 budget uses no reserves for one-time or long-term purchases, despite allowance of such under the city's Fund Balance policy. The 2025 budget supports the Envision Lakeville Vision Plan by investing in technology, strategic partnerships, infrastructure, and staffing to enhance efficiency, foster development, and meet community expectations. Requests for Information This financial report is designed to provide a general overview of the City of Lakeville’s finances for all those with an interest in the government’s finances. Questions concerning any of the information provided in this report or requests for additional financial information should be directed to the City of Lakeville Finance Department at 20195 Holyoke Avenue, Lakeville, Minnesota 55044, (952) 985-4400, or email request to jstahl@lakevillemn.gov. Page 464 of 899 BASIC FINANCIAL STATEMENTS Page 465 of 899 CITY OF LAKEVILLE STATEMENT OF NET POSITION DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (35) Governmental Activities Business-Type Activities Total ASSETS Cash and investments 138,747,612$ 33,531,434$ 172,279,046$ Receivables 32,251,235 6,323,961 38,575,196 Internal balances (251,813) 251,813 - Inventories 308,206 2,415,487 2,723,693 Prepaid items 44,559 14,414 58,973 Restricted assets (temporarily): Investments held by trustee 272 - 272 Net pension asset - fire relief 4,402,307 - 4,402,307 Capital assets: Nondepreciable 52,030,669 3,710,863 55,741,532 Depreciable, net 335,451,907 207,303,936 542,755,843 Total capital assets 387,482,576 211,014,799 598,497,375 Total assets 562,984,954 253,551,908 816,536,862 DEFERRED OUTFLOWS OF RESOURCES OPEB related deferments 255,376 52,990 308,366 Pension plan deferments - PERA 14,611,361 437,963 15,049,324 Pension plan deferments - fire relief 205,825 - 205,825 Total deferred outflows of resources 15,072,562 490,953 15,563,515 LIABILITIES Salaries, accounts, contracts, and deposits payable 13,515,523 1,421,073 14,936,596 Accrued interest 2,464,515 122,029 2,586,544 Unearned revenue 340,325 107,800 448,125 Noncurrent liabilities: Net pension liability - PERA due in more than one year 13,086,392 1,706,150 14,792,542 Total OPEB Liability due within one year 38,437 6,345 44,782 Total OPEB Liability due in more than one year 955,227 199,838 1,155,065 Other long-term liabilities due within one year 15,508,292 2,161,743 17,670,035 Other long-term liabilities due in more than one year 152,231,365 10,474,742 162,706,107 Total liabilities 198,140,076 16,199,720 214,339,796 DEFERRED INFLOWS OF RESOURCES Deferred gain on refunding 844,291 - 844,291 Leases 8,124,692 - 8,124,692 OPEB-related deferments 411,731 85,434 497,165 Pension plan deferments - PERA 18,445,405 1,294,954 19,740,359 Pension plan deferments - fire relief 1,837,693 - 1,837,693 Total deferred inflows of resources 29,663,812 1,380,388 31,044,200 NET POSITION Net investment in capital assets 259,538,899 199,011,990 458,550,889 Restricted for: Special purposes 429,105 - 429,105 Debt service 33,709,823 - 33,709,823 Capital acquisition 30,317,533 - 30,317,533 Public safety 3,156,649 - 3,156,649 Opioid remediation activities 414,682 - 414,682 Fire relief pensions 4,402,307 - 4,402,307 Unrestricted 18,284,630 37,450,763 55,735,393 Total Net Position 350,253,628$ 236,462,753$ 586,716,381$ Primary Government Page 466 of 899 CITY OF LAKEVILLE STATEMENT OF ACTIVITIES YEAR ENDED DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (36) Functions/Programs Expenses Charges for Services Operating Grants and Contributions Capital Grants and Contributions Governmental Activities Business-Type Activities Total Primary Government: Governmental Activities: General government 9,524,931$ 7,452,928$ 175,668$ 380,326$ (1,516,009)$ -$ (1,516,009)$ Public safety 21,818,556 819,342 1,823,715 - (19,175,499) - (19,175,499) Public works 27,274,347 5,774,455 249,629 18,802,885 (2,447,378) - (2,447,378) Parks and recreation 11,644,154 4,796,412 119,004 295,363 (6,433,375) - (6,433,375) Interest on long-term debt 3,535,602 - - - (3,535,602) - (3,535,602) Total-governmental activities 73,797,590 18,843,137 2,368,016 19,478,574 (33,107,863) - (33,107,863) Business-Type Activities: Liquor 21,357,518 22,647,127 38,882 - - 1,328,491 1,328,491 Utility 22,236,710 21,287,682 178,555 9,866,907 - 9,096,434 9,096,434 Total Business-Type Activities 43,594,228 43,934,809 217,437 9,866,907 - 10,424,925 10,424,925 Total Primary Government 117,391,818$ 62,777,946$ 2,585,453$ 29,345,481$ (33,107,863) 10,424,925 (22,682,938) General Revenues: Property taxes 44,289,880 - 44,289,880 Franchise taxes 531,252 - 531,252 Investment income 5,630,680 1,368,137 6,998,817 Transfers 892,503 (892,503) - Total general revenues and transfers 51,344,315 475,634 51,819,949 Change in Net Position 18,236,452 10,900,559 29,137,011 Net Position - Beginning of Year, As Originally Reported 332,017,176 221,210,035 553,227,211 Restatement (see Note 22)- 4,352,159 4,352,159 Beginning of Year, as Restated 332,017,176 225,562,194 557,579,370 Net Position - End of Year 350,253,628$ 236,462,753$ 586,716,381$ Program Revenues Primary Government Net (Expense) Revenue and Changes in Net Position Page 467 of 899 CITY OF LAKEVILLE BALANCE SHEET GOVERNMENTAL FUNDS DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (37) Nonmajor Total General Debt Service Capital Projects Governmental Governmental ASSETS Fund Fund Fund Funds Funds Cash and investments 31,074,728$ 23,248,030$ 81,741,951$ 1,557,297$ 137,622,006$ Investments held by trustee - 272 - - 272 Interest receivable 114,920 93,735 513,760 8,074 730,489 Taxes receivable 2,090,389 - - - 2,090,389 Accounts receivable 716,280 513,751 5,157,866 868,731 7,256,628 Due from other funds - - 187,445 - 187,445 Special assessments receivable 136,154 11,521,921 1,962,555 - 13,620,630 Leases and financed purchases receivable 40,292 815,000 8,491,666 - 9,346,958 Inventory 308,206 - - - 308,206 Prepaid items 44,559 - - - 44,559 Total Assets 34,525,528$ 36,192,709$ 98,055,243$ 2,434,102$ 171,207,582$ LIABILITIES, DEFERRED INFLOWS OF RESOURCES, AND FUND BALANCE LIABILITIES Salaries payable 680,885$ -$ -$ 10,702$ 691,587$ Accounts payable 1,090,053 18,370 3,295,099 2,724 4,406,246 Due to other funds - - 187,445 - 187,445 Deposits payable 8,228,705 - 184,777 - 8,413,482 Unearned revenue 190,325 - 150,000 - 340,325 Total Liabilities 10,189,968 18,370 3,817,321 13,426 14,039,085 DEFERRED INFLOWS OF RESOURCES Unavailable revenue - taxes 361,737 - - - 361,737 Unavailable revenue - special assessments 749,054 11,492,923 1,962,437 - 14,204,414 Leases and financed purchases 38,140 815,000 8,041,385 45,167 8,939,692 Unavailable revenue - other - 275,572 4,543,377 738,964 5,557,913 Total Deferred Inflows of Resources 1,148,931 12,583,495 14,547,199 784,131 29,063,756 FUND BALANCE Nonspendable 352,765 - - - 352,765 Restricted 1,850,000 23,590,844 33,131,742 540,013 59,112,599 Committed - - 46,874,760 1,096,532 47,971,292 Unassigned (Deficit)20,983,864 - (315,779) - 20,668,085 Total Fund Balance 23,186,629 23,590,844 79,690,723 1,636,545 128,104,741 Total Liabilities, Deferred Inflows of Resources, and Fund Balance 34,525,528$ 36,192,709$ 98,055,243$ 2,434,102$ 171,207,582$ Page 468 of 899 CITY OF LAKEVILLE RECONCILIATION OF THE BALANCE SHEET TO THE STATEMENT OF NET POSITION GOVERNMENTAL ACTIVITIES DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (38) Total Fund Balances for Governmental Funds 128,104,741$ Total net position reported for governmental activities in the statement of net Capital assets used in governmental funds are not financial resources and, Governmental capital assets 614,522,169$ Less: Accumulated depreciation and amortization (227,039,593) 387,482,576 Net pension assets are only recorded in the government-wide financial statements 4,402,307 Long-term liabilities are not payable with current financial resources and, therefore, Bonds (147,050,000) Accrued interest (2,464,515) Loan (2,956,795) Note Payable (5,174,148) Unamortized bond premium (8,707,323) Deferred gain on refunding (844,291) (167,197,072) The City's net pension liability and related and deferred inflows and deferred outflows are recorded only on the statement of net position. Balances at year-end Net pension liability (13,086,392) Deferred inflows of resources (20,283,098) Deferred outflows of resources 14,817,186 (18,552,304) Total OPEB liabilities are not payable with current financial resources and, (993,664) OPEB related deferred outflows of resources are recorded only on the statement 255,376 OPEB related deferred inflows of resources are recorded only on the statement (411,731) Deferred inflows of resources related to unavailable revenue in governmental 20,124,064 The City uses an internal service fund to charge the cost of insurance activities and compensated absences to individual funds. A portion of the assets and liabilities of the municipal reserves fund and compensated absences fund are included in (2,960,665) Total Net Position of Governmental Activities 350,253,628$ of net position. are: funds are susceptible to full accrual on the government-wide statements. governmental activities in the Statement of Net Position. therefore, are not reported in the governmental funds. of net position. position is different because: therefore, are not reported in the funds. Those assets consist of: are not reported in the governmental funds. as they are not current financial resources to governmental funds. Page 469 of 899 CITY OF LAKEVILLE STATEMENT OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES GOVERNMENTAL FUNDS YEAR ENDED DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (39) Nonmajor Total General Debt Service Capital Projects Governmental Governmental Fund Fund Fund Funds Totals REVENUE Property taxes 29,513,138$ 11,537,150$ 2,550,000$ -$ 43,600,288$ Tax increment - - 729,439 - 729,439 Licenses and permits 3,052,954 - - - 3,052,954 Franchise Taxes - - - 531,252 531,252 Intergovernmental 2,172,655 60,572 1,521,762 230,207 3,985,196 Charges for services 3,870,497 551,961 10,000,847 38,548 14,461,853 Special assessments 9,321 2,528,375 408,289 - 2,945,985 Fines 222,790 - - - 222,790 Interest income 470,764 388,847 2,501,284 33,059 3,393,954 Change in fair value of investments 398,037 324,740 1,485,978 27,971 2,236,726 Donations 76,290 - 257,643 - 333,933 Miscellaneous 80,841 - 568,693 187,148 836,682 Total Revenue 39,867,287 15,391,645 20,023,935 1,048,185 76,331,052 EXPENDITURES Current: General government 7,863,312 - - 720,193 8,583,505 Public safety 19,567,238 - - - 19,567,238 Public works 5,611,535 - - - 5,611,535 Parks and recreation 5,995,649 - - - 5,995,649 Capital Outlay: General government 36,772 - 1,536,581 24,858 1,598,211 Public safety - - 2,271,694 - 2,271,694 Public works 2,259 - 18,403,391 - 18,405,650 Parks and recreation 53,024 - 12,453,396 - 12,506,420 Debt Service: Principal bond maturities - 11,505,000 5,659,120 - 17,164,120 Interest on debt - 4,936,874 - - 4,936,874 Fiscal charges - 33,630 75,547 - 109,177 Total Expenditures 39,129,789 16,475,504 40,399,729 745,051 96,750,073 EXCESS (DEFICIENCY) OF REVENUE OVER (UNDER) EXPENDITURES 737,498 (1,083,859) (20,375,794) 303,134 (20,419,021) OTHER FINANCE SOURCES (USES) Issuance of bonds and other debt - 530,802 21,764,990 - 22,295,792 Premium on issued debt - - 1,389,304 - 1,389,304 Proceeds from the sale of capital assets - - 414,647 - 414,647 Transfers in from other funds 226,998 1,952,607 1,075,300 - 3,254,905 Transfers out to other funds (215,000) - (678,588) (204,298) (1,097,886) Total Other Finance Sources (Uses)11,998 2,483,409 23,965,653 (204,298) 26,256,762 NET CHANGE IN FUND BALANCES 749,496 1,399,550 3,589,859 98,836 5,837,741 FUND BALANCES Beginning of Year, as previously reported 22,372,997 22,191,294 76,100,864 1,537,709 122,202,864 Change in Supplies - Inventory 64,136 - - - 64,136 End of Year 23,186,629$ 23,590,844$ 79,690,723$ 1,636,545$ 128,104,741$ Page 470 of 899 CITY OF LAKEVILLE RECONCILIATION OF THE STATEMENT OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES TO THE STATEMENT OF ACTIVITIES YEAR ENDED DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (40) Net Change in Fund Balances-Total Governmental Funds 5,837,741$ Am ounts reported for governmental activities in the statement of activities are different because: Governmental funds report capital outlays as expenditures while the government-wide statement of activities reports depreciation expense to allocate those expenditures over the life of the assets. As a result, fund balance decreases by the amount of financial resources expended, whereas net position decreases by the amount of depreciation expense charged for the year. This is the amount by which depreciation expense exceeded capital outlay. Capital outlay 25,798,130$ Capital contributed by developer 11,527,671 Depreciation expense (22,223,467) 15,102,334 In the government-wide statement of activities, only the gain or loss on the sale of capital assets is reported, whereas in the governmental funds, the proceeds from the sales increases financial resources. Thus, the change in net position differs from the change (687,646) Governmental funds report inventory related to snow removing chemicals as an expenditure at the time of purchase rather than when it is consumed. The change in supplies is shown as a direct adjustment to fund balance. On the government-wide statement of activities, inventories are shown as an expenditure when consumed. As a 64,136 Revenues in the government-wide statement of activities that do not provide current Deferred inflows of resources - December 31, 2023 (16,844,233) Deferred inflows of resources - December 31, 2024 20,124,064 3,279,831 Bond proceeds are reported as other financing sources in governmental funds and thus contribute to the increase in fund balance. Bond and loan principal maturities are reported as expenditures in governmental funds thus reducing fund balance. In the government- wide statements, however, issuing debt increases long-term liabilities while debt (22,295,792) 17,164,120 (5,131,672) Governmental funds report the effect of premiums, discounts and similar items when debt is first issued, whereas material amounts are deferred and amortized in the statement Change in accrued interest payable (371,867) Premium on bonds issued in the current year (1,389,304) Amortization of deferred gain on refunding 163,152 Amortization of debt premiums/discounts 1,719,164 121,145 In the statement of activities, certain operating expenses and other postemployment benefit expenses - are measured by amounts earned during the year. In the governmental funds, however, expenditures for these items are measured by the (64,088) (272,178) (13,151) Change in Net Position of Governmental Activities 18,236,452$ such as insurance, to individual funds. This amount represents a portion of the change in net position of the internal service fund, which are reported in with the governmental Bond and loan proceeds Bond and loan principal maturities Pension expenditures in the governmental funds are measured by current year employer contributions. Pension expenses on the statement of activities are measured by the change activities. financial resources are not reported as revenues in the governmental funds. result, the change in net position must be adjusted by the change in supplies. in fund balance by the net book value of the capital assets disposed of. repayment reduces long-term liabilities thus affecting the statement of activities. of activities. resources. amount of financial resources used (and amounts actually paid). in the net pension liability(asset) and the related deferred inflows and outflows of Internal service funds are used by management to charge the costs of certain activities, Page 471 of 899 CITY OF LAKEVILLE STATEMENT OF NET POSITION PROPRIETARY FUNDS DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (41) Governmental Activities - Internal Service Liquor Utility Totals Funds ASSETS AND DEFERRED OUTFLOWS OF RESOURCES CURRENT ASSETS Cash and investments 3,627,065$ 29,904,369$ 33,531,434$ 1,125,606$ Interest receivable 16,723 164,272 180,995 6,379 Accounts receivable - 6,142,966 6,142,966 14,762 Inventory 2,085,150 330,337 2,415,487 - Prepaid expenses - 14,414 14,414 - Total current assets 5,728,938 36,556,358 42,285,296 1,146,747 NONCURRENT ASSETS Capital assets: Land 3,087,882 585,087 3,672,969 - Construction in progress - 37,894 37,894 - Buildings and improvements 8,256,341 26,234,314 34,490,655 - Machinery and equipment 765,513 8,306,227 9,071,740 - Infrastructure - 264,154,976 264,154,976 - Right-to-use lease asset 3,989,676 - 3,989,676 - Accumulated depreciation / amortization (2,492,837) (101,910,274) (104,403,111) - Net capital assets 13,606,575 197,408,224 211,014,799 - Total noncurrent assets 13,606,575 197,408,224 211,014,799 - Total assets 19,335,513 233,964,582 253,300,095 1,146,747 DEFERRED OUTFLOWS OF RESOURCES Pension plan deferments - PERA 215,432 222,531 437,963 - OPEB related deferments 26,753 26,237 52,990 - Total deferred outflows of resources 242,185 248,768 490,953 - Total Assets and Deferred Outflows of Resources 19,577,698$ 234,213,350$ 253,791,048$ 1,146,747$ LIABILITIES, DEFERRED INFLOWS OF RESOURCES, AND NET POSITION CURRENT LIABILITIES Salaries payable 58,688$ 58,871$ 117,559$ -$ Accounts payable 761,995 486,909 1,248,904 4,208 Accrued interest payable 2,929 119,100 122,029 - Deposits payable 44,710 9,900 54,610 - Accrued compensated absences 136,006 295,431 431,437 2,598,292 Unearned revenue - 107,800 107,800 - Total OPEB liability due within one year 2,537.00 3,808.00 6,345 - Lease liability and financed purchase payable - current 600,306 - 600,306 - Long-term debt - current - 1,130,000 1,130,000 - Total current liabilities 1,607,171 2,211,819 3,818,990 2,602,500 NONCURRENT LIABILITIES Accrued compensated absences 103,109 99,130 202,239 1,253,099 Net pension liability - PERA due in more than one year 839,250 866,900 1,706,150 - Total OPEB liability 101,559 98,279 199,838 - Lease liability and financed purchase payable 3,261,773 - 3,261,773 - Long-term debt - 7,010,730 7,010,730 - Total noncurrent liabilities 4,305,691 8,075,039 12,380,730 1,253,099 Total liabilities 5,912,862 10,286,858 16,199,720 3,855,599 DEFERRED INFLOWS OF RESOURCES Pension plan deferments - PERA 636,984 657,970 1,294,954 - OPEB related deferments 43,133 42,301 85,434 - Total deferred inflows of resources 680,117 700,271 1,380,388 - NET POSITION Net investment in capital assets 9,744,496 189,267,494 199,011,990 - Unrestricted 3,240,223 33,958,727 37,198,950 (2,708,852) Total net position 12,984,719 223,226,221 236,210,940 (2,708,852) Total Liabilities, Deferred Inflows of Resources, and Net Position 19,577,698$ 234,213,350$ 253,791,048 1,146,747$ Explanation of difference between Enterprise Funds, Statement of Net Position, and government-wide Statement of Net Position: The City uses an internal service fund to charge the cost of its insurance activities to individual funds. This amount consists of the necessary adjustments to reflect the consolidation of internal service fund activities:251,813 Net position of business-type activities 236,462,753$ Enterprise Funds Business-type Activities - Page 472 of 899 CITY OF LAKEVILLE STATEMENT OF REVENUES, EXPENSES, AND CHANGES IN NET POSITION PROPRIETARY FUNDS YEAR ENDED DECEMBER 31,2024 See accompanying Notes to Basic Financial Statements. (42) Governmental Activities - Internal Service Liquor Utility Total Funds OPERATING REVENUE Sales 22,647,127$ -$ 22,647,127$ -$ Cost of sales (16,331,345) - (16,331,345) - User charges - 20,775,952 20,775,952 706,522 Other - 511,730 511,730 316,592 Total operating revenue 6,315,782 21,287,682 27,603,464 1,023,114 OPERATING EXPENSES Personnel services 3,004,329 3,394,000 6,398,329 289,838 Commodities 72,674 810,494 883,168 - Other charges and services 1,162,484 5,911,604 7,074,088 669,167 Disposal charges - 5,382,250 5,382,250 - Depreciation and amortization 715,458 6,703,894 7,419,352 - Total operating expenses 4,954,945 22,202,242 27,157,187 959,005 OPERATING INCOME 1,360,837 (914,560) 446,277 64,109 NONOPERATING REVENUE (EXPENSES) Intergovernmental - grants 38,882 178,555 217,437 - Interest Income 68,472 672,633 741,105 26,119 Change in Fair Value of Investments 57,932 569,100 627,032 6,745 Interest, fiscal charges, bond premium (net)(36,572) (120,540) (157,112) - Disposal of capital assets (69,896) 11,188 (58,708) - Total nonoperating revenue (expenses)58,818 1,310,936 1,369,754 32,864 INCOME (LOSS) BEFORE CONTRIBUTIONS AND TRANSFERS 1,419,655 396,376 1,816,031 96,973 Contributed capital from developers 35,462 9,831,445 9,866,907 - Contributed capital from governmental activities - 1,264,516 1,264,516 - Transfers to other funds (1,339,950) (817,069) (2,157,019) - Total Contributions and Transfers (1,304,488) 10,278,892 8,974,404 - CHANGE IN NET POSITION 115,167 10,675,268 10,790,435 96,973 NET POSITION Beginning of Year, As Originally Reported 12,869,552 208,198,794 (2,805,825) Restatement, see Note 22 - 4,352,159 - Beginning of Year, as Restated 12,869,552 212,550,953 (2,805,825) End of Year 12,984,719$ 223,226,221$ (2,708,852)$ Explanation of difference between Proprietary Funds Statement of Revenue, Expenses, and Changes in Fund Net Position and the Statement of Activities: The City uses an internal service fund to charge the cost of its insurance activities to individual funds. This amount represents the income that has been allocated back to the business-type activities in the government-wide Statement of Activities that is attributable to the City's business-type activities:110,124 Change in net Position of business-type activities 10,900,559$ Enterprise Funds Business-type Activities - Page 473 of 899 CITY OF LAKEVILLE STATEMENT OF CASH FLOWS PROPRIETARY FUNDS YEAR ENDED DECEMBER 31,2024 See accompanying Notes to Basic Financial Statements. (43) Governmental Activities - Internal Service Liquor Utility Total Funds CASH FLOWS FROM OPERATING ACTIVITIES Cash received from customers 22,654,464$ 20,436,711$ 43,091,175$ -$ Cash received from general service charges - - - 1,010,825 Cash paid to suppliers (17,856,217) (12,417,340) (30,273,557) (736,878) Cash paid to and for employees (3,017,781) (3,546,117) (6,563,898) (226,296) Net Cash Provided (Used) by Operating Activities 1,780,466 4,473,254 6,253,720 47,651 CASH FLOWS FROM NONCAPITAL FINANCING ACTIVITIES Intergovernmental - grant 38,882 178,555 217,437 - Transfers to other funds (1,339,950) (817,069) (2,157,019) - Net Cash Provided (Used) by Noncapital Financing Activities (1,301,068) (638,514) (1,939,582) - CASH FLOWS FROM CAPITAL AND RELATED FINANCING ACTIVITIES Acquisition and construction of capital assets (195,986) (900,179) (1,096,165) - Proceeds from sale of capital assets 13,500 23,446 36,946 - Interest and fiscal charges (36,829) 27,947 (8,882) - Principal maturities (587,201) (1,415,710) (2,002,911) - Net Cash Used by Capital and Related Financing Activities (806,516) (2,264,496) (3,071,012) - CASH FLOWS FROM INVESTING ACTIVITIES Investment income received 130,908 1,183,771 1,314,679 30,007 NET INCREASE IN CASH AND CASH EQUIVALENTS (196,210) 2,754,015 2,557,805 77,658 Cash and Cash Equivalents - Beginning of the Year 3,823,275 27,150,354 30,973,629 1,047,948 CASH AND CASH EQUIVALENTS - END OF THE YEAR 3,627,065$ 29,904,369$ 33,531,434$ 1,125,606$ RECONCILIATION OF OPERATING INCOME (LOSS) TO NET CASH PROVIDED (USED) BY OPERATING ACTIVITIES Operating Income (Loss) 1,360,837$ (914,560)$ 446,277$ 64,109$ Adjustments: Depreciation expense 715,458 6,703,894 7,419,352 - (Increase) decrease in assets and deferred outflows: Accounts receivable 3,580 (858,601) (855,021) (12,289) Inventory 218,557 67,794 286,351 - Prepaid expenses - (4,414) (4,414) - Pension-related deferred outflows 203,460 255,559 459,019 - OPEB-related deferred outflows 823 4,333 5,156 - Increase (decrease) in liabilities and deferred inflows: Salaries payable 14,582 10,684 25,266 - Accounts payable (508,271) (376,372) (884,643) (67,711) Unearned revenue - 107,800 107,800 Deposits payable 3,757 (100,170) (96,413) - Accrued compensated absences 22,576 47,266 69,842 63,542 Net pension liability (479,299) (637,983) (1,117,282) - Pension-related deferred inflows 217,188 178,850 396,038 - OPEB-related deferred inflows (5,523) (11,638) (17,161) - Total OPEB liability 12,741 812 13,553 - Net Cash Provided (Used) by Operating Activities 1,780,466$ 4,473,254$ 6,253,720$ 47,651$ Supplemental schedule of noncash financing activities: The City assumes ownership of utility capital assets from governmental projects and land developers. Capital assets assumed were as follows:-$ 4,352,159$ 4,352,159$ -$ Amortization of Bond Premiums - (170,355) (170,355) - -$ 4,181,804$ 4,181,804$ -$ Enterprise Funds Business-type Activities - Page 474 of 899 CITY OF LAKEVILLE STATEMENT OF FIDUCIARY NET POSITION CUSTODIAL FUND DECEMBER 31, 2024 See accompanying Notes to Basic Financial Statements. (44) Custodial Fund AS SETS Cash and investments 18,050$ Accounts receivable 4,493 Total assets 22,543 LIABILITIES Accounts payable 2,641 Total liabilities 2,641 NET POSITION Restricted for: Individuals, organizations, and other governm ents 19,902$ Page 475 of 899 CITY OF LAKEVILLE STATEMENT OF CHANGES IN FIDUCIARY NET POSITION CUSTODIAL FUND YEAR ENDED DECEMBER 31,2024 See accompanying Notes to Basic Financial Statements. (45) Custodial Fund AD DITIONS Contributions 18,930$ DEDUCTIONS Payments to vendors 21,037 NET DECREASE IN FIDUCIARY NET POSITION (2,107) Fiduciary net position - beginning of year 22,009 FIDUCIARY NET POSITION - END OF YEAR 19,902$ Page 476 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (46) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES A.Organization The City of Lakeville, Minnesota (the City) operates under the “Optional Plan A”form of government as defined in Minnesota Statutes. The Statutes prescribe a Mayor-Council form of organization. The City provides the following services: public safety, highways and streets, water and sanitary sewer, public improvements, planning and zoning, culture-recreation, and general administration. The basic financial statements of the City of Lakeville have been prepared in conformity with accounting principles generally accepted in the United States of America (GAAP) as applied to government units. The Governmental Accounting Standards Board (GASB) is the accepted standard-setting body for establishing governmental accounting and financial reporting principles. The City’s more significant accounting policies are described below. B.Reporting Entity The City of Lakeville is a municipal corporation governed by an elected mayor and a four-member council. In accordance with GASB standards, these financial statements represent the City of Lakeville and its sole component unit. The City includes all funds, organizations, agencies, departments, and offices that are not legally separate from such. Component units are legally separate organizations for which the elected officials of the City are financially accountable and are included within the basic financial statements of the City based on the nature and the significance of their operational or financial relationships with the City. The City has considered all potential units for which it is financially accountable, and other organizations for which the nature and significance of their relationship with the City are such that exclusion would cause the City’s financial statements to be misleading or incomplete. The Governmental Accounting Standards Board (GASB) has set forth criteria to be considered in determining financial accountability. These criteria include appointing a voting majority of an organization’s governing body, and (1)the ability of the primary government to impose its will on that organization or (2)the potential for the organization to provide specific benefits to or impose specific financial burdens on the primary government. Based upon the application of these criteria, the City has the following component units: Blended Component Unit The Housing and Redevelopment Authority (HRA) of Lakeville, Minnesota was created by the City to provide housing and redevelopment assistance to its citizens. The HRA provides this assistance through the administration of various programs. The HRA is governed by a five-member Board of Commissioners comprised of the City of Lakeville Council in accordance with Minnesota Statutes 469.003, Subdivision 6. Although it is legally separate from the City, the HRA is reported as if it were a part of the City (blended) because the City Council is also the HRA governing board. The Commissioners’ terms of office coincide with those of the City Council member. The City Administrator serves as the HRA Executive Director. The operational responsibility for the HRA rests with management of the City. Page 477 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (47) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) B.Reporting Entity (Continued) Blended Component Unit (Continued) During fiscal year 2006, the HRA issued $9,230,000 in Ice Arena Lease Revenue Bonds, Series 2006, to finance the construction of the single sheet Hasse ice arena facility. The Ice Arena Lease Revenue Bonds, Series 2006 were subsequently refunded in 2016. Debt service will be payable from equal lease payments to be made by the City pursuant to the lease agreement between the HRA and the City, and in conjunction with the joint powers agreement between the City and Independent School District No.194. In 2017, the HRA issued $2,255,000 in Lease Revenue Liquor Enterprise Refunding Bonds, Series 2017A, to refund the existing liquor revenue bonds through a purchase (and subsequent lease-back) of the liquor store land and building. Debt service will be payable from lease payments made by the City’s liquor enterprise fund. These HRA bond obligations are combined and presented separately in the debt service funds as debt supported by HRA lease revenue. The HRA has not issued separate financial statements for the period ending December 31, 2024.Information of a nonfinancial matter regarding the HRA can be obtained at the City’s Finance offices, located at 20195 Holyoke Avenue, Lakeville, Minnesota 55044. C.Government-Wide Financial Statements The basic financial statements include both government-wide and fund financial statements.The government-wide financial statements focus on the City as a whole (consolidation of the City, excluding fiduciary funds) while the fund financial statements focus on the major individual funds (reported as separate columns within the fund financial statements). Separate financial statements are provided for governmental funds, proprietary funds, and fiduciary funds. Both the government-wide and fund financial statements (within the basic financial statements) categorize primary activities as either governmental or business-type. In the government-wide statement of net position, both the governmental and business-type activities columns (a)are presented on a consolidated basis by column, and (b)are reflected, on a full accrual, economic resources measurement focus, which incorporates long-term assets, receivables, deferred inflows and outflows of resources as well as long-term debt and other obligations. The City generally first uses restricted assets for expenses incurred for which both restricted and unrestricted assets are available.The City may defer the use of restricted assets based on a review of the specific transaction. The government-wide statement of activities reflects both the gross cost and the net cost per function category (general government, public safety, public works, and parks and recreation) which are otherwise being supported by both program and general revenues (charges for services, grants and contributions, property taxes, etc.).The statement of activities reduces gross expenses (including depreciation and amortization) by the related program revenues and operating/capital grants and contributions. Page 478 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (48) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) C.Government-Wide Financial Statements (Continued) The program revenues must be directly associated with the function (general government, public safety, public works, and parks and recreation) or a business-type activity. Program revenues are derived directly from the program itself or from parties outside the City’s taxpayers or citizenry, as a whole. The City does not allocate indirect expenses. The operating grants and contributions column includes operating-specific and discretionary grants while the capital grants and contributions column includes capital specific grants and contributions. D.Fund Financial Statement Presentation The governmental fund financial statements are presented using the current financial resources measurement focus and the modified accrual basis of accounting. This is the manner in which these funds are normally budgeted. Since the governmental fund statements are presented using a measurement focus and basis of accounting different from that used in the government-wide statement’s governmental column, a reconciliation is presented that briefly explains the adjustments necessary to reconcile ending net position and the change in net position. Both the City as a whole and the City’s major funds, including both governmental and enterprise funds, as well as a custodial fund, are presented utilizing the focus of the GASB Statement No. 34 reporting model. Each presentation provides valuable information that can be analyzed and compared (between years and between governments) to enhance the usefulness of the information. In the fund financial statements, financial transactions and accounts of the City are organized on the basis of funds. The operation of each fund is considered to be an independent fiscal and separate accounting entity, with a self-balancing set of accounts recording cash and/or other financial resources together with all related liabilities, deferred inflows and outflows of resources and residual equities or balances, and changes therein, which are segregated for the purpose of carrying on specific activities or attaining certain objectives in accordance with special regulations, restrictions, or limitations. Major governmental funds -The City reports the following major governmental funds: General fund –The general fund is the general operating fund of the City. It is used to account for all financial resources except for those required to be accounted for in another fund. This fund records revenues such as property taxes, licenses,and permits, intergovernmental revenues, charges for services, fines, and investment income. Most of the day-to-day operations of the City are financed from this fund. Page 479 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (49) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) D.Fund Financial Statement Presentation (Continued) Debt service fund –This fund is used to account for the accumulation of resources that are restricted for the payment of long-term principal, interest, and related costs. Capital projects fund –This fund accounts for the accumulation and disbursement of funds for major capital projects and facilities including the construction or improvement of public buildings, Minnesota Municipal State-aid funded street construction, and complex construction contracts that involve multiple financing resources from the City and other government entities. Major enterprise funds –The City reports the following major proprietary funds: Enterprise liquor fund –This fund is used to account for the retail operations of four off-sale liquor stores. Enterprise utility fund –This fund is used to account for water, sanitary sewer, street lighting, and environmental resources services provided to City customers. Other funds –The City reports the following other funds: Internal service funds –The City has a Municipal Reserves internal service fund as well as a Compensated Leave internal service fund. The Municipal Reserves fund accounts for the City’s risk management program relating to general liability, excess liability, property, workers compensation, and casualty insurance costs which are charged to other departments of the City. The Compensated Leave fund accounts for the accrued liability of employee benefits attributed to compensated leave. Funding was initially provided by transfers from the General Fund. Future revenue sources are charges to benefited programs and departments. Benefits paid to Enterprise Fund employees are accounted for in their respective funds.The Compensated Leave fund currently has a deficit net position, but the City supports reestablishing a Compensated Leave Fund for the purpose of funding the current liability for accrued leave hours due to those employees eligible to retire within the next five years as well as an estimated amount for a normal level of staff turnover, recognizing that even though this liability will be paid in the future, the liability was incurred to provide current services and should be funded with current revenues. Funding this liability can be phased in but the City will strive to meet this goal within three to five years. Custodial fund –The custodial fund is used to record the receipt and remittance of monies held by the City on behalf of other legally separate entities. Page 480 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (50) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) E.Measurement Focus and Basis of Accounting The accounting and reporting treatment applied to a fund is determined by its measurement focus. Funds are classified into three categories: Governmental, Proprietary,and Fiduciary. To provide an accurate cost measurement of individual activities in the fund financial statement consolidation process, the City’s interfund activity relating to services provided by and used between functions has been removed from these statements; exceptions are for charges between the government’s liquor and utility function and other functions of the government. Governmental Funds: Measurement focus: Governmental funds are accounted for using a current financial resources measurement focus.With this measurement focus, only current assets and current liabilities generally are included on the balance sheet.Reported fund balance is considered a measure of “available spendable resources.” Governmental fund operating statements represent increases (i.e., revenues and other financing sources) and decreases (i.e., expenditures and other financing uses) in net current assets. Basis of accounting:Governmental funds are accounted for using the modified accrual basis of accounting.Their revenues are recognized when susceptible to accrual (i.e., when they become measurable and available).“Measurable” means the amount of the transaction can be determined and “available” means collectible within the current fiscal year or soon enough thereafter to be used to pay liabilities of the current fiscal year. For this purpose,the City generally considers revenues to be available if collected within 60 days of year-end or if intergovernmental revenues related to a joint project venture with the county are considered to be available if collected within 181 days of year-end. Revenues: Major revenues that are susceptible to accrual include property taxes, excluding delinquent taxes received over 60 days after current fiscal year-end; special assessments, intergovernmental revenue, excluding intergovernmental revenues related to a joint project venture with the county are considered revenue if collected within 181 days after current fiscal year-end; charges for services, investment income, and donations. Major revenues that are not susceptible to accrual (i.e., license and permit revenues, and miscellaneous revenues) are recorded when received because they are not measurable until collected. Expenditures:Expenditures are generally recognized under the modified accrual basis of accounting when the related fund liability is incurred, except for principal and interest on long-term debt, other postemployment benefits, pension benefits and compensated absences which are recognized when due. Page 481 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (51) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) E.Measurement Focus and Basis of Accounting (Continued) Proprietary and Fiduciary Funds: Measurement focus: Proprietary funds and fiduciary funds are accounted for on a flow of economic resources measurement focus. This means that all assets, including capital assets, and all liabilities, including long-term liabilities, and deferred inflows and outflows of resources associated with fund activity are included on the statement of net position. Proprietary fund types statement of revenues, expenses, and changes in net position present increases (i.e., revenues) and decreases (i.e., expenses) in net total position. Basis of accounting:Proprietary funds and fiduciary funds (including custodial funds) are accounted for using the accrual basis of accounting.Revenues are recognized when earned and expenses are recorded at the time the liabilities are incurred. Unbilled utility service receivables are recorded at current fiscal year-end. Operating versus nonoperating items:Proprietary funds distinguish operating revenues and expenses from nonoperating items. Operating revenues and expenses generally result from providing services and producing and delivering goods in connection with a proprietary fund’s principal ongoing operations. The principal operating revenue of the City’s enterprise funds and internal service funds are charges to customers for sales and services. Operating expenses for enterprise funds and internal service funds include the cost of sales and services, administrative expenses, and depreciation and amortization on capital assets. All revenues and expenses not meeting this definition are reported as nonoperating revenues and expenses. F.Cash and Investments Cash balances from all funds are combined and invested to the extent available in certificates of deposit, commercial paper, U.S. Government securities, and other securities authorized by state statutes. Earnings from such investments are allocated to the respective funds on the basis of applicable cash balance participation by each fund. Cash and investments held by trustee represent in part the value of deposits that are required to be held in trust for various City obligations. These established escrow accounts will remain in effect until the terms and conditions of the obligations have been fulfilled. Earnings from such investments are allocated directly to the respective funds in which the assets are held. G.Taxes Receivable Property tax levies are set by the City Council in December each year and are certified to Dakota County for collection in the following year. Such taxes become a receivable of the City and become a lien on the respective property as of January 1. In Minnesota, most counties act as collection agents for all property taxes. Dakota County spreads the levies over all taxable property within the City of Lakeville. Page 482 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (52) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) G.Taxes Receivable (Continued) Real and personal property taxes are payable in equal installments by property owners to Dakota County on May 15 and October 15 of each year. Dakota County remits these and delinquent collections to the City twice a year, in July and December. Unpaid taxes on December 31 are classified in the fund financial statements as delinquent taxes receivable. Taxes receivable include the following components: Unremitted –amounts collected by Dakota County but not yet remitted to the City by December 31. Delinquent –amounts billed to property owners but not paid. H.Special Assessments Receivable Special assessments are levied against the benefited properties for the assessable costs of special assessment improvement projects in accordance with State Statutes. The City usually adopts the assessment rolls when construction contracts will be awarded for the individual projects. The City is obligated for the payment of special assessment debt not covered through the collection of special assessments from property owners. Any obligation by the City would be paid by property taxes. Special assessments are collectable over a term of years generally consistent with the term of years of the related bond issue. Collection of annual special assessment installments (including interest) is administered by Dakota County in the same manner as property taxes. Property owners are allowed to prepay total future installments without interest or prepayment penalties. As of December 31, 2024, the special assessment delinquent receivable was $141,056 in the governmental funds and $49,554 in the proprietary enterprise utility fund. Special assessments receivable includes the following components: Unremitted –amounts collected by Dakota County but not yet remitted to the City by December 31. Delinquent –amounts billed to property owners but not paid. Deferred –assessment installments that will be billed to property owners in future years. Other -assessments for which payment has been delayed based on state statutes or City Council action. I.Inventory Inventories are valued on a first-in, first-out method. The cost of inventories is recorded as expenses/expenditures when consumed rather than purchased except for,general fund inventory related to snow removing chemicals. These materials are recorded as an expenditure at the time of purchase rather than when it is consumed. J.Prepaid Items Payments made to vendors for services that will benefit periods beyond the current year are recorded as prepaid items. Prepaid items are also accounted for using the consumption method. Page 483 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (53) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) K.Unamortized Bond Premium and Bond Discount In the governmental fund financial statements, bond premiums and discounts are recognized as other financing sources and uses, respectively in the current fiscal year. Bond discounts and bond premiums for the City’s government-wide financial statements are deferred and amortized over the term of the bonds using the effective interest rate method. Unamortized bond premiums and discounts are included within the noncurrent liabilities due in more than one year of the City’s government-wide statement of net position. The enterprise utility fund includes a noncurrent liability for unamortized bond premium associated with the issuance of the water,sewer,and streetlight bonds of 2016-2021. The bond premium is amortized over the term of the bonds using the effective interest rate method. L.Restricted Assets The government-wide statement of Net Position “restricted assets (temporarily)” represents cash and investments, and investments held by trustee that have imposed restrictions placed on them by parties outside the government. These restricted amounts are pledged by bond covenants to the repayment of City indebtedness. The assets are temporarily restricted until the terms and conditions of the obligations have been fulfilled. M.Capital Assets Capital assets, which include land, historical treasures, construction in process, buildings and improvements, machinery and equipment, other improvements, and infrastructure, are reported in the applicable governmental or business-type activity columns of the government-wide statement of net position and proprietary funds statement of net position. Such assets are capitalized at historical cost or estimated historical cost for assets where actual historical cost is not available. Donated assets are recorded as capital assets at their estimated acquisition value on the date of donation. The City defines capital assets as those with an initial, individual cost of $5,000 or more with an estimated useful life of not less than one year. The cost of normal maintenance and repairs that do not add to the value of the asset or materially extend the life of the asset are not capitalized. Capital outlays are recorded as expenditures in the City’s governmental fund financial statements, which use the modified accrual basis of accounting. Capital outlays that meet the City’s capitalization criteria are reported in the government-wide statement of net position and proprietary funds statement of net position, both of which use the full accrual basis of accounting. Page 484 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (54) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) M.Capital Assets (Continued) Depreciation and amortization on the capital assets is recorded in the government-wide and proprietary fund financial statements. Land, historical treasures, and construction in process are not depreciated. Capital assets are depreciated using the straight-line method over their estimated useful lives as follows: Buildings and improvements 50 to 75 Years Machinery and equipment 3 to 20 Years Other improvements 10 to 50 Years Infrastructure 20 to 50 Years Right-to-use lease assets are initially measured at the present value of payments expected to be made during the lease term, adjusted for lease payments made at or before the lease commencement date, plus certain initial direct costs. Subsequently, the lease asset is amortized in a systematic and rational manner over the shorter of the lease term or the useful life of the underlying asset. N.Deferred Outflows/Inflows of Resources In addition to assets, the statement of net position will sometimes report a separate section for deferred outflows of resources.This separate financial statement element represents a consumption of net assets that applies to a future period and so will not be recognized as an outflow of resources (expense/expenditure) until then. The City has three items that qualifies for reporting in this category. The first two items are the deferred outflows of resources related to pensions reported in the government-wide and proprietary fund statements of net position. This deferred outflow results from differences between expected and actual experience, changes of assumptions, differences between projected and actual earnings on pension plan investments, and contributions to the plan subsequent to the measurement date and before the end of the reporting period. These amounts are deferred and amortized as required under pension standards. The third item is a deferred outflow related to the City’s OPEB liability. This deferred outflows results from contributions made to the plan after the measurement date and for differences between expected and actual experience, and these deferred outflows will be amortized as required under OPEB standards. In addition to liabilities, statements of net position or balance sheets will sometimes report a separate section for deferred inflows of resources. This separate financial statement element represents an acquisition of net assets that applies to future periods and so will not be recognized as an inflow of resources (revenue) until that time. The City has four items which qualify for reporting in this category. The first item, unavailable revenue, is reported only in the governmental funds Balance Sheet. The governmental funds report unavailable revenue from three sources: property taxes,special assessments, and other.These amounts are deferred and recognized as an inflow of resources in the period the amounts become available. Page 485 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (55) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) N.Deferred Outflows/Inflows of Resources (Continued) The second item, deferred inflows of resources related to pensions and OPEB, is reported in the government-wide and proprietary fund statements of net position. This deferred inflow results from differences between expected and actual experience, changes of assumptions, and the difference between projected and actual earnings on pension plan investments. These amounts are deferred and amortized as required under pension and OPEB standards.The third item relates to deferred gains on bond refundings that are amortized over the life of the related bonds.The fourth item, leases and financed purchases, relates to long-term lease receivables and financed purchase receivables not recognized to revenue until the underlying timing requirements of the leases have been met. O.Compensated Absences It is the City’s policy to permit employees to accumulate earned but unused leave benefits as either paid-time-off (PTO), or vacation and sick leave. Under the City’s personnel policies and collective bargaining contracts, City employees are granted leave benefits in varying amounts based on length of service. PTO accruals vary from 18 to 30 days per year, vacation accruals vary from 10 to 20 days per year,and sick leave accrues at a rate of 12 days per year. As benefits accrue to employees, the accumulated PTO, vacation and vested sick leave is reported as an expense and liability in the government-wide and proprietary fund financial statements. Accrued PTO, vacation and a percentage of sick leave is paid to employees upon termination (severance) only if they have vested and is reported as an expenditure in the governmental fund that will pay for it. The liability for compensated absences reported in the government-wide and proprietary fund statements consists of leave that has not been used that is attributable to services already rendered, accumulates, and is more likely than not to be used for time off or otherwise paid in cash. The liability also includes amounts for leave that has been used for time off but has not yet been paid in cash. P.Pensions For purposes of measuring the net pension asset/liability, deferred outflows/inflows of resources, and pension expense, information about the fiduciary net position of the Public Employees Retirement Association (PERA) and the Lakeville Fire Relief Association and the applicable pension additions to/deductions from the pension plan’s fiduciary net position have been determined on the same basis as they are reported by the plan except that the PERA pension plan’s fiscal year-end is June 30. For this purpose, plan contributions are recognized as of employer payroll paid dates and benefit payments and refunds are recognized when due and payable in accordance with the benefit terms. Investments are reported at fair value. Page 486 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (56) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) Q.Other Postemployment Benefits (OPEB) Obligation In accordance with the provisions of GASB Statement No. 75, Accounting and Financial Reporting for Postemployment Benefits Other Than Pensions, an actuarial valuation is required to be computed and reported for the City’s postemployment health insurance benefits provided to eligible employees through the City’s Other Postemployment Benefits Plan. OPEB is reported as an expense on a pay-as-you-go basis and is accrued as it is earned. The total OPEB obligation liability and corresponding expense for governmental activities is reported within the government-wide financial statements. The total OPEB liability and corresponding expense for enterprise funds are recorded within those funds. R.Long-Term Obligations Long-term obligations are recorded in the City’s government-wide and proprietary fund statements of net position when they become a liability of the City. Long-term obligations are recognized as a liability of a governmental fund only when due or when payment is made to the paying agent. S.Leases Receivable The City determines if an arrangement is a lease at inception. Leases for which the City is the lessor are included in lease receivables and deferred inflows of resources in the statements of net position and fund financial statements. Lease receivables represent the City’s claim to receive lease payments over the lease term, as specified in the contract, in an exchange or exchange-like transaction. Lease receivables are recognized at commencement date based on the present value of expected lease payments over the lease term, reduced by any provision for estimated uncollectible amounts. Interest revenue is recognized ratably over the contract term. Deferred inflows of resources related to leases are recognized at the commencement date based on the initial measurement of the lease receivable, plus any payments received from the lessee at or before the commencement of the lease term that relate to future periods, less any lease incentives paid to, or on behalf of, the lessee at or before the commencement of the lease term. The deferred inflows related to leases are recognized as lease revenue in a systematic and rational manner over the lease term. The individual lease contracts do not provide information about the discount rate implicit in the lease. Therefore, the City has elected to use its incremental borrowing rate to calculate the present value of expected lease payments. Page 487 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (57) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) T.Fund Balance In the fund financial statements, governmental funds report fund balance classification that disclose constraints for which amounts in those funds can be spent. These classifications are as follows: Nonspendable –consists of amounts that cannot be spent because they are not in spendable form, such as prepaid items and inventory. Restricted –consists of amounts related to externally imposed constraints established by creditors, grantors or contributors; or constraints imposed by state statutory provisions. Committed –consists of amounts that are constrained for specific purposes that are internally imposed by formal action (resolution) of the City Council. Those committed amounts cannot be used for any other purpose unless City Council removes or changes the specified use by taking the same type of action it employed to previously commit those amounts. Assigned –consists of amounts intended to be used by the City for specific purposes but do not meet the criteria to be classified as restricted or committed. Pursuant to City resolution, the City Administrator and the Finance Director are authorized to establish assignments of fund balances. Unassigned –is the residual classification for the General fund and also reflects negative residual amounts in other funds. The City will endeavor to maintain an unrestricted (committed, assigned,and unassigned) fund balance in the General fund of an amount not less than 40%and not greater than 50%of the next year’s budgeted expenditures of the General fund. This will assist in maintaining an adequate level of fund balance to provide for cash flow requirements and contingency needs. At December 31, 2024, the unrestricted fund balance of the General Fund was 49.2%of the subsequent year’s budgeted expenditures. When both restricted and unrestricted resources are available for use, it is the City’s policy to first use restricted resources, and then use unrestricted resources as they are needed. When committed, assigned or unassigned resources are available for use, it is the City’s policy to use resources in the following order; 1.)committed, 2.)assigned, and 3.)unassigned. Page 488 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (58) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) U.Net Position In the government-wide and proprietary fund financial statements, net position represents the difference between assets and deferred outflows of resources and liabilities and deferred inflows of resources. Net position is displayed in three components: Net investment in capital assets –Consists of capital assets, net of accumulated depreciation and amortization reduced by any outstanding debt attributable to acquire capital assets. Restricted net position –Consists of net position balances restricted when there are limitations imposed on their use through external restrictions imposed by creditors, grantors, laws,or regulations of other governments. Unrestricted net position –All other net position balances that does not meet the definition of “restricted” or “net investment in capital assets”. When both restricted and unrestricted resources are available for use, it is the City’s policy to use restricted resources first, then unrestricted resources as they are needed. The City has also established specific targets it will use to maintain an adequate level of net position for the Utility Enterprise Funds. When implementing any rate changes, the City intends to meet the following financial management targets: (i)Available cash on hand to cover the following objectives: 1.Three months of operating cash 2.Following year debt service payments 3.Next year planned capital expenses not financed with bonds. (ii)Unassigned cash to account for unexpected costs at the following thresholds: 1.$500,000 for water and sewer operating funds 2.$100,000 for environmental resources and streetlight operating funds. (iii)Unrestricted Net Position not less than 50% of projected expenses. (iv)Net revenues not less than 125% of annual debt service on existing and planned debt. V.Revenues and Expenditures/Expenses In the governmental fund financial statements property tax revenue is recognized when it becomes measurable and available to finance expenditures of the current fiscal year. All delinquent taxes receivable are fully offset by deferred inflow of resources in the governmental fund financial statements. Taxes due from Dakota County on December 31 are included in revenue since they are remitted to the City within 60 days after December 31. In the government-wide statement of activities property tax revenue is recognized when levied. Page 489 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (59) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) V.Revenues and Expenditures/Expenses (Continued) In the governmental fund financial statements special assessments principal and interest are recognized as revenue when they become measurable and available to finance expenditures of the current fiscal year. All delinquent and deferred assessments receivable are fully offset by deferred inflow of resources in the fund financial statements. Both the principal and interest on special assessments are payable in installments over a term of years that matches the scheduled payments for the bond issue which financed the project. In the government-wide statement of activities special assessments revenue is recognized when levied. Investment income is recorded as revenue in the year earned. Elements of investment income include interest earned on investments and unrealized gains or losses on net increases or decreases in the fair value of investments. Certain grants and aids received by the City require that eligible expenditures be made in order to earn the grant. Revenue for these grants is recorded in the period of which eligible expenditures are made. Enterprise utility fund service charges are recognized when earned with no allowance for uncollectibles because delinquent accounts deemed uncollectible during the normal billing process are certified to Dakota County as a property tax lien.Quarterly utility service charges provided to customers but unbilled are included as receivables as of December 31. Interfund service transactions are accounted for as expenditures or expenses. Service transaction payments to a fund are recorded as an expenditure or expense in the paying fund and conversely recorded as a reduction of expenditure or expense in the fund that is receiving payment. Interfund service transactions within the respective categories of governmental activities and business-type activities in the government-wide statement of activities are eliminated.Interfund services provided and used are not eliminated in the process of consolidation into the government-wide statement of activities. W.Cash Flows For purposes of the statement of cash flows, the City considers all highly liquid debt instruments with an original maturity from the time of purchase of three months or less to be cash equivalents. The proprietary funds’ equity in the government-wide cash and investments management pool is considered to be a cash equivalent. X.Use of Estimates The preparation of financial statements in conformity with accounting principles generally accepted in the United States of America requires management to make estimates that affect amounts reported in the financial statements during the reporting period. Actual results could differ from such estimates. Page 490 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (60) NOTE 1 SUMMARY OF SIGNIFICANT ACCOUNTING POLICIES (CONTINUED) Y.Adoption of New Accounting Standards Effective January 1, 2024, the City implemented GASB Statement No. 101, Compensated Absences. This statement updated the recognition and measurement guidance for compensated absences and associated salary-related payments and amended certain previously required disclosures. There was no material impact as a result of the implementation of this standard. For the year ended December 31, 2024, the City implemented a change in accounting principle related to the treatment of group asset purchases. This change was prompted by the amendment of Question 7.9.8 in GASB Implementation Guide 2015-1, replaced by Question 5.1 in Implementation Guide 2021-1. The change is applied retroactively in accordance with GASB Statement No. 100. Beginning net position in the Utility Fund has been restated as a result of this change, see Note 22 for more information. NOTE 2 DEPOSITS AND INVESTMENTS A.Components of Cash and Investments The City’s cash surpluses are pooled and invested in accordance with State Statute and City investment policy. Investment earnings and unrealized gains and losses are allocated to funds on the basis of average cash balances. Investments are stated at fair value, which is the amount that a financial instrument could be exchanged for in a current transaction between willing parties. The investments are not identified with specific funds with the exception for bond proceeds related to bond series 2018 A. Investments held by trustee include balances held in segregated accounts for specific purposes. Interest earned on these trustee accounts is allocated directly to the responsible fund. The amounts represent funds held as required by the debt obligation covenants and other agreements. The City’s cash and investments as of December 31, 2024 consist of the following: Cash on hand 17,750$ Investments 172,279,618 Total cash and investments 172,297,368$ Page 491 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (61) NOTE 2 DEPOSITS AND INVESTMENTS (CONTINUED) A.Components of Cash and Investments (Continued) The City’s cash and investments as of December 31, 2024 are presented in the financial statements as follows: Statement of Net Position Cash and investments 172,279,046$ Temporarily restricted investments held by trustee 272 Statement of Fiduciary Net Position Cash and investments 18,050 Total cash and investments 172,297,368$ B.Deposits In accordance with applicable Minnesota Statutes, the City maintains deposits at depository banks authorized by the City Council, including checking accounts and certificates of deposit.The following is considered the most significant risk associated with deposits: Custodial Credit Risk –In the case of deposits, this is the risk that in the event of a bank failure, the City’s deposits may be lost.Minnesota Statutes require that all deposits be protected by federal deposit insurance, corporate surety bond, or collateral. The value of collateral pledged must equal 110%of the deposits not covered by federal deposit insurance or corporate surety bonds. Authorized collateral includes treasury bills, notes, and bonds; issues of U.S. government agencies; general obligations rated “A”or better; revenue obligations rated “AA”or better; irrevocable standard letters of credit issued by the Federal Home Loan Bank; and certificates of deposit. Minnesota Statutes require that securities pledged as collateral be held in safekeeping in a restricted account at the Federal Reserve Bank or in an account at a trust department of a commercial bank or other financial institution that is not owned or controlled by the financial institution furnishing the collateral.The City does not have a formal policy addressing this risk. At year-end, the carrying amount of the City’s deposits was $17,750,while the balance on the bank records was $-0-. At December 31, 2024, all deposits were fully covered by federal depository insurance, surety bonds, or by collateral held by the City’s agent in the City’s name. Page 492 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (62) NOTE 2 DEPOSITS AND INVESTMENTS (CONTINUED) C.Investments The City’s investments as of December 31, 2024 are as follows: Investment Type Rating Agency Total Value Less than 1 1 - 5 Money market funds: Minnesota Municipal (4M)N/R N/A 36,316,710$ 36,316,710$ -$ First American Treasury Obligation AAAm S&P - - - Wells Fargo Money Market N/R N/A - - - Certificates of deposit N/R N/A 7,560,961 3,648,120 3,912,841 U.S. treasury securities N/A N/A - - - U.S. government agencies AA+S&P 94,968,630 20,195,306 74,773,324 Municipal bonds Aaa Moody's 405,571 405,571 - Municipal bonds AAA S&P 13,923,120 6,336,353 7,586,767 Municipal bonds Aa1 Moody's 597,766 - 597,766 Municipal bonds AA+S&P 6,398,004 484,605 5,913,399 Municipal bonds Aa2 Moody's 2,044,768 798,641 1,246,127 Municipal bonds AA S&P 6,279,334 1,217,004 5,062,330 Municipal bonds Aa3 Moody's 133,328 - 133,328 Municipal bonds AA-S&P 3,651,426 - 3,651,426 Total investments 172,279,618$ 69,402,310$ 102,877,308$ N/R - Not rated N/A - Not applicable Credit Risk Interest Risk - Maturity Duration in Years The 4M Fund is regulated by Minnesota Statutes and the Board of Directors of the League of Minnesota Cities and is an external investment pool not registered with the Securities and Exchange Commission (SEC) that follows guidance under GASB Statement No. 79. The City’s investment in the 4M Fund is measured at an amortized cost method that approximates fair value. Investments in the 4M Plus must be deposited for a minimum of 14 calendar days. Withdrawals prior to the 14-day restriction period will be subject to a penalty equal to seven days interest on the amount withdrawn. The City’s investment policy does not place any further limitations beyond the state statute requirements for the risk categories described below. Investments are subject to various risks, the following of which are considered the most significant: Custodial Credit Risk –For investments, this is the risk that in the event of a failure of the counterparty to an investment transaction (typically a broker-dealer) the City would not be able to recover the value of its investments or collateral securities that are in the possession of an outside party.The City does not have any custodial credit risk for its investments since all of the City’s investments held in safekeeping by the City’s brokerage firm in the City’s name are insured and registered. Credit Risk –This is the risk that an issuer or other counterparty to an investment will not fulfill its obligations. State statutes authorize investments in money market funds, certificates of deposit, commercial paper, U.S. treasury securities, U.S. government agencies, and other securities provided they meet the two highest quality ratings of nationally recognized rating organizations. Page 493 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (63) NOTE 2 DEPOSITS AND INVESTMENTS (CONTINUED) C.Investments (Continued) Concentration Risk –This is the risk associated with investing a significant portion of the City’s investments (considered 5%or more) in the securities of a single issuer, excluding U.S. guaranteed investments (such as treasuries), investment pools, and mutual funds. As of December 31, 2024, the City’s investment portfolio includes the following securities of single issuers exceeding 5%: Federal Farm Credit Bank 11.5% Federal Home Loan Bank 25.2% Federal Home Loan Mortgage Corporation 8.4% Federal National Mortgage Association 7.8% Interest Rate Risk –This is the risk of potential variability in the fair value of fixed rate investments resulting from changes in interest rates (the longer the period for which an interest rate is fixed, the greater the risk). D.Investments Policy The City’s investment policy limits exposure to interest rate risk by investing in shorter term securities (maturing in one year or less) to meet current operating cash requirements.Longer-term investments are to be purchased with the intent to match maturity periods with future funding needs for capital replacement and debt obligations. The City will not purchase investments that, at the time of investment, cannot be held to maturity. This does not mean that an investment cannot be sold prior to maturity. Investment activity will focus upon protection of taxpayer dollars and investment income, consistent with statutory authorization and financial prudence. The City will conduct its investment transactions with several legal competing, reputable investment security dealers,and qualifying banks. The City will invest only in the following instruments or those others that may subsequently be permitted by state statute. United States Treasury Obligations Federal Agency Securities Certificates of Deposit Commercial Paper Banker’s Acceptance Money Market Funds State and Local Securities Page 494 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (64) NOTE 2 DEPOSITS AND INVESTMENTS (CONTINUED) E.Fair Value Measurements The City uses fair value measurements to record fair value adjustments to certain asset and liabilities and to determine fair value disclosures. The City follows an accounting standard which defines fair value, establishes framework for measuring fair value, establishes a fair value hierarchy based on the quality of inputs used to measure fair value, and requires expanded disclosures about fair value measurements. In accordance with this standard, the City has categorized its investments, based on the priority of inputs to the valuation technique, into a three-level fair value hierarchy. The fair value hierarchy gives the highest priority to quotes and prices in active markets for identical assets or liabilities (Level 1) and the lowest priority to unobservable inputs (Level 3). If inputs used to measure the financial instruments fall within different levels of the hierarchy, the categorization is based on the lowest level input that is significant to the fair value measurement of the instrument. Financial assets and liabilities recorded on the statement of net position are categorized based on the inputs to the valuation techniques as follows: Level 1 –Financial assets and liabilities are valued using inputs that are unadjusted quoted prices in active markets accessible at the measurement date of identical financial assets and liabilities. Level 2 –Financial assets and liabilities are valued based on quoted prices for similar assets or inputs that are observable, either directly or indirectly, for substantially the full term through corroboration with observable market data. Level 3 –Financial assets and liabilities are valued using pricing inputs which are unobservable for the asset, inputs that reflect the reporting entity’s own assumptions about the assumptions market participants would use in pricing the asset. Investment Type Level 1 Level 2 Level 3 Total U.S. government securities -$ 94,968,630$ -$ 94,968,630$ Certificates of deposit - 7,560,961 - 7,560,961 Municipal bonds - 33,433,317 - 33,433,317 Total -$ 135,962,908$ -$ 135,962,908 Investments measured at amortized cost 36,316,710 Total 172,279,618$ Page 495 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (65) NOTE 3 CAPITAL ASSETS A summary of changes in governmental capital assets during the year ended December 31, 2024 are as follows: Balance Beginning of Year,Balance Restated (1)Additions Deletions End of Year Governmental Activities: Capital Assets, Not Being Depreciated: Land 37,432,613$ 252,309$ (1,375)$ 37,683,547$ Historical treasures 128,000 90,700 - 218,700 Construction in progress 11,844,401 12,580,885 (10,296,864) 14,128,422 Total Capital Assets, Not Being Depreciated 49,405,014 12,923,894 (10,298,239) 52,030,669 Capital Assets, Being Depreciated: Building and improvements 70,000,663 8,459,874 (709,257) 77,751,280 Machinery and equipment 29,955,471 3,117,371 (1,573,549) 31,499,293 Other improvements 21,458,516 1,381,715 (57,777) 22,782,454 Infrastructure Streets 230,663,689 11,276,557 (1,458,034) 240,482,212 Storm Sewer 135,603,182 8,573,466 - 144,176,648 Parks 44,171,349 1,889,788 (261,524) 45,799,613 Total Capital Assets, Being Depreciated 531,852,870 34,698,771 (4,060,141) 562,491,500 Accumulated Depreciation for: Buildings and improvements (22,999,783) (2,148,694) 227,779 (24,920,698) Machinery and equipment (18,852,055) (2,913,293) 1,518,425 (20,246,923) Other improvements (6,575,726) (1,176,455) 51,869 (7,700,312) Infrastructure Streets (105,314,975) (10,223,270) 1,314,273 (114,223,972) Storm Sewer (34,905,089) (3,970,876) - (38,875,965) Parks (19,542,368) (1,790,879) 261,524 (21,071,723) Total Accumulated Depreciation (208,189,996) (22,223,467) 3,373,870 (227,039,593) Total Capital Assets, Being Depreciated, Net 323,662,874 12,475,304 (686,271) 335,451,907 Governmental Activities Capital Assets, Net 373,067,888$ 25,399,198$ (10,984,510)$ 387,482,576$ Depreciation and amortization expense was charged to governmental functions as follows: Governmental Activities: General government 462,064$ Public safety 1,590,851 Public works 15,525,314 Parks and recreation 4,645,238 Total depreciation and amortization expense 22,223,467$ Page 496 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (66) NOTE 3 CAPITAL ASSETS (CONTINUED) A summary of changes in business-type capital assets during the year ended December 31, 2024 are as follows: Balance Beginning of Year,Balance Restated (1)Additions Deletions End of Year Business-Type Activities: Capital Assets, Not Being Depreciated: Land 3,672,969$ -$ -$ 3,672,969$ Construction in Progress - 37,894 - 37,894 Total Capital Assets, Not Being Depreciated 3,672,969 37,894 - 3,710,863 Capital Assets, Being Depreciated: Buildings and improvements 34,361,032 236,123 (106,500) 34,490,655 Machinery and equipment 8,611,583 542,295 (82,138) 9,071,740 Infrastructure Environmental Resources 489,644 74,319 - 563,963 Water 150,793,883 5,940,117 (76,444) 156,657,556 Sanitary Sewer 101,478,364 5,455,093 - 106,933,457 Total Capital Assets, Being Depreciated 295,734,506 12,247,947 (265,082) 307,717,371 Accumulated Depreciation for: Buildings and improvements (12,373,990) (850,729) 35,443 (13,189,276) Machinery and equipment (2,733,166) (679,862) 11,980 (3,401,048) Infrastructure Environmental Resources (37,010) (18,452) - (55,462) Water (45,975,990) (3,371,881) 63,752 (49,284,119) Sanitary Sewer (35,266,425) (2,144,251) - (37,410,676) Total Accumulated Depreciation (96,386,581) (7,065,175) 111,175 (103,340,581) Total Capital Assets, Being Depreciated, Net 199,347,925 5,182,772 (153,907) 204,376,790 Right-to-Use Assets, Not Being Depreciated: Leased buildings 3,989,676 - - 3,989,676 Less accumulated amortization (708,353) (354,177) - (1,062,530) Total Right-to-Use Assets, Net 3,281,323 (354,177) - 2,927,146 Business-Type Activities Capital Assets, Net 206,302,217$ 4,866,489$ (153,907)$ 211,014,799$ (1) Prior period restatement due to change in accounting principle. See additional information related to restatements in Note 22. Depreciation and amortization expense was charged to governmental functions as follows: Business-Type Activities: Liquor fund 715,458$ Utility fund 6,703,894 Total depreciation and amortization expense, Business-Type Activities 7,419,352$ NOTE 4 LEASES The City, acting as lessor, leases land and water tower space for cellular services as well as ice arena space under long-term, non-cancelable lease agreements. The leases expire at various dates through 2056. During the year ended December 31, 2024, the City recognized $629,851 and $137,670 in lease revenue and interest revenue, respectively, pursuant to these contracts. Certain leases provide for increases in future minimum annual rental payments based on defined increases in the Consumer Price Index, subject to certain minimum increases. Page 497 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (67) NOTE 5 LONG-TERM DEBT A.Components of Long-Term Debt General Obligation Bonds The City’s general obligation bonds are supported primarily from revenues derived from property tax levies, special assessment levies, tax increment levies, state-aid street revenue, water connection revenue charges, ice arena operations, and contributions by an organization conducting lawful gaming at approved locations. These bonds are backed by the full-faith and credit of the City. Revenue Bonds The following revenue bonds are not general obligations of the City and accordingly are not backed by the full-faith and credit of the City. Business-type Activities Future revenue pledged for the payment of long-term debt related to the Utility – Water, Utility –Sewer, Utility –Street Lights, and Water Connection revenue bonds is noted in the table below. Summary of Business-type Activities Remaining Pledged Principal and Principal and Revenue Bond Issue Use of Proceeds Type Term of Pledge Interest Interest Paid Received Utility - Water Revenue Water infrastructure Utility user fees 2023 - 2034 8,420,393$ 1,266,513$ 7,979,715$ Utility - Sewer Rev enue Sewer infrastructure Utility user fees 2023 - 2025 71,750 70,125 9,563,268 Utility - Street Lights Revenue Street lights infrastructure Utility user fees 2023 - 2026 105,000 51,125 1,297,347 Water Connection Revenue Water infrastructure Connection charges 2023 - 2034 5,881,225 611,575 2,132,882 Revenue Pledged Current Year Metropolitan Council Loan Agreements On February 21, 2006, the City entered into a loan agreement with the Metropolitan Council for the purpose of acquiring property for a commuter vehicle park and pool lot located within a proposed state trunk highway right-of-way. The Metropolitan Council provided a loan to the City in the amount of $1,466,300 to finance the acquisition of the property. In 2024, the City made no payments on this loan. As of December 31, 2024, the balance of the loan is $1,159,843. On January 3, 2017, the City entered into another loan agreement with the Metropolitan Council for the purpose of acquiring property within a proposed state trunk highway right-of-way. The amount of the loan was $737,171 and the City made no payments on the loan in 2024.In December of 2021,the City entered into another loan agreement with the Metropolitan Council for the purpose of acquiring property within a proposed state trunk highway right-of-way. The amount of the loan was $950,000 with subsequent additions of $51,842 in 2022 and $57,939 in 2023, for a total loan of $1,059,781. The City made no payments on the loan in 2024. No specific assets are pledged as collateral for the debt, but there are restrictions on the related properties acquired with the loan proceeds. The loans (all free of interest charge) will be discharged by the Metropolitan Council upon the conveyance of the properties to the highway authority at an undetermined future date. Page 498 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (68) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) Metropolitan Council Loan Agreements (Continued) If the City determined it would not use the land for the highway project and wanted to sell it, it would owe the Met Council the fair market value of the property and, once paid, the loan would be forgiven. If the City breached the contract, essentially using the land for something other than was detailed in the agreements use of funds, the City would owe the Met Council the purchase price of the property (which is equal to the loan amount), and the loan would be forgiven. Dakota County Loans Payable During 2020, the City entered into two new agreements with Dakota County, where as Dakota County delayed repayment of project costs. One agreement related to construction on 179th Street between CSAH 23 and CSAH 31, with the City’s total share to date of $2,854,377 being recorded as a new loan in 2020. Additions of $27,923 were made to this loan in 2021, bringing the total balance payable to $2,882,300, payment of $2,526,000 was made in 2023 and additions to the loan of $4,449 in 2023 bringing the balance to the $360,748.This loan requires the City to pay the County for the City’s share of the project’s costs after May 1, 2023. There were no additions or payments made on this loan in 2024, the balance at December 31, 2024 is $360,748. The other 2020 agreement related to the County Road 70 expansion, with the City’s total share to date of $2,319,659 being recorded as a new loan in 2020. Additions of $4,672,203 were made to this loan in 2021, bringing the total balance payable to $6,991,862. This loan requires the City to pay the County for the City’s share of the project’s costs over three years starting with engineering and right of way acquisition after February 1, 2022, and the final payment for constructions costs is due after February 1, 2024. Payments of $656,200 were made in 2022, bringing the total balance payable as of December 31, 2022 to $6,335,662. An adjustment to the agreement in the amount of $676,542 was made in 2023, bringing the balance of the payable as of December 31, 2023,to $5,659,120. Payment of $5,659,120 was made in 2024, fully paying off the loan as of December 31, 2024. During 2021, the City entered into a third agreement with Dakota County related to 179th Street Reconstruction, with the City’s total share to date of $224,099 being recorded as a new loan in 2021. Additions in the amount of $68,018 were made to this loan in 2022 and additions in the amount of $41,346 were made to the loan in 2023, bringing the total balance payable to $333,463. There were no additions or payments in 2024. This loan is not payable to the County until 2025. During 2023, the City entered into agreements for three more projects with Dakota County. The first of these agreements related to reconstruction on 185th Street between Dodd Boulevard and Highview Avenue, with the City’s total date to date of $2,982,455 as a new loan in 2023.There were no additions or payments in 2024. This loan is not payable to the County until 2026.The second of these agreements related to the 185th Street and CSAH 60 reconstruction project, with the City’s total date to date of $207,700 as a new loan in 2023. Page 499 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (69) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) Dakota County Loans Payable (Continued) This loan is not payable to the County until 2025. The third agreement related to the 210th Street and Lakeville Boulevard reconstruction project, with the City’s total date to date of $524,000 as a new loan in 2023. An addition of $438,190 was added to this loan in 2024, bringing the total balance at December 31, 2024 to $645,890. This loan is not payable to the County until 2025 and 2026. During 2024, the City entered into another agreement related to the 179th St. and County Road 31 traffic signal construction project, with the City’s total share to date of $327,602 recorded as a new loan as of December 31, 2024. This loan is not payable to the County until 2025 through 2027. No assets were specifically pledged as collateral for these loans in the related agreements. There were no terms specified in the agreements with the County related to significant events of default, termination events, or subjective acceleration clauses. Lease Revenue Liquor Enterprise Refunding Bonds, Series 2017A On October 25, 2017, the City issued $2,255,000 in HRA Lease Revenue Liquor Enterprise Refunding Bonds, Series 2017A. The proceeds of this issue were deposited with the Trustee in order to call and prepay the outstanding liquor revenue bonds of 2007. In exchange for the refunding of the existing liquor revenue bonds, the liquor fund conveyed related capital assets consisting of land and building to the HRA fund. The HRA then leased the building back to the liquor fund under a financed purchase agreement, resulting in the capital assets being reported back in the liquor fund and the long-term debt being shown in the liquor fund as a financed purchase.The financed purchase terms include interest of between 2.0%-3.0% with payments totaling $2,255,000 through 2027. The capital assets being leased had a total cost of $2,522,470 and accumulated depreciation of $840,855 at December 31 2024.Per governmental accounting standards the related long-term debt is not shown in both the governmental and business-type activities, therefore the long-term liability is included in business-type activities as a financed purchase, as is noted in the table on the following page.This refunding resulted in an aggregate difference in debt service cash flows between the refunding debt and the refunded debt of $305,074 as well as an economic net present value benefit of $321,727 on the transaction. General Obligation Tax Abatement Bonds, Series 2021 A On February 16, 2021, the City issued $7,770,000 in General Obligation Tax Abatement Bonds, Series 2021 A. Proceeds of the Bonds were used to finance various energy savings improvements to the Ames Arena and Hasse Arena and to pay costs associated with issuance of the Bonds. The Bonds are valid and binding general obligations of the City and are payable from tax abatement levies.The General Obligation Tax Abatement Bonds carry interest that will vary from 1.0% to 3.0% with a final maturity of February 1, 2041. The Bonds carry a call provision on February 1, 2029. Page 500 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (70) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) General Obligation Tax Abatement Bonds, Series 2021 B On May 18, 2021, the City issued $5,620,000 in General Obligation Tax Abatement Bonds, Series 2021 B. Proceeds of the Bonds were used to finance the construction of a municipal liquor store and to pay costs associated with issuance of the Bonds. The Bonds are valid and binding general obligations of the City and are payable from tax abatement levies and net revenues of the City's Liquor Fund.The General Obligation Tax Abatement Bonds carry interest that will vary from 2.0% to 4.0% with a final maturity of February 1, 2042. The Bonds carry a call provision on February 1, 2029. General Obligation Bonds, Series 2021 C On August 17, 2021, the City issued $6,915,000 in General Obligation Bonds, Series 2021 C. This included $5,650,000 in General Obligation Improvement Bonds and $1,265,000 in General Obligation Water Revenue Bonds. The proceeds of this issue will be used for street reconstruction and improvement projects. The General Obligation Improvement Bonds carry interest that will vary from 2.0% to 4.0% with a final maturity of February 1, 2032. The debt service of these bonds will be made from special assessments and property tax levies. The General Obligation Water Revenue Bonds also carry an interest rate that will vary from 2.0% to 4.0% with a final maturity of February 1, 2032. The debt service of these bonds will be made from water utility revenues. The General Obligation Improvement Bonds and General Obligation Water Revenue Bonds carry a call provision on February 1, 2029. General Obligation Refunding Bonds, Series 2022A The General Obligation Refunding Bonds, Series 2022A,were issued in the amount of $13,240,000, dated January 6, 2022, pursuant to Minnesota Statutes, Sections 475.521 and 475.58, Subdivision 3b and Chapters 429 and 475, as amended. Proceeds of the Bonds will be used to current refund the February 1, 2023 through February 1, 2033 maturities, totaling $1,860,000 in principal, of the City's General Obligation Improvement Bonds, Series 2012A on February 1, 2022; to current refund the February 1, 2023 through February 1, 2030 maturities, totaling $11,990,000 in principal, of the City's General Obligation Refunding Bonds, Series 2012B on February 1, 2022; to current refund the February 1, 2023 through February 1, 2034 maturities, totaling $1,800,000 in principal, of the City's General Obligation Improvement Bonds, Series 2013A on February 1, 2022; and to pay costs associated with issuance of the Bonds. The Bonds are general obligations of the City and are payable from special assessments levied against benefitted properties and ad valorem taxes. This refunding resulted in an aggregate difference in debt service cash flows between the refunding debt and the refunded debt of $2,251,071 as well as an economic net present value benefit of $1,423,255 on the transaction. Page 501 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (71) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) Taxable General Obligation Bonds, Series 2022 B The Taxable General Obligation Bonds, Series 2022B were issued in the amount of $9,570,000, dated April 5, 2022,pursuant to Minnesota Statutes, Sections 469.1812 through 469.1815 and Chapter 475, as amended, and a voter referendum held on November 2, 2021, which passed by a vote of 7,346 (yes) to 4,681 (no). Proceeds of the Bonds will be used to full net advance refund the February 1, 2023 through February 1, 2032 maturities, totaling $4,920,000 in principal, of the Housing and Redevelopment Authority of the City of Lakeville, Minnesota Lease Revenue Refunding Bonds (Ice Arena Project), Series 2016A; to finance the construction of an outdoor refrigerated covered ice rink at Hasse Arena; and to pay costs associated with issuance of the Bonds. The bonds are general obligations of the City and are payable from an abatement levy and ad valorem taxes. This refunding resulted in an aggregate difference in debt service cash flows between the refunding debt and the refunded debt of $634,677 as well as an economic net present value benefit of $171,723 on the transaction. General Obligation Bonds, Series 2022C On July 18, 2022, the City issued the General Obligation Bonds, Series 2022C were being issued by the City pursuant to Minnesota Statutes, Chapters 429 and 475, as amended, and a voter referendum held on November 2, 2021, which passed by a vote of 7,346 (yes) to 4,681 (no). Proceeds of the Bonds will be used to finance the City's 2022 street improvements, various park improvements, and to pay costs associated with issuance of the Bonds. The Bonds are valid and binding general obligations of the City and are payable from special assessments levied against benefitted properties and ad valorem taxes. The full faith and credit of the City is also pledged to their payment. The Bonds maturing on February 1, 2031 and thereafter are subject to redemption, in whole or in part, on February 1, 2030 and on any date thereafter at a price of par plus accrued interest.Principal due with respect to the Bonds is payable annually on February 1, commencing February 1, 2024. Interest due with respect to the Bonds is payable semiannually on February 1 and August 1, commencing August 1, 2023. General Obligation Bonds, Series 2023A The General Obligation Bonds, Series 2023A were issued on July 20, 2023 in the amount of $9,220,000, pursuant to Minnesota Statutes, Chapter 475 and Section 475.58, Subdivision 3b and a voter referendum held of November 2, 2021, which passed by a vote of 7,346 (yes) to 4,681 (no). Proceeds of the Bonds were used to finance the City’s 2023 street reconstruction projects and various park improvements and to pay costs associated with issuance of the Bonds. The Bonds are valid and binding general obligations of the City and are payable from ad valorem taxes. The full faith and credit of the City is also pledged to their payment. The Bonds maturing on February 1, 2032 and thereafter are subject to redemption, in whole or in part, on February 1, 2031 and on any date thereafter at a price of par plus accrued interest. Principal due with respect to the Bonds is payable annually on February 1, commencing February 1, 2025. Interest due with respect to the Bonds is payable semiannually on February 1 and August 1, commencing February 1, 2024. Page 502 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (72) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) General Obligation Bonds, Series 2024A The General Obligation Bonds, Series 2024A were issued on July 17, 2024 in the amount of $21,530,000, pursuant to Minnesota Statutes, Chapter 475 and Section 475.58, Subdivision 3b and a voter referendum held of November 2, 2021, which passed by a vote of 7,346 (yes) to 4,681 (no). Proceeds of the Bonds will be used to finance the City's 2024 street reconstruction and collector rehabilitation projects and various park improvements and to pay costs associated with issuance of the Bonds. The Bonds are valid and binding general obligations of the City and are payable from ad valorem taxes. The full faith and credit of the City is also pledged to their payment. The Bonds maturing on February 1, 2033 and thereafter are subject to redemption, in whole or in part, on February 1, 2032 and on any date thereafter at a price of par plus accrued interest. Principal due with respect to the Bonds is payable annually on February 1, commencing February 1, 2026. Interest due with respect to the Bonds is payable semiannually on February 1 and August 1, commencing February 1, 2025. Leases Payable The City also leases liquor store space, as a lessee, as well as certain operating under long-term, non-cancelable lease agreements. The Heritage Liquor Store lease (located in Heritage Shopping Center) consists of 8,859 square feet of space and expires on June 30, 2027. This lease was discounted at a rate of 0.636%. The Kenrick Liquor Store lease (located off Kenrick Avenue) consists of 9,705 square feet of space and expires on April 30, 2038. This lease was discounted at a rate of 1.24%. The City also has an internal lease between the HRA and the Liquor fund for space that was funding by the 2017A lease revenue liquor enterprise refunding bonds. Page 503 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (73) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) The City had the following long-term liabilities outstanding at December 31, 2024: Description Maturities Interest Rates Amount PRIMARY GOVERNMENT Governmental Activities: General Obligation Bonds Payable: General obligation bonds 2026 - 2044 1.75% - 5.00%64,575,000$ G.O. improvement bonds 2029 - 2038 1.50% - 5.00%57,800,000 State-aid street revenue bonds 2036 1.25% - 5.00%3,260,000 G.O. water revenue bonds 2034 2.00% - 5.00%5,125,000 Tax abatement Bonds 2031 - 2042 1.00% - 5.00%16,290,000 Total General Obligation Bonds 147,050,000 Business-Type Activities: Revenue Bonds Water revenue bonds 2028 - 2034 1.50% - 5.00%7,415,000 Sewer revenue bonds 2025 1.50% - 5.00%70,000 Street light revenue bonds 2026 5.00%100,000 Total Revenue Bonds 7,585,000 Financed purchase arrangements 2027 2.00% - 3.00%815,000 Lease liability 2024- 2038 1.16% - 3.00%3,047,079 Total Business-Type Activities 11,447,079 Total long-term bonded debt outstanding 158,497,079$ The City is in compliance with all significant bond covenants.Annual bond debt service requirements to maturity for long-term bond obligations are as follows: Year Ending December 31, Principal Interest Principal Interest Total 2025 12,910,000$ 5,422,749$ 1,130,000$ 258,788$ 19,721,537$ 2026 13,710,000 4,811,131 1,105,000 208,588 19,834,719 2027 13,035,000 4,255,870 950,000 133,538 18,374,408 2028 13,490,000 3,731,965 980,000 133,538 18,335,503 2029 13,130,000 3,211,829 915,000 97,988 17,354,817 2030 - 2034 48,145,000 9,633,996 2,505,000 144,656 60,428,652 2035 - 2039 18,325,000 3,944,926 - - 22,269,926 2040 - 2044 13,220,000 1,299,997 - - 14,519,997 2044 1,085,000 22,378 - - 1,107,378 Total 147,050,000$ 36,334,841$ 7,585,000$ 977,096$ 190,839,559$ Governmental Business-Type Page 504 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (74) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) Annual bond debt service requirements to maturity for financed purchases payable and the liquor lease liability are as follows: Year Ending December 31, Principal Interest 2025 265,000$ 20,475$ 2026 270,000 12,450 2027 280,000 4,200 Total 815,000$ 37,125$ Liquor Financed Purchase Year Ending December 31, Principal Interest 2025 335,306$ 33,728$ 2026 343,608 30,564 2027 259,588 27,457 2028 181,353 25,137 2029 188,254 22,830 2030-2034 1,001,903 78,101 2035-2038 737,067 15,718 Total 3,047,079$ 233,535$ Liquor Lease Liability Accrued Compensated Absences Governmental Activities The governmental funds accumulated liability for accrued PTO, comp pay, vacation, and sick pay (including applicable salary-related payments) as of December 31, 2024 is $3,851,391. This amount is included in the noncurrent liabilities of the government-wide statement of net position. In the event of employee separation from the City, the related compensated leave internal service fund, general fund, and the responsible special revenue fund will pay the accumulated severance portion. Business-Type Activities The accumulated liability for accrued PTO, vacation,and sick pay for proprietary enterprise funds (including applicable salary-related payments) as of December 31, 2024 is $633,676. In the event of employee separation from the City, the responsible enterprise fund will pay the accumulated severance portion. These amounts are recorded as a liability and as an expense when earned in the responsible funds. Page 505 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (75) NOTE 5 LONG-TERM DEBT (CONTINUED) A.Components of Long-Term Debt (Continued) Unamortized Bond Premium and Discount Unamortized bond premium and bond discount included within noncurrent liabilities are as follows: Governmental Business-Type Unamortized bond premium 8,707,323$ 555,730$ B.Changes in Long-Term Debt Long-term liability activity for the year ended December 31, 2024 was as follows: Beginning End of Due Within PRIMARY GOVERNMENT of Year Additions Deletions Year One Year Governmental Activities General obligation bonds 53,025,000$ 15,075,000$ (3,525,000)$ 64,575,000$ 4,715,000$ Other bonds 84,000,000 6,455,000 (7,980,000) 82,475,000 8,195,000 Total bonds 137,025,000 21,530,000 (11,505,000) 147,050,000 12,910,000 Direct Borrowing - County note payable 10,067,476 765,792 (5,659,120) 5,174,148 - Direct Borrowing - Metropolitan Council loans 2,956,795 - - 2,956,795 - Total long-term debt 150,049,271 22,295,792 (17,164,120) 155,180,943 12,910,000 Accrued compensated absences 3,787,849 2,661,835 (2,598,293) 3,851,391 2,598,292 Unamortized bond premium/discount 9,037,183 1,389,304 (1,719,164) 8,707,323 - Total Governmental Activities 162,874,303 26,346,931 (21,481,577) 167,739,657 15,508,292 Business-Type Activities: Utility - water revenue bonds 8,380,000 - (965,000) 7,415,000 1,010,000 Utility - sewer revenue bonds 135,000 - (65,000) 70,000 70,000 Utility - street light revenue bonds 145,000 - (45,000) 100,000 50,000 Liquor - lease liability 3,374,280 - (327,201) 3,047,079 335,306 Financed purchase arrangements 1,075,000 - (260,000) 815,000 265,000 Accrued compensated absences 563,834 501,279 (431,437) 633,676 431,437 Unamortized Bond Premiums 726,085 - (170,355) 555,730 - Total Business-Type Activities 14,399,199 501,279 (2,263,993) 12,636,485 2,161,743 Total Primary Government 177,273,502$ 26,848,210$ (23,745,570)$ 180,376,142$ 17,670,035$ Page 506 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (76) NOTE 6 NET INVESTMENT IN CAPITAL ASSETS Net investment in capital assets as of December 31, 2024 is calculated as follows: Governmental Business-type Total Capital assets, net of depreciation / amortization 387,482,576$ 211,014,799$ 598,497,375$ Less applicable: Bonds payable (118,925,000) (7,485,000) (126,410,000) Lease liability and financed purchase payable - (3,862,079) (3,862,079) Loan payable (2,956,795) - (2,956,795) Note payable (5,174,148) - (5,174,148) Unamortized bond premium / discount (net)(8,620,804) (555,730) (9,176,534) Unamortized deferred gain on refunding (844,291) - (844,291) Unspent bond proceeds 11,073,220 - 11,073,220 Contracts payable (2,495,859) - (2,495,859) Net Investment in capital assets 259,538,899$ 199,111,990$ 458,650,889$ The City has $28,225,000 in bonds and $86,519 in unamortized bond premiums that are not included in the calculation above as they are not capital in nature. NOTE 7 RESTRICTED NET POSITION The government-wide statement of net position reports restricted amounts in the net position section. These amounts represent net position that has imposed restrictions placed on it by parties outside the City government. Net position restricted for debt service represents assets pledged by bond covenant to the repayment of City bond obligations. The government-wide restricted net position is as follows: Governmental Business-type Activities Activities Total Restricted Net Position Special purposes 429,105$ -$ 429,105$ Debt service 33,709,823 - 33,709,823 Capital acquisition 30,317,533 - 30,317,533 Public safety 3,156,649 - 3,156,649 Opioid remediation activities 414,682 - 414,682 Fire relief pensions 4,402,307 - 4,402,307 Total restricted net position 72,430,099$ -$ 72,430,099$ Page 507 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (77) NOTE 8 CONSTRUCTION COMMITMENTS The City has outstanding construction and build projects as of December 31, 2024. These projects include street reconstruction projects, equipment purchases, land purchases and other water and sanitary sewer projects. The City’s commitments with contractors and other governmental entities are shown as follows: Projects Remaining Governmental Activities Spent-to-Date Commitment ERP Implementation Project 813,226$ 25,620$ 215th St Extension, CP22-24 Airlake improvements 4,940,320 233,640 185th St Extension (CP24-04)9,970,532 10,006 2022 Street reconstruction projects 6,410,920 360,788 2024 Street reconstruction CP24-02 4,058,730 380,706 2024 Collector Rd Rehab. CP24-03 2,069,680 114,442 Casperson park irrigation 69,689 14,162 Voyageur Farms pedestrian bridge - 62,300 Trail gaps project CP23-06 2,283,139 270,945 179th St project 23-04 - 3,775,074 North Creek stormwater management CP23-59 377,588 3,283 City Hall renovations 645,811 22,994 Grand Prairie Park Project 8,748,125 9,273,330 Hasse Arena covered ice rink (Apex)577,280 14,011 Other/miscellaneous projects 51,844 58,156 Total governmental 41,016,884$ 14,619,457$ Projects Remaining Business-Type Activities Spent-to-Date Commitment Stormwater restoration/improvement projects 62,931$ 198,725$ Total business-type 62,931$ 198,725$ Page 508 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (78) NOTE 9 FUND BALANCES A summary of the City’s governmental fund balance classifications at December 31, 2024 is as follows: Debt Service Capital Projects General Fund Fund Fund Nonmajor Total Nonspendable Inventory 308,206$ -$ -$ -$ 308,206$ Prepaid Items 44,559 - - - 44,559 Total nonspendable 352,765 - - - 352,765 Restricted for: Debt Service - 23,590,844 - - 23,590,844 Public improvements - - 5,734,501 - 5,734,501 Street construction - - 5,285,847 - 5,285,847 Public safety aid 1,850,000 - 1,306,649 - 3,156,649 Park development - - 8,469,235 - 8,469,235 Tax increment - - 320,083 - 320,083 Parks bond referendum - - 12,015,427 - 12,015,427 Opioid remediation activities - - - 110,908 110,908 Local Affordable Housing Aid - - - 229,465 229,465 Public communications - - - 186,233 186,233 Special Service District - - - 13,407 13,407 Total Restricted 1,850,000 23,590,844 33,131,742 540,013 59,112,599 Committed for: Public improvements - - 1,193,889 - 1,193,889 Public buildings - - 816,043 - 816,043 Pavement management - - 965,880 - 965,880 Storm water infrastructure - - 7,952,133 - 7,952,133 Water trunk system - - 16,377,704 - 16,377,704 Sanitary sewer trunk system - - 14,221,485 - 14,221,485 Parks bond referendum - - 150,000 - 150,000 Trail improvement - - 704,455 - 704,455 Park improvement - - 754,155 - 754,155 Capital acquisitions - - 3,043,212 - 3,043,212 Technology equipment - - 429,476 - 429,476 Public communications - - - 1,096,532 1,096,532 Arenas improvement projects - - 266,328 - 266,328 Total Committed - - 46,874,760 1,096,532 47,971,292 Unassigned (Deficit)20,983,864 - (315,779) - 20,668,085 Total 23,186,629$ 23,590,844$ 79,690,723$ 1,636,545$ 128,104,741$ Page 509 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (79) NOTE 10 CONTRIBUTED CAPITAL The ownership of local streets, storm water, parks, water,and sanitary sewer infrastructure capital assets that are constructed and completed during the year by private land developers becomes contributed property of the City. Storm sewer, water,and sanitary sewer infrastructure assets constructed within Dakota County and state of Minnesota right- of-way boundaries also become City capital assets since they are serviced and maintained by the City. Roads and highways constructed within Dakota County and state of Minnesota right-of-way boundaries are excluded from City capital assets. The City assumed ownership of the following governmental and business-type capital assets contributed from private land developers during the current fiscal year as follows: Enterprise From Private Land Developers Governmental Utility Fund Infrastructure: Streets 4,694,456$ -$ Storm sewer 6,141,513 - Parks 691,702 - W ater - 4,857,199 Sanitary sewer - 4,974,246 Total 11,527,671$ 9,831,445$ The ownership of water and sanitary sewer infrastructure assets that are constructed and completed during the year by City governmental activities (through various funding sources at cost) becomes contributed property of the City’s enterprise utility fund. The ownership of liquor store assets that are constructed and completed during the year by City governmental activities (through various funding sources at cost) becomes contributed property of the City’s liquor fund. The City’s enterprise utility fund and liquor fund assumed ownership of the following capital assets contributed during the current fiscal year as follows: Enterprise From Governmental Activities Utility Fund Infrastructure: W ater 825,953$ Sanitary sewer 438,563 Total 1,264,516$ Page 510 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (80) NOTE 11 STEWARDSHIP AND ACCOUNTABILITY Although total fund balance was positive, the capital projects fund has a deficit unassigned fund balance of $319,113 as of December 31, 2024 for an internally tracked project, as a result of paying for capital expenditures for projects for which no debt has been issued yet. It is anticipated that the deficit will be financed by future bond proceeds, intergovernmental revenues, special assessments, and transfers from other funds. NOTE 12 INTERFUND TRANSFERS The City provides financing for a variety of operations and capital projects utilizing resources from certain funds; interfund transfers used for these various activities during the current fiscal year are as follows: General Debt Service Capital Projects Transfers From:Fund Fund Fund Total General fund -$ -$ 215,000$ 215,000$ Debt service fund - - - - Capital projects fund - 678,588 - 678,588 Nonmajor govermental funds 196,998 - 7,300 204,298 Total 196,998 678,588 222,300 1,097,886 Enterprise - liquor 30,000 750,450 559,500 1,339,950 Enterprise - utility - 523,569 293,500 817,069 Total 226,998$ 1,952,607$ 1,075,300$ 3,254,905$ (1)(2)(3), (4), (5) Transfers To: The following are explanations to interfund transfers sub-notes 1 through 5. Abbreviation key: (SR) special revenue fund, (DS) debt service fund, (CP) capital projects fund, (Ent)enterprise fund. Page 511 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (81) NOTE 12 INTERFUND TRANSFERS (CONTINUED) (1)The transfers to the general fund were provided mainly to move the Forestry department to the General fund and as overhead and maintenance costs from the following funds: Fund Amount Liquor (Ent)30,000$ Contribution to Pan-o-Prog Fireworks SRF (Opioid Fund)196,998 One-time transfer to move Opioid grant funding to cover eligible costs in General Fund Total 226,998$ Description (2)The transfers to the debt service fund were provided by the following funds mainly to transfer back excess bond proceeds and related to the City improvements projects whereby user fees are pledged towards the improvement bonds debt service requirements. Fund Am ount Arenas Capital Projects (CP)66,563$ Water Trunk Fund (CP)612,025 Utility (Ent)523,569 Liquor (Ent)400,000 Liquor (Ent)350,450 Total 1,952,607$ Description Transfer to 2020A tax abatement bonds (DSF) for payments received from associations/donations Water revenue (DS) for debt service requirements Total transfer to the DS GO improvement bonds provided by the enterprise utility fund related to the City im provement projects whereby user fees are pledged towards the improvement bonds debt service requirements. Total transfer to the DS GO bonds provided by the enterprise liquor fund related to the City improvement projects whereby user fees are pledged towards the improvement bonds debt service requirements (police station). Transfer to the DS GO bonds provided by the enterprise liquor fund related to the Keokuk Liquor Store construction. (3)The total transfers to the capital projects fund from other governmental funds were provided to finance various construction projects as follows: From:Amount General Fund 215,000$ Communications Fund (SR)7,300 Total 222,300$ Description Technology Fund (CP) for future technology purchases/costs and ERP project Technology Fund (CP) for future technology-equipment purchases (4)The total transfer to the capital projects fund was provided by the liquor enterprise fund to finance various construction projects: From:Am ount Liquor (Ent)59,500$ Liquor (Ent)500,000 Total 559,500$ Description Technology Fund (CP) for future technology-equipment purchases Equipment Fund (CP) for future equipment purchases (5)The total transfer to the capital projects fund was provided by the utility enterprise fund to finance various construction projects: From:Am ount Environmental Resources Fund (EF)4,600$ Environmental Resources Fund (EF)40,500 Water Operating Fund (EF)14,200 Sanitary Sewer Operating Fund (EF)14,200 Environmental Resources Fund (EF)220,000 Total 293,500$ Technology Fund (CP) for future technology-equipment purchases Equipment Fund (CP) for future equipment purchases Technology Fund (CP) for future technology-equipment purchases Technology Fund (CP) for future technology-equipment purchases One-time contribution to Building Fund (CP) for materials bunker project Description Page 512 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (82) NOTE 13 JOINT POWERS DEBT COMMITMENT On August 25, 2005,the City of Lakeville entered into a joint powers agreement with the Cities of Apple Valley, Burnsville, Eagan, Farmington, Hastings, Inver Grove Heights, Mendota Heights, Rosemount, South St. Paul, West St. Paul, Minnesota, and Dakota County Minnesota, to establish the Dakota 911 (D911), a Minnesota nonprofit corporation. The purpose of the D911 is to engage in the operation and maintenance of a countywide public safety answering point and communications center for law enforcement, fire, emergency medical services, and other public safety services for the mutual benefit of residents residing in the above mentioned cities and county (members). Pursuant to the joint powers agreement, members are required to provide the D911 their pro rata share of cost of operations and maintenance, and capital projects. Information regarding the Dakota 911 can be obtained at the website https://dakota911mn.gov/or by contacting Julie Stahl at the City of Lakeville, 20195 Holyoke Avenue, Lakeville, Minnesota 55044. Telephone 952-985-4481 or email address jstahl@lakevillemn.gov. NOTE 14 OTHER POSTEMPLOYMENT BENEFITS (OPEB) A.Plan Description The City provides postemployment insurance benefits to certain eligible employees through the City’s Other Postemployment Benefits Plan, a single-employer defined benefit plan administered by the City. All postemployment benefits are based on contractual agreements with employee groups. These contractual agreements do not include any specific contribution or funding requirements. These benefits are summarized as follows: Postemployment Insurance Benefits –All retirees of the City have the option under state law to continue their medical insurance coverage through the City from the time of retirement until the employee reaches the age of eligibility for Medicare. For members of all employee groups, the retiree must pay the full premium to continue coverage for medical and dental insurance. The City is legally required to include any retirees for whom it provides health insurance coverage in the same insurance pool as its active employees, whether the premiums are paid by the City or the retiree. Consequently, participating retirees are considered to receive a secondary benefit known as an “implicit rate subsidy.”This benefit relates to the assumption that the retiree is receiving a more favorable premium rate than they would otherwise be able to obtain if purchasing insurance on their own, due to being included in the same pool with the City’s younger and statistically healthier active employees. Page 513 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (83) NOTE 14 OTHER POSTEMPLOYMENT BENEFITS (OPEB)(CONTINUED) A.Plan Description (Continued) Employees Covered by Benefit Terms –At December 31, 2024, the following employees were covered by the benefit terms: Inactive Plan Members or Beneficiaries Currently Receiving Benefit Payments 5 Inactive Plan Members Entitled to but not yet Receiving Benefit Payments - Active Plan Mem bers 229 Total 234 B.Contributions and Funding Policy The required contribution is based on projected pay-as-you-go financing requirements, with additional amounts to pre-fund benefits as determined annually by the City. The City contributes a portion of the cost of current year premiums for eligible retired plan members and their spouses as well as the implicit rate subsidy described above. For fiscal year 2024, the City contributed $35,154 in subsidized payments and implicit payments of $12,648 to the plan. As of December 31, 2024,there were five retirees receiving health benefits from the City’s health plans.The City holds no assets in trust related to this plan. C.Total OPEB Liability The City’s Total OPEB liability was measured as of January 1, 2024 and was determined by an actuarial valuation as of January 1, 2023. Actuarial Assumptions The total OPEB liability in the January 1, 2023 actuarial valuation was determined using the following actuarial assumptions, applied to all periods included in the measurement, unless otherwise specified: Valuation date: Measurement date: Methods and assum ptions used to determine the contribution rates: Actuarial cost method Entry age Amortization method Level percentage of payroll, closed Amortization period Average of expected remaining service on a closed basis for differences between expected and actual experience and assumption changes. Inflation 3.00% Healthcare cost trend rate 5.50% for 2024, decreasing to 5.00% by 2026 Salary increases 3.00% Discount rate 4.00% (20-year municipal bond yield) Mortality RP-2014 White Collar Mortality Tables with MP-2021 Generational Improvement Scale (with Blue Collar adjustment for Police and Fire Personnel) January 1, 2023 January 1, 2024 Page 514 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (84) NOTE 14 OTHER POSTEMPLOYMENT BENEFITS (OPEB)(CONTINUED) C.Total OPEB Liability (Continued) Discount Rate The City’s OPEB plan is not funded by a trust, and therefore, the City’s uses the 20-year municipal bond index rate to develop its long-term rate of return and discount rate. This rate was 4.00% in the current actuarial valuation,which was updated from the 4.31% used in the prior measurement date. D.Changes in the Total OPEB Liability The details of the changes in the City’s total OPEB liability were as follows for 2024: Increase (Decrease) Total OPEB Liability (a) Balances at 12/31/23 1,074,960$ Changes for the Year: Service Cost 94,527 Interest 49,386 Benefit Payments (47,802) Changes in Assumptions 28,776 Net Changes 124,887 Balances at 12/31/24 1,199,847$ The following changes in assumptions and plan provisions occurred between the current and prior actuarial valuations: Discount rate of 4.31% was updated to 4.00%. There have been no changes in plan provisions since the prior valuation. Page 515 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (85) NOTE 14 OTHER POSTEMPLOYMENT BENEFITS (OPEB)(CONTINUED) E.Sensitivity of Total OPEB Liability Sensitivity of the total OPEB liability to changes in the discount rate and healthcare cost trend rates. The following presents the total OPEB liability of the City, as well as what the City's net OPEB liability would be if it were calculated using a discount rate that is one percentage point lower (3.31%) or one percentage point higher (5.31%) than the current discount rate: 1% Decrease Discount Rate 1% Increase (3.00)%(4.00)%(5.00)% Total OPEB Liability (Asset)1,296,749$ 1,199,847$ 1,109,273$ Sensitivity of the net OPEB liability to changes in the healthcare cost trend rates. The following presents the net OPEB liability of the City, as well as what the City's net OPEB liability would be if it were calculated using healthcare cost trend rates that are one percentage point lower (4.5% decreasing to 4.00%) or one percentage point higher (6.5% decreasing to 6.00%) than the current healthcare cost trend rates: Healthcare Cost 1% Decrease Trend Rates 1% Increase (4.50%(5.50%(6.50% Decreasing Decreasing Decreasing to 4.00%)to 5.00%)to 6.00%) Total OPEB liability (asset)1,046,933$ 1,199,847$ 1,383,487$ F.OPEB Expense and Deferred Outflows of Resources and Deferred Inflows of Resources Related to OPEB For the year ended December 31, 2024, the City recognized OPEB expense of $110,415. At December 31, 2024, the City reported deferred outflows of resources and deferred inflows of resources related to OPEB from the following sources: Deferred Deferred Outflows of Inflows of Resources Resources Differences Between Expected and Actual Experience 155,467$ 351,684$ Changes of Assumptions 108,117 145,481 Contributions After Measurement Date and Before the Reporting Date 44,782 - Total 308,366$ 497,165$ Page 516 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (86) NOTE 14 OTHER POSTEMPLOYMENT BENEFITS (OPEB)(CONTINUED) F.OPEB Expense and Deferred Outflows of Resources and Deferred Inflows of Resources Related to OPEB (Continued) A total of $44,782 reported as deferred outflows of resources related to OPEB resulting from City contributions subsequent to the measurement date will be recognized as a reduction of the total OPEB liability in the year ended December 31, 2024.Other amounts reported as deferred outflows and inflows of resources related to postemployment benefits will be recognized in OPEB expense as follows: Year Ending Decem ber 31,Amount 2025 (33,498)$ 2026 (33,498) 2027 (33,498) 2028 (33,498) 2029 (33,498) Thereafter (66,091) NOTE 15 RISK FINANCING AND RELATED INSURANCE ISSUES The City is exposed to various risks of loss related to torts; theft of, damage to, and destruction of assets; errors and omissions; injuries to employees; and natural disasters. The City purchased the following insurance coverage through the League of Minnesota Cities Insurance Trust (LMCIT), a public entity risk pool currently operating as a common risk management and insurance program for Minnesota cities: general liability, excess liability, workers compensation, property, automobile, marine, crime, employee dishonesty, boiler, petro fund, and open meeting law. The City pays an annual premium to the LMCIT for its insurance coverage. The LMCIT is self-sustaining through member premiums and will reinsure through commercial companies for claims in excess of reserved amounts for each insured event. The LMCIT allows for the pool to make additional assessments to make the pool self-sustaining. Current state statutes (Minnesota Statutes Subd. 466.04) provide limits of liability for the City.There were no significant reductions in insurance from the previous year or settlements in excess of insurance coverage for any of the past three fiscal years. Page 517 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (87) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE A.Plan Description The City of Lakeville participates in the following cost-sharing multiple-employer defined benefit pension plans administered by the Public Employees Retirement Association of Minnesota (PERA). PERA’s defined-benefit pension plans are established and administered in accordance with Minnesota Statutes, Chapters 353 and 356. PERA’s defined-benefit pension plans are tax-qualified plans under Section 401(a) of the Internal Revenue Code. 1.General Employees Retirement Plan (GERF) Membership in the General Plan includes employees of counties, cities, townships, schools in non-certified positions, and other governmental entities whose revenues are derived from taxation, fees, or assessments. Plan membership is required for any employee who is expected to earn more than $425 in a month, unless the employee meets exclusion criteria. 2.Public Employees Police and Fire Plan (PEPFF) Membership in the Police & Fire Plan includes full-time, licensed police officers and firefighters who meet the membership criteria defined in Minnesota Statutes section 353.64 and who are not earning service credit in any other PERA retirement plan or a local relief association for the same service. Employers can provide Police & Fire Plan coverage for part-time positions and certain other public safety positions by submitting a resolution adopted by the entity’s governing body. The resolution must state that the position meets plan requirements. B.Benefits Provided PERA provides retirement, disability, and death benefits. Benefit provisions are established by state statute and can only be modified by the state Legislature. Vested, terminated employees who are entitled to benefits, but are not receiving them yet, are bound by the provisions in effect at the time they last terminated their public service. When a member is “vested,” they have earned enough service credit to receive a lifetime monthly benefit after leaving public service and reaching an eligible retirement age. Members who retire at or over their Social Security full retirement age with at least one year of service qualify for a retirement benefit. 1.General Employees Retirement Plan Benefits General Employees Plan requires three years of service to vest. Benefits are based on a member’s highest average salary for any five successive years of allowable service, age, and years of credit at termination of service. Two methods are used to compute benefits for General Plan members. Members hired prior to July 1, 1989, receive the higher of the Step or Level formulas. Only the Level formula is used for members hired after June 30, 1989. Under the Step formula, General Plan members receive 1.2% of the highest average salary for each of the first 10 years of service and 1.7% for each additional year. Under the Level formula, General Plan members receive 1.7% of highest average salary for all years of service. For members hired prior to July 1, 1989 a full retirement benefit is available when age plus years of Page 518 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (88) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) B.Benefits Provided (Continued) 1.General Employees Retirement Plan Benefits (Continued) service equal 90 and normal retirement age is 65. Members can receive a reduced requirement benefit as early as age 55 if they have three or more years of service. Early retirement benefits are reduced by .25% for each month under age 65. Members with 30 or more years of service can retire at any age with a reduction of .25% for each month the member is younger than age 62. The Level formula allows General Plan members to receive a full retirement benefit at age 65 if they were first hired before July 1, 1989 or at age 66 if they were hired on or after July 1, 1989. Early retirement begins at age 55 with an actuarial reduction applied to the benefit. Benefit increases are provided to benefit recipients each January. The postretirement increase is equal to 50% of the cost-of-living adjustment (COLA) announced by the SSA, with a minimum increase of at least 1% and a maximum of 1.5%. The 2024 annual increase was 1.5%. Recipients that have been receiving the annuity or benefit for at least a full year as of the June 30 before the effective date of the increase will receive the full increase. Recipients receiving the annuity or benefit for at least one month but less than a full year as of the June 30 before the effective date of the increase will receive a prorated increase. 2.Police and Fire Plan Benefits Benefits for Police and Fire Plan members hired before July 1, 2010, are vested after three years of service. Members hired on or after July 1, 2010, are 50% vested after five years of service and 100% vested after ten years. After five years, vesting increase by 10% each full year of service until members are 100% vested after ten years. Police and Fire Plan members receive 3 percent of highest average salary for all years of service. Police and Fire Plan members receive a full retirement benefit when they are age 55 and vested, or when their age plus their years of service equals 90 or greater if they were first hired before July 1, 1989. Early retirement starts at age 50, and early retirement benefits are reduced by 0.417% each month members are younger than age 55. Benefit increases are provided to benefit recipients each January. The postretirement increase is fixed at 1%. Recipients that have been receiving the annuity or benefit for at least 36 months as of the June 30 before the effective date of the increase will receive the full increase. Recipients receiving the annuity or benefit for at least 25 months but less than 36 months as of the June 30 before the effective date of the increase will receive a prorated increase. Page 519 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (89) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) C.Contributions Minnesota Statutes chapters 353, 353E, 353G, and 356 set the rates for employer and employee contributions. Contribution rates can only be modified by the state Legislature. 1.General Employees Fund Contributions General Plan members were required to contribute 6.50% of their annual covered salary in fiscal year 2024 and the City was required to contribute 7.50% for Coordinated Plan members. The City contributions to the General Employees Fund for the year ended December 31, 2024 were $1,126,459, which was equal to the required contribution as set by state statute. 2.Police and Fire Fund Contributions Police and Fire Plan members were required to contribute 11.80% of their annual covered salary in fiscal year 2024 and the City was required to contribute 17.70% for Police and Fire Plan members. The City’s contributions to the Police and Fire Fund for the year ended December 31, 2024 were $1,557,876.The City’s contributions were equal to the required contributions as set by state statute. D.Pension Costs 1.General Employees Fund Pension Costs At December 31, 2024, the City reported a liability of $6,660,502 for its proportionate share of the General Employees Fund’s net pension liability. The City’s net pension liability reflected a reduction due to the state of Minnesota’s contribution of $16 million. The state of Minnesota is considered a non-employer contributing entity and the state’s contribution meets the definition of a special funding situation. The State of Minnesota’s proportionate share of the net pension liability associated with the City totaled $172,227. City's Proportionate Share of the Net Pension Liability 6,660,502$ State of Minnesota's Proportionate Share of the Net Pension Liability Associated with the City 172,227 Total 6,832,729$ The net pension liability was measured as of June 30, 2024, and the total pension liability used to calculate the net pension liability was determined by an actuarial valuation as of that date. The City’s proportionate share of the net pension liability was based on the City’s contributions received by PERA during the measurement period for employer payroll paid dates from July 1, 2023 through June 30, 2024, relative to the total employer contributions received from all of PERA’s participating employers. The City’s proportionate share was 0.1802% at the end of the measurement period and 0.1929% for the beginning of the period. Page 520 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (90) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) D.Pension Costs (Continued) 1.General Employees Fund Pension Costs (Continued) For the year ended December 31, 2024, the City recognized pension expense of $725,327 for its proportionate share of the General Employees Plan’s pension expense. At December 31, 2024, the City reported deferred outflows of resources and deferred inflows of resources related to pensions from the following sources: Deferred Outflows Deferred Inflows Description of Resources of Resources Differences Between Expected and Actual Economic Experience 626,262$ -$ Changes in Actuarial Assumptions 32,519 2,520,890 Net Difference Between Projected and Actual Earnings on Pension Plan Investments - 1,934,155 Changes in Proportion and Differences Between City Contributions and Proportionate Share of Contributions 413,782 600,226 City Contributions Subsequent to the Measurement Date 637,167 - Total 1,709,730$ 5,055,271$ The $637,167 reported as deferred outflows of resources related to pensions resulting from City contributions subsequent to the measurement date will be recognized as a reduction of the net pension liability in the year ended December 31, 2025. Other amounts reported as deferred outflows and inflows of resources related to pensions will be recognized in pension expense as follows: Pension Expense Year Ending Decem ber 31,Am ount 2025 (2,056,825)$ 2026 (399,263) 2027 (1,016,133) 2028 (510,487) Page 521 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (91) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) D.Pension Costs (Continued) 2.Police and Fire Fund Pension Costs At December 31, 2024, the City reported a liability of $8,132,040 for its proportionate share of the Police and Fire Fund’s net pension liability. The net pension liability was measured as of June 30, 2024, and the total pension liability used to calculate the net pension liability was determined by an actuarial valuation as of that date. The City’s proportionate share of the net pension liability was based on the City’s contributions received by PERA during the measurement period for employer payroll paid dates from July 1, 2023 through June 30, 2024, relative to the total employer contributions received from all of PERA’s participating employers. The City’s proportionate share was 0.6181% at the end of the measurement period and 0.0608% for the beginning of the period. The State of Minnesota contributed $37.4 million to the Police and Fire Fund in the plan fiscal year ended June 30, 2024. The contribution consisted of $9 million in direct state aid that meets the definition of a special funding situation, additional one- time direct state aid contribution of $19.4 million, and $9 million in supplemental state aid that does not meet the definition of a special funding situation. Additionally, $9 million supplemental state aid was paid on October 1, 2024. Thereafter, by October 1 of each year, the state will pay $9 million to the Police and Fire Fund until full funding is reached or July 1, 2048, whichever is earlier. The $9 million in supplemental state aid will continue until the fund is 90% funded, or until the State Patrol Plan (administered by the Minnesota State Retirement System) is 90% funded, whichever occurs later. The State of Minnesota’s proportionate share of the net pension liability associated with the City totaled $309,990. City's Proportionate Share of the Net Pension Liability 8,132,040$ State of Minnesota's Proportionate Share of the Net Pension Liability Associated with the City 309,990 Total 8,442,030$ For the year ended December 31, 2024, the City recognized pension expense of $1,596,323 for its proportionate share of the Police and Fire Plan’s pension expense. Page 522 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (92) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) D.Pension Costs (Continued) 2.Police and Fire Fund Pension Costs (Continued) At December 31, 2024, the City reported deferred outflows of resources and deferred inflows of resources related to pensions from the following sources: Deferred Outflows Deferred Inflows Description of Resources of Resources Differences Between Expected and Actual Economic Experience 3,169,126$ -$ Changes in Actuarial Assumptions 8,939,221 11,974,638 Net Difference Between Projected and Actual Earnings on Pension Plan Investments - 2,644,139 Changes in Proportion and Differences Between City Contributions and Proportionate Share of Contributions 438,471 66,311 City Contributions Subsequent to the Measurem ent Date 792,776 - Total 13,339,594$ 14,685,088$ The $792,776 reported as deferred outflows of resources related to pensions resulting from City contributions subsequent to the measurement date will be recognized as a reduction of the net pension liability in the year ended December 31, 2025. Other amounts reported as deferred outflows and inflows of resources related to pensions will be recognized in pension expense as follows: Pension Expense Year Ending December 31,Amount 2025 (329,057)$ 2026 2,215,281 2027 (1,132,567) 2028 (3,108,968) 2029 217,041 3.Aggregate Pension Expense The total pension expense, net pension liability, deferred inflows and deferred outflows of resources, and net pension assets for all plans in which the City participates are summarized below: GERF PEPFF Fire Relief Total Net Pension Liability 6,660,502$ 8,132,040$ (4,402,307)$ 14,792,542$ Deferred Inflows of Resources 5,055,271 14,685,088 1,837,693 21,578,052 Deferred Outflows of Resources 1,709,730 13,339,594 205,825 15,255,149 Pension Expense 727,461 1,718,189 1,650,883 4,096,533 Net Pension Asset N/A N/A 4,402,307 4,402,307 Page 523 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (93) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) E.Long-Term Expected Return on Investment The State Board of Investment, which manages the investments of PERA, prepares an analysis of the reasonableness on a regular basis of the long-term expected rate of return using a building-block method in which best-estimate ranges of expected future rates of return are developed for each major asset class. These ranges are combined to produce an expected long-term rate of return by weighting the expected future rates of return by the target asset allocation percentages. The target allocation and best estimates of geometric real rates of return for each major asset class are summarized in the following table: Long-Term Target Expected Real Asset Class Allocation Rate of Return Domestic Equity 33.5 %5.10 % International Equity 16.5 5.30 Fixed Income 25.0 0.75 Private Markets 25.0 5.90 Totals 100.0 % F.Actuarial Methods and Assumptions The total pension liability for each of the cost-sharing defined benefit plans was determined by an actuarial valuation as of June 30, 2024, using the entry age normal actuarial cost method. The long-term rate of return on pension plan investments used to determine the total liability is 7%. The 7% assumption is based on a review of inflation and investment return assumptions from a number of national investment consulting firms. The review provided a range of investment return rates considered reasonable by the actuary. An investment return of 7% is within that range. Inflation is assumed to be 2.25% for the General Employees Plan, Police & Fire Plan, and the Correctional Plan. Benefit increases after retirement are assumed to be 1.25% for the General Employees Plan, 1% for the Police & Fire Plan, and 2% for the Correctional Plan. Salary growth assumptions in the General Employees Plan range in annual increments from 10.25% after one year of service to 3% after 27 years of service. In the Police & Fire Plan, salary growth assumptions range in annual increments from 11.75% after one year of service to 3% after 24 years of service. In the Correctional Plan, salary growth assumptions range from 11% at age 20 to 3% at age 60. Mortality rates for the General Employees Plan are based on the Pub-2010 General Employee Mortality Table. Mortality rates for the Police & Fire Plan and the Correctional Plan are based on the Pub-2010 Public Safety Employee Mortality tables. The tables are adjusted slightly to fit PERA’s experience. Page 524 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (94) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) F.Actuarial Methods and Assumptions (Continued) Actuarial assumptions for the General Employees Plan are reviewed every four years. The General Employees Plan was last reviewed in 2022. The assumption changes were adopted by the board and became effective with the July 1, 2023 actuarial valuation. The Police & Fire Plan and Correctional Plan were reviewed in 2024. PERA anticipates the experience study will be approved by the Legislative Commission on Pensions and Retirement and become effective with the July 1, 2025 actuarial valuation. The following changes in actuarial assumptions and plan provisions occurred in 2024: General Employees Fund Changes in Actuarial Assumptions: Rates of merit and seniority were adjusted, resulting in slightly higher rates. Assumed rates of retirement were adjusted as follows: increase the rate of assumed unreduced retirements, slight adjustments to Rule of 90 retirement rates, and slight adjustments to early retirement rates for Tier 1 and Tier 2 members. Minor increase in assumed withdrawals for males and females. Lower rates of disability. Continued use of Pub-2010 general mortality table with slight rate adjustments as recommended in the most recent experience study. Minor changes to form of payment assumptions for male and female retirees. Minor changes to assumptions made with respect to missing participant data. Changes in Plan Provisions: The workers’ compensation offset for disability benefits was eliminated. The actuarial equivalent factors updated to reflect the changes in assumptions. Police and Fire Fund Changes in Plan Provisions: The State contribution of $9.0 million per year will continue until the earlier of 1) both the Police & Fire Plan and the State Patrol Retirement Fund attain 90% funded status for three consecutive years (on an actuarial value of assets basis) or 2) July 1, 2048. The contribution was previously due to expire after attaining a 90% funded status for one year. The additional $9.0 million contribution will continue until the Police & Fire Plan is fully funded for a minimum of three consecutive years on an actuarial value of assets basis, or July 1, 2048, whichever is earlier. This contribution was previously due to expire upon attainment of fully funded status on an actuarial value of assets basis for one year (or July 1, 2048 if earlier). Page 525 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (95) NOTE 16 DEFINED BENEFIT PENSION PLANS –STATE-WIDE (CONTINUED) G.Discount Rate The discount rate used to measure the total pension liability in 2024 was 7.0%. The projection of cash flows used to determine the discount rate assumed that contributions from plan members and employers will be made at rates set in Minnesota Statutes. Based on these assumptions, the fiduciary net position of the General Employees, Police and Fire, and Correctional Plans were projected to be available to make all projected future benefit payments of current plan members. Therefore, the long-term expected rate of return on pension plan investments was applied to all periods of projected benefit payments to determine the total pension liability. H.Pension Liability Sensitivity The following presents the City’s proportionate share of the net pension liability for all plans it participates in, calculated using the discount rate disclosed in the preceding paragraph, as well as what the City’s proportionate share of the net pension liability would be if it were calculated using a discount rate one percentage point lower or one percentage point higher than the current discount rate: GERF PENSION LIABILITY 1% Decrease in 1% Increase in Discount Rate Current Discount Discount Rate Description (6.00%)Rate (7.00%)(8.00%) City’s Proportionate Share of the GERF Net Pension Liability 14,547,608$ 6,660,502$ 172,638$ PEPFF PENSION LIABILITY 1% Decrease in 1% Increase in Discount Rate Current Discount Discount Rate Description (6.00%)Rate (7.00%)(8.00%) City’s Proportionate Share of the PEPFF Net Pension Liability 19,217,599$ 8,132,040$ (971,524)$ I.Pension Plan Fiduciary Net Position Detailed information about each pension plan’s fiduciary net position is available in a separately-issued PERA financial report that includes financial statements and required supplementary information. That report may be obtained on the Internet at www.mnpera.org. NOTE 17 DEFINED CONTRIBUTION PLAN Council members of the City are covered by the Defined Contribution Plan, a multiple- employer deferred compensation plan administered by PERA. The Defined Contribution Plan is a tax qualified plan under Section 401(a) of the Internal Revenue Code and all contributions by or on behalf of employees are tax deferred until time of withdrawal. Page 526 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (96) NOTE 17 DEFINED CONTRIBUTION PLAN (CONTINUED) Plan benefits depend solely on amounts contributed to the plan plus investment earnings, less administrative expenses. Minnesota Statutes, Chapter 353D and 356, specifies plan provisions, including the employee and employer contribution rates for those qualified personnel who elect to participate. An eligible elected official who decides to participate contributes five percent of salary which is matched by the elected official's employer. For ambulance service personnel, employer contributions are determined by the employer, and for salaried employees contributions must be a fixed percentage of salary. Employer contributions for volunteer personnel may be a unit value for each call or period of alert duty. Employees who are paid for their services may elect to make member contributions in an amount not to exceed the employer share. Employer and employee contributions are combined and used to purchase shares in one or more of the seven accounts of the Minnesota Supplemental Investment Fund. For administering the plan, PERA receives two percent of employer contributions and twenty-five hundredths of one percent (0.25%) of the assets in each member's account annually. Total contributions made by the City for the current fiscal year were: Required Rate Year Ended, for Employees December 31,Employee Em ployer Em ployee Em ployer and Em ployers 2024 2,795$ 2,795$ 5%5%5% Contribution Amount Percentage of Covered Payroll NOTE 18 DEFINED BENEFIT PENSION PLANS –FIRE RELIEF ASSOCIATION A.Plan Description Volunteer firefighters of the City of Lakeville Fire Department (the Department) are members of the Lakeville Fire Relief Association (the Association), which administers a single-employer defined benefit plan established to provide benefits for its members. The plan is established and administered in accordance with Minnesota Statute, Chapters 69 and 424, as amended. The Association is governed by a board of six members elected by the members of the Association for three-year terms. One City Council member, Finance Director and Fire Chief are ex officio, nonvoting members of the Board of Trustees. As of December 31, 2024, the plan covered 75 active firefighters and 24 vested terminated firefighters whose pension benefits are deferred. The Association maintains a separate Special Fund to accumulate assets to fund the retirement benefits earned by the Department’s membership. Funding for the Association is derived from an insurance premium tax in accordance with the Volunteer Firefighter’s Relief Association Financing Guidelines Act of 1971 (Chapter 261 as amended by Chapter 509 of Minnesota Statutes 1980). Funds are also derived from investment income. Page 527 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (97) NOTE 18 DEFINED BENEFIT PENSION PLANS –FIRE RELIEF ASSOCIATION (CONTINUED) B.Benefits Provided A firefighter who completes at least 20 years as an active member of the Department is entitled, after age 50, to a full service pension upon retirement. The bylaws of the Association also provide for an early vested service pension for a retiring member who has completed fewer than 20 years of service. The reduced pension, available to members with seven years of service, shall be equal to 48%of the pension as described by the bylaws. This percentage increases 4%per year so that at 20 years of service, the full amount prescribed is paid. Members who retire with less than 20 years of service and have reached the age of 50 years and have completed at least seven years of active membership are entitled to a reduced service pension not to exceed the amount calculated by multiplying the member’s service pension for the completed years of service times the applicable nonforfeitable percentage of pension. C.Contributions Minnesota Statutes, Chapters 424 and 424A authorize pension benefits for volunteer fire relief associations. The plan is funded by fire state aid, investment earnings, and, if necessary, employer contributions as specified in Minnesota Statutes and voluntary city contributions (if applicable). The firefighters have no obligation to contribute to the plan. Nonemployer pension contributions include state aid from the state of Minnesota and municipal contributions from the City. On-behalf of the state payments from the state of Minnesota are received initially by the City and subsequently remitted to the Association. These on-behalf of the state aid payments in addition to the City’s municipal contribution payments to the Association plan are recognized as revenues and expenditures in the City’s General Fund during the period received. The City contributed state of Minnesota fire aid of $685,405 to the plan on behalf of the Department for the year ended December 31, 2024, which was recorded as revenue. Required employer contributions are calculated annually based on statutory provisions. The City’s statutorily required contributions to the plan for the year ended December 31, 2024 were $-0-. The City’s contributions were equal to the required contributions as set by state statute. The City made no voluntary contributions to the plan. D.Pension Costs At December 31, 2024, the City reported a net pension liability (asset) of ($4,402,307) for the plan. The net pension liability (asset) was measured as of December 31, 2024. The total pension liability used to calculate the net pension liability (asset) in accordance with GASB Statement No. 68 was determined by Van Iwaarden Associates, applying an actuarial formula to specific census data certified by the Department as of December 31, 2024. Page 528 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (98) NOTE 18 DEFINED BENEFIT PENSION PLANS –FIRE RELIEF ASSOCIATION (CONTINUED) D.Pension Costs (Continued) The following table presents the changes in the net pension liability (asset) during the year: Total Pension Plan Fiduciary Net Pension Liability Net Position Liability (Asset) (a)(b)(a-b) Beginning balance - January 1, 2024 7,413,982$ 11,585,642$ (4,171,660)$ Changes for the year: Service cost 501,314 - 501,314 Interest on pension liability (asset)432,398 - 432,398 Difference between expected and actual economic experience (255,200) - (255,200) Changes of assumptions (126,493) - (126,493) Changes of benefit terms 1,847,064 - 1,847,064 Contributions (employer)- - - Contributions (state)- 685,405 (685,405) Net investm ent income - 1,965,419 (1,965,419) Benefit payments (790,653) (790,653) - Administrative costs - (21,094) 21,094 Total net changes 1,608,430 1,839,077 (230,647) Ending balance - December 31, 2024 9,022,412$ 13,424,719$ (4,402,307)$ For the year ended December 31, 2024, the City recognized pension expense of $1,627,213. At December 31,2024, the City reported deferred outflows of resources, including its contributions subsequent to the measurement date, related to pension from the following sources: Deferred Outflows Deferred Inflows Description of Resources of Resources Changes in Actuarial Assumptions 108,483$ 133,111$ Difference between expected and actual experience 97,342 755,135 Net Difference Between Projected and Actual Earnings on Pension Plan Investments - 949,447 Total 205,825$ 1,837,693$ Amounts reported as deferred outflows and inflows of resources related to the plan will be recognized in pension expense as follows: Pension Expense Year Ending December 31,Amount 2025 (328,134)$ 2026 (93,469) 2027 (696,149) 2028 (392,739) 2029 (33,350) Thereafter (88,027) Page 529 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (99) NOTE 18 DEFINED BENEFIT PENSION PLANS –FIRE RELIEF ASSOCIATION (CONTINUED) E.Actuarial Assumptions The total pension liability at the December 31, 2022 valuation date was determined using the entry age normal actuarial cost method and the following actuarial assumptions: Inflation 2.50% per year Active Member Payroll Growth 2.50% per year Investment Rate of Return 6.25% 20-Year Municipal Bond Yield 4.08% Retirement eligibility at 100%service pension at age 50 with 20 years of service,early vested retirement at age 50 with seven years of service vested at 48%and increased by 4%for each additional year of service up to 20 and eligibility for deferred service pension payable at age 50 and based on the lump sum pension formula and service at date of termination reduced for less than 20 years of service. The target allocation and best estimates of arithmetic real rates of return for each major asset class are summarized in the following table: Allocation at Long-Term Long-Term Measurement Expected Real Expected Nominal Asset Class Date Rate of Return Rate of Return Domestic Equity 64.00 %4.52 %7.02 % International Equity 4.00 5.08 7.58 Fixed Income 11.00 2.44 4.94 Real Estate and Alternatives - 3.73 6.23 Cash and Equivalents 21.00 0.99 3.49 Totals 100.00 %29.26 Reduced for Assumed Investment Expense (0.10) Net Assumed Investment Return (Rounded to 1/4%)5.75 % F.Discount Rate The discount rate used to measure the total pension liability was 6.25%. This was a 0.5% increase from the previous discount rate of 5.75%. The projection of cash flows used to determine the discount rate assumed that contributions to the plan will be made as specified in statute. Based on that assumption and considering the funding ratio of the plan, the fiduciary net position was projected to be available to make all projected future benefit payments of current active and inactive members. Therefore, the long-term expected rate of return on pension plan investments was applied to all periods of projected benefit payments to determine the total pension liability. G.Pension Liability Sensitivity The following presents the City’s net pension liability (asset) for the plan, calculated using the discount rate disclosed in the preceding paragraph, as well as what the City’s net pension liability (asset) would be if it were calculated using a discount rate 1% lower or 1% higher than the current discount rate: 1% Decrease in 1% Increase in Discount Rate Current Discount Discount Rate Description (5.25%)Rate (6.25%)(7.25%) Defined Benefit Plan (4,137,254)$ (4,402,307)$ (4,657,263)$ Page 530 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (100) NOTE 18 DEFINED BENEFIT PENSION PLANS –FIRE RELIEF ASSOCIATION (CONTINUED) H.Pension Plan Fiduciary Net Position The Association issues a publicly available financial report. This report may be obtained by writing to the Lakeville Firefighters’ Relief Association, 20195 Holyoke Avenue, Lakeville, Minnesota, 55044 or by calling (952) 985-4480. NOTE 19 DEFERRED COMPENSATION PLAN The City offers its employees an optional deferred compensation plan created in accordance with Internal Revenue Service Code Section 457. The plan is available to all City employees, which permits them to tax defer a portion of their salary until future years. The deferred compensation is not available to employees until termination, retirement, death,or unforeseeable emergency. Under provisions of Section 72(p) of the Internal Revenue Code, a plan may permit participant loans once 457 plan assets are held in a trust. As of the current fiscal year, the City’s plan does not have a loan provision for its participants. All amounts of compensation deferred under the plan must be held in trust for the exclusive benefit of plan participants and/or beneficiaries. Investments are managed by the plan’s trustee under various investment options or a combination thereof. The choice of investment options is made by the participant.The plan is offered through the City in connection with ICMA-RC and does not meet the requirements of GASB Statement Nos. 84 and 97 for inclusion as a fiduciary activity of the City. NOTE 20 LITIGATION There are several lawsuits pending in which the City is involved. The City Attorney has indicated that existing and pending lawsuit claims and other actions in which the City is a defendant are either covered by insurance, fully reserved for by the City, or the cases are in the early stages of discovery, and accordingly, the ultimate outcome cannot presently be determined. It is the opinion of City management that in each case the possibility of material loss, net of amounts reserved is remote. NOTE 21 TAX ABATEMENT The City has five pay-as-you-go tax increment financing districts with local businesses to promote economic development within the City. The City agrees pursuant to the authority granted in the TIF Act to abate real estate taxes based on the increased property value from improvements on the owned property. The three of the five agreements call for 95%of the property tax increments collected to be returned to the developers. The City will retain 5% for administrative fees for the periods of time specified in each agreement.One of the agreements calls for 90% if the property tax increments collected to be returned to the developers. The City will retain 10% for administrative fees for the periods of time specified the agreement.One of the agreements calls for 80% if the property tax increments collected to be returned to the developers. The City will retain 20% for administrative fees for the periods of time specified the agreement.For the year ended December 31, 2024, the City paid excess tax increment in the amount of $650,226. No other commitments were made by the City as part of these agreements. Page 531 of 899 CITY OF LAKEVILLE NOTES TO BASIC FINANCIAL STATEMENTS DECEMBER 31, 2024 (101) NOTE 22 ACCOUNTING CHANGES AND ERROR CORRECTIONS A)Change In Accounting Principle For the year ended December 31, 2024, the City implemented a change in accounting principle related to the treatment of group asset purchases. This change was prompted by the amendment of Question 7.9.8 in GASB Implementation Guide 2015-1, replaced by Question 5.1 in Implementation Guide 2021-1. The change is applied retroactively in accordance with GASB Statement No. 100. As part of the City’s retroactive review, annual water meter purchases from 2014 through 2023 were identified as group asset purchases that meet the criteria for capitalization under the revised guidance. Accordingly, these assets have been capitalized. The effect of this change in the current period is an increase of $4,352,159 in Utility Fund capital assets and a corresponding increase in Utility Fund net position. The effect of the change is shown in column A of the table below. Adjustments to and Restatements of Beginning Balances During fiscal year 2024, the change in accounting principle related to the treatment of group asset purchases resulted in a restatement of beginning net position, as follows: Change in December 31, 2023 Accounting December 31, 2024 As Previously Principle As Adjusted or Reported (A)Restated Government-Wide: Business-Type Activities 221,210,035$ 4,352,159$ 225,562,194$ Proprietary Funds: Major Funds Utility Fund 208,198,794$ 4,352,159$ 212,550,953$ NOTE 23 SUBSEQUENT EVENT On April 16, 2025, the City issued $22.25 million in General Obligation Bonds. Of this, $18.1 million will fund the new First Responders Skill Training Center (FiRST Center), and $4.15 million is allocated to 2025 street reconstruction projects. The $25.8 million FiRST Center will be built on the site of the old public works building at 777 214th Street, serving fire, police, and EMT personnel across the south metro and Greater Minnesota. The project is supported by $7.17 million in state funding and $800,000 in federal funding. Newly adopted electric and gas franchise fees will repay the bond portion related to the FiRST Center. Page 532 of 899 REQUIRED SUPPLEMENTARY INFORMATION Page 533 of 899 CITY OF LAKEVILLE GENERAL FUND SCHEDULE OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES –BUDGETARY COMPARISON YEAR ENDED DECEMBER 31, 2024 See accompanying Note to Required Supplementary Information. (103) Variance with Budgeted Amounts Final Budget Original Final Actual Positive (Negative) REVENUE Property Taxes General property taxes: Current 25,978,925$ 25,978,925$ 25,787,647$ (191,278)$ Delinquent 226,500 226,500 155,765 (70,735) Fiscal Disparities 3,530,725 3,530,725 3,476,441 (54,284) Mobile Home Tax 80,000 80,000 90,522 10,522 Gravel Tax 5,000 5,000 2,763 (2,237) Total property taxes 29,821,150 29,821,150 29,513,138 (308,012) Licenses and permits 3,262,810 2,962,810 3,052,954 90,144 Intergovernmental Market value homestead credit 3,000 3,000 2,155 (845) State-aid police 642,476 797,698 797,698 - State-aid fire 575,879 695,405 682,405 (13,000) State-aid PERA - - 131,962 131,962 State police and fire grants 206,485 232,485 234,747 2,262 State other grants 77,752 84,371 176,070 91,699 Federal other grants 91,249 91,249 145,118 53,869 Other Grants - - 2,500 Total intergovernmental 1,596,841 1,904,208 2,172,655 265,947 Charges for services General government 507,357 561,767 604,439 42,672 Public safety 622,495 622,495 596,552 (25,943) Public works 819,342 819,342 1,294,484 475,142 Parks and recreation 1,110,316 1,220,616 1,375,022 154,406 Total charges for services 3,059,510 3,224,220 3,870,497 646,277 Special assessments - - 9,321 9,321 Fines 240,000 240,000 222,790 (17,210) Investment income Interest Income 311,190 611,190 470,764 (140,426) Increase (Decrease in Fair Market Value)- - 398,037 398,037 Total investment income 311,190 611,190 868,801 257,611 Donations 45,200 45,200 76,290 31,090 Miscellaneous 38,884 61,284 80,841 19,557 Total revenues 38,375,585 38,870,062 39,867,287 994,725 Page 534 of 899 CITY OF LAKEVILLE GENERAL FUND SCHEDULE OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES –BUDGETARY COMPARISON (CONTINUED) YEAR ENDED DECEMBER 31, 2024 See accompanying Note to Required Supplementary Information. (104) Variance with Budgeted Amounts Final Budget Original Final Actual Positive (Negative) EXPENDITURES General government Mayor and council Personnel services 60,379$ 57,360$ 56,481$ 879$ Commodities 50 47 - 47 Other charges and services 77,971 74,050 44,878 29,172 Total mayor and council 138,400 131,457 101,359 30,098 Committees/commissions Personnel services 74,289 74,289 94,204 (19,915) Commodities 2,500 2,500 1,109 1,391 Other charges and services 59,200 59,200 54,303 4,897 Total committees/commissions 135,989 135,989 149,616 (13,627) City administration Personnel services 579,819 510,947 513,237 (2,290) Commodities 2,550 2,422 4,247 (1,825) Other charges and services 64,691 60,725 55,121 5,604 Capital Outlay - - 127 (127) Total city administration 647,060 574,094 572,732 1,362 City clerk Personnel services 265,956 310,594 315,301 (4,707) Commodities 5,420 15,420 16,169 (749) Other charges and services 87,724 88,324 83,222 5,102 Total city clerk 359,100 414,338 414,692 (354) Legal counsel Other charges and services 87,000 97,000 99,827 (2,827) Community and economic development Personnel services 1,070,370 1,082,810 960,750 122,060 Commodities 2,566 2,566 2,430 136 Other charges and services 132,212 132,212 107,542 24,670 Capital Outlay - - 2,367 (2,367) Total community and economic development 1,205,148 1,217,588 1,073,089 144,499 Inspections Personnel services 1,506,687 1,515,572 1,386,043 129,529 Commodities 16,796 16,796 13,837 2,959 Other charges and services 455,626 455,626 419,091 36,535 Capital Outlay 34,245 34,245 33,635 610 Total inspections 2,013,354 2,022,239 1,852,606 169,633 Page 535 of 899 CITY OF LAKEVILLE GENERAL FUND SCHEDULE OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES –BUDGETARY COMPARISON (CONTINUED) YEAR ENDED DECEMBER 31, 2024 See accompanying Note to Required Supplementary Information. (105) Variance with Budgeted Amounts Final Budget Original Final Actual Positive (Negative) EXPENDITURES (CONTINUED) General government (continued) General government facilities Personnel services 449,966$ 385,414$ 391,730$ (6,316)$ Commodities 26,477 22,749 15,945 6,804 Other charges and services 254,964 217,435 191,286 26,149 Total general government facilities 731,407 625,598 598,961 26,637 Finance Personnel services 1,051,698 1,033,451 1,016,317 17,134 Commodities 2,300 2,300 1,747 553 Other charges and services 321,780 321,780 223,033 98,747 Total finance 1,375,778 1,357,531 1,241,097 116,434 Information technology Personnel services 535,051 395,936 393,689 2,247 Commodities 5,500 4,070 3,821 249 Other charges and services 522,918 490,572 385,444 105,128 Total information technology 1,063,469 890,578 782,954 107,624 Human resources Personnel services 663,735 504,555 575,336 (70,781) Commodities 1,800 1,342 3,100 (1,758) Other charges and services 279,321 246,626 184,072 62,554 Capital Outlay - - 643 (643) Total human resources 944,856 752,523 763,151 (10,628) Insurance coverage Other charges and services 250,000 250,000 250,000 - Total general government 8,951,561 8,468,935 7,900,084 568,851 Public safety Police Personnel services 12,706,216 12,848,862 13,070,527 (221,665) Commodities 477,229 477,229 495,852 (18,623) Other charges and services 2,396,808 2,412,652 2,347,365 65,287 Total police 15,580,253 15,738,743 15,913,744 (175,001) Fire Protection Personnel services 2,924,016 3,057,323 3,087,902 (30,579) Commodities 229,321 229,321 189,677 39,644 Other charges and services 366,087 366,087 375,915 (9,828) Total fire protection 3,519,424 3,652,731 3,653,494 (763) Total public safety 19,099,677 19,391,474 19,567,238 (175,764) Page 536 of 899 CITY OF LAKEVILLE GENERAL FUND SCHEDULE OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES –BUDGETARY COMPARISON (CONTINUED) YEAR ENDED DECEMBER 31, 2024 See accompanying Note to Required Supplementary Information. (106) Variance with Budgeted Amounts Final Budget Original Final Actual Positive (Negative) EXPENDITURES (CONTINUED) Public Works Engineering Personnel services 999,808$ 798,224$ 718,709$ 79,515$ Commodities 8,270 6,120 4,688 1,432 Other charges and services 198,242 179,461 91,066 88,395 Capital Outlay - - - - Total engineering 1,206,320 983,805 814,463 169,342 Forestry Personnel services 239,333 239,333 195,899 43,434 Commodities 9,736 9,736 7,549 2,187 Other charges and services 348,090 348,090 397,365 (49,275) Total engineering 597,159 597,159 600,813 (3,654) Construction services Personnel services 592,484 592,484 383,759 208,725 Commodities 12,350 12,350 8,381 3,969 Other charges and services 17,750 17,750 14,689 3,061 Capital Outlay - - 2,259 (2,259) Total construction services 622,584 622,584 409,088 213,496 Street maintenance Personnel services 2,860,065 2,785,257 2,506,204 279,053 Commodities 1,104,220 1,083,182 871,131 212,051 Other charges and services 497,640 472,272 412,095 60,177 Total street maintenance 4,461,925 4,340,711 3,789,430 551,281 Total public works 6,887,988 6,544,259 5,613,794 930,465 Parks and recreation Park maintenance Personnel services 2,674,592 2,697,075 2,777,646 (80,571) Commodities 356,919 356,919 346,951 9,968 Other charges and services 703,272 703,272 601,755 101,517 Total park maintenance 3,734,783 3,757,266 3,726,352 30,914 Recreation Personnel services 620,185 624,255 615,787 8,468 Commodities 47,108 49,608 39,602 10,006 Other charges and services 389,506 431,306 447,309 (16,003) Total recreation 1,056,799 1,105,169 1,102,698 2,471 Ar ts center Personnel services 574,013 580,632 615,987 (35,355) Commodities 61,755 61,755 100,942 (39,187) Other charges and services 311,494 440,894 449,670 (8,776) Capital Outlay 37,500 47,500 53,024 (5,524) Total arts center 984,762 1,130,781 1,219,623 (88,842) Total parks and recreation 5,776,344 5,993,216 6,048,673 (55,457) Other 250,000 - - - Total expenditures 40,965,570 40,397,884 39,129,789 1,268,095 Page 537 of 899 CITY OF LAKEVILLE GENERAL FUND SCHEDULE OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES –BUDGETARY COMPARISON (CONTINUED) YEAR ENDED DECEMBER 31, 2024 See accompanying Note to Required Supplementary Information. (107) Variance with Budgeted Amounts Final Budget Original Final Actual Positive (Negative) EXCESS (DEFICIENCY) OF REVENUE OVER (UNDER) EXPENDITURES (2,589,985)$ (1,527,822)$ 737,498$ 2,262,820$ OTHER FINANCE SOURCES (USES) Transfers In From: Special Revenue - Communications Fund 283,491 196,998 196,998 - Enterprise - Liquor Fund 269,036 30,000 30,000 - Enterprise - Utility Fund 694,044 - - - Internal Service - Municipal Reserves Fund 30,000 - - - Transfers Out To: Capital Projects Fund (215,000) (215,000) (215,000) - Total Other Finance Sources (Uses)1,061,571 11,998 11,998 - NET CHANGE IN FUND BALANCES (1,528,414)$ (1,515,824)$ 749,496 2,265,320$ FUND BALANCES Beginning of Year 22,372,997 Change in Supplies - Inventory 64,136 End of Year 23,186,629$ Page 538 of 899 CITY OF LAKEVILLE GENERAL FUND NOTE TO REQUIRED SUPPLEMENTARY INFORMATION DECEMBER 31, 2024 (108) A.Budgetary Information Budgets are adopted on a basis consistent with accounting principles generally accepted in the United States of America. Annual appropriated budgets are adopted for the General Fund and Special Revenue Funds. Budgeted amounts are as originally adopted or as amended by the City Council. The City follows these procedures in establishing the budgetary data reflected in the financial statements: 1.The City Administrator submits a proposed operating budget to the City Council. 2.Public hearings are conducted to obtain taxpayer comments. 3.Upon Council approval the budget is legally adopted and employs formal budgetary integration during the year. 4.Expenditures may legally exceed budgeted appropriations at the fund level through City Council action. 5.The legal level of budgetary control (i.e., the level at which expenditures may not legally exceed appropriations) is at the fund level for the General Fund and total expenditures for the Special Revenue Funds. The City Administrator has authorization to expend funds in excess of the appropriation for individual line items. 6.Budget appropriations of all funds lapse at year-end to the extent they were not encumbered. Encumbrances are re-appropriated in the following year’s budget. Page 539 of 899 CITY OF LAKEVILLE PERA –GENERAL EMPLOYEES RETIREMENT FUND YEAR ENDED DECEMBER 31, 2024 See accompanying Notes to Required Supplementary Information –Statewide Plans. (109) GERF Schedule of the City’s Proportionate Share of the Net Pension Liability Last Ten Fiscal Years* 6/30/2024 6/30/2023 6/30/2022 6/30/2021 6/30/2020 6/30/2019 6/30/2018 6/30/2017 6/30/2016 6/30/2015 City’s Proportion of the Net Pension Liability 0.1802%0.1929%0.1821%0.1758%0.1701%0.1633%0.1632%0.1585%0.1544%0.1540% City’s Proportionate Share of the Net Pension Liability 6,660,502$ 10,786,752$ 14,422,380$ 7,507,448$ 10,198,272$ 9,028,491$ 9,053,667$ 10,118,535$ 12,536,514$ 7,981,079$ State's Proportionate Share of the Net Pension Liability Associated with the City 172,227 297,327 422,734 229,302 314,577 280,654 297,059 127,203 - - Total 6,832,729$ 11,084,079$ 14,845,114$ 7,736,750$ 10,512,849$ 9,309,145$ 9,350,726$ 10,245,738$ 12,536,514$ 7,981,079$ City’s Covered Payroll 15,019,453$ 15,468,304$ 13,640,721$ 12,645,032$ 12,134,069$ 11,645,116$ 10,971,998$ 10,213,446$ 9,572,229$ 9,046,858$ City’s Proportionate Share of the Net Pension Liability as a Percentage of Its Covered Payroll 44.35%69.73%105.73%59.37%84.05%77.53%82.52%99.07%130.97%88.22% Plan Fiduciary Net Position as a Percentage of the Total Pension Liability 89.08%83.10%76.67%87.00%79.06%80.20%79.53%75.90%68.90%78.20% * The Amounts Presented for Each Fiscal Year were Determined as of 6/30. GERF Schedule of City Contributions Last Ten Fiscal Years* 2024 2023 2022 2021 2020 2019 2018 2017 2016 2015 Statutorily Required Contribution 1,126,459$ 1,065,020$ 1,065,020$ 987,086$ 990,259$ 896,894$ 847,485$ 791,612$ 741,919$ 705,189$ Contributions in Relation to the Statutorily Required Contribution (1,126,459) (1,065,020) (1,065,020) (987,086) (990,259) (896,894) (847,485) (791,612) (741,919) (705,189) Contribution Deficiency (Excess)-$ -$ -$ -$ -$ -$ -$ -$ -$ -$ City’s Covered Payroll 15,019,453$ 14,200,267$ 14,200,267$ 13,161,147$ 13,203,453$ 11,958,587$ 11,299,800$ 10,554,827$ 9,892,253$ 9,402,520$ Contributions as a Percentage of Covered Payroll 7.50%7.50%7.50%7.50%7.50%7.50%7.50%7.50%7.50%7.50% * The Amounts Presented for Each Fiscal Year were Determined as of 12/31. Measurement Date Fiscal Year Ended December 31, Note: The City implemented GASB Statement No. 68 in fiscal 2015 (using a June 30, 2015 measurement date). Page 540 of 899 CITY OF LAKEVILLE PERA –PUBLIC EMPLOYEES POLICE AND FIRE FUND YEAR ENDED DECEMBER 31, 2024 See accompanying Notes to Required Supplementary Information –Statewide Plans. (110) PEPFF Schedule of the City’s Proportionate Share of the Net Pension Liability Last Eight Fiscal Years* 6/30/2024 6/30/2023 6/30/2022 6/30/2021 6/30/2020 6/30/2019 6/30/2018 6/30/2017 6/30/2016 6/30/2015 City’s Proportion of the Net Pension Liability 0.6181%0.6080%0.5996%0.5818%0.5668%0.5900%0.5693%0.5490%0.5620%0.5320% City’s Proportionate Share of the Net Pension Liability 8,132,040$ 10,499,370$ 26,092,224$ 4,490,879$ 7,471,030$ 6,281,146$ 6,068,152$ 7,412,153$ 22,554,038$ 6,044,765$ State's Proportionate Share of the Net Pension Liability Associated with the City 309,990 422,928 1,139,864 201,912 175,988 - - - - - Total 8,442,030$ 10,922,298$ 27,232,088$ 4,692,791$ 7,647,018$ 6,281,146$ 6,068,152$ 7,412,153$ 22,554,038$ 6,044,765$ City’s Covered Payroll 8,801,559$ 7,903,580$ 7,255,546$ 6,888,492$ 6,400,325$ 6,241,714$ 6,004,172$ 5,635,205$ 5,423,663$ 4,870,941$ City’s Proportionate Share of the Net Pension Liability as a Percentage of Its Covered Payroll 92.39%132.84%359.62%65.19%116.73%100.63%101.07%131.53%415.85%124.10% Plan Fiduciary Net Position as a Percentage of the Total Pension Liability 90.17%86.47%70.53%93.66%87.19%89.30%88.84%85.40%63.90%86.60% * The Amounts Presented for Each Fiscal Year were Determined as of 6/30. PEPFF Schedule of City Contributions Last Eight Fiscal Years* 2024 2023 2022 2021 2020 2019 2018 2017 2016 2015 Statutorily Required Contribution 1,557,876$ 1,403,842$ 1,316,993$ 1,172,597$ 1,173,052$ 1,066,319$ 999,032$ 942,349$ 904,571$ 845,144$ Contributions in Relation to the Statutorily Required Contribution (1,557,876) (1,403,842) (1,316,993) (1,172,597) (1,173,052) (1,066,319) (999,032) (942,349) (904,571) (845,144) Contribution Deficiency (Excess)-$ -$ -$ -$ -$ -$ -$ -$ -$ -$ City’s Covered Payroll 8,801,559$ 7,931,311$ 7,440,638$ 6,624,842$ 6,627,412$ 6,290,968$ 6,166,864$ 5,816,969$ 5,583,772$ 5,216,938$ Contributions as a Percentage of Covered Payroll 17.70%17.70%17.70%17.70%17.70%16.95%16.20%16.20%16.20%16.20% * The Amounts Presented for Each Fiscal Year were Determined as of 12/31. Fiscal Year Ended December 31, Measurement Date Note: The City implemented GASB Statement No. 68 in fiscal 2015 (using a June 30, 2015 measurement date). Page 541 of 899 CITY OF LAKEVILLE NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS DECEMBER 31, 2024 (111) General Employees Fund 2024 Changes Changes in Actuarial Assumptions Rates of merit and seniority were adjusted, resulting in slightly higher rates. Assumed rates of retirement were adjusted as follows: increase the rate of assumed unreduced retirements, slight adjustments to Rule of 90 retirement rates, and slight adjustments to early retirement rates for Tier 1 and Tier 2 members. Minor increase in assumed withdrawals for males and females. Lower rates of disability. Continued use of Pub-2010 general mortality table with slight rate adjustments as recommended in the most recent experience study. Minor changes to form of payment assumptions for male and female retirees. Minor changes to assumptions made with respect to missing participant data. Changes in Plan Provisions The workers’ compensation offset for disability benefits was eliminated. The actuarial equivalent factors updated to reflect the changes in assumptions 2023 Changes Changes in Actuarial Assumptions: The investment return assumption and single discount rate were changed from 6.5% to 7.0%. Changes in Plan Provisions: An additional one-time direct state aid contribution of $170.1 million will be contributed to the Plan on October 1, 2023. The vesting period of those hired after June 30, 2010, was changed from five years of allowable service to three years of allowable service. The benefit increase delay for early retirements on or after January 1, 2024, was eliminated. A one-time, non-compounding benefit increase of 2.5% minus the actual 2024 adjustment will be payable in a lump sum for calendar year 2024 by March 31, 2024. 2022 Changes Changes in Actuarial Assumptions: The mortality improvement scale was changed from Scale MP-2020 to Scale MP-2021. Changes in Plan Provisions: There were no changes in plan provisions since the previous valuation. 2021 Changes Changes in Actuarial Assumptions: The investment return and single discount rates were changed from 7.50%to 6.50%, for financial reporting purposes. The mortality improvement scale was changed from Scale MP-2019 to Scale MP-2020. Changes in Plan Provisions: There were no changes in plan provisions since the previous valuation. Page 542 of 899 CITY OF LAKEVILLE NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS DECEMBER 31, 2024 (112) General Employees Fund (Continued) 2020 Changes Changes in Actuarial Assumptions: The price inflation assumption was decreased from 2.50% to 2.25%. The payroll growth assumption was decreased from 3.25% to 3.00%. Assumed salary increase rates were changed as recommended in the June 30, 2019 experience study. The net effect is assumed rates that average 0.25% less than previous rates. Assumed rates of retirement were changed as recommended in the June 30, 2019 experience study. The changes result in more unreduced (normal) retirements and slightly fewer Rule of 90 and early retirements. Assumed rates of termination were changed as recommended in the June 30, 2019 experience study. The new rates are based on service and are generally lower than the previous rates for years 2-5 and slightly higher thereafter. Assumed rates of disability were changed as recommended in the June 30, 2019 experience study. The change results in fewer predicted disability retirements for males and females. The base mortality table for healthy annuitants and employees was changed from the RP- 2014 table to the Pub-2010 General Mortality table, with adjustments. The base mortality table for disabled annuitants was changed from the RP-2014 disabled annuitant mortality table to the PUB-2010 General/Teacher disabled annuitant mortality table, with adjustments. The mortality improvement scale was changed from Scale MP-2018 to Scale MP-2019. The assumed spouse age difference was changed from two years older for females to one year older. The assumed number of married male new retirees electing the 100% Joint & Survivor option changed from 35% to 45%. The assumed number of married female new retirees electing the 100% Joint & Survivor option changed from 15% to 30%. The corresponding number of married new retirees electing the Life annuity option was adjusted accordingly. Changes in Plan Provisions: Augmentation for current privatized members was reduced to 2.0% for the period July 1, 2020 through December 31, 2023 and 0.0% after. Augmentation was eliminated for privatizations occurring after June 30, 2020. 2019 Changes Changes in Actuarial Assumptions: The morality projection scale was changed from MP-2017 to MP-2018. Changes in Plan Provisions: The employer supplemental contribution was changed prospectively, decreasing from $31.0 million to $21.0 million per year. The State’s special funding contribution was changed prospectively, requiring $16.0 million due per year through 2031. 2018 Changes Changes in Actuarial Assumptions: The morality projection scale was changed from MP-2015 to MP-2017. The assumed benefit increase was changed from 1.00%per year through 2044 and 2.50% per year thereafter to 1.25%per year. Page 543 of 899 CITY OF LAKEVILLE NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS DECEMBER 31, 2024 (113) General Employees Fund (Continued) 2018 Changes (Continued) Changes in Plan Provisions: The augmentation adjustment in early retirement factors is eliminated over a five-year period starting July 1, 2019, resulting in actuarial equivalence after June 30, 2024. Interest credited on member contributions decreased from 4.00%to 3.00%, beginning July 1, 2018. Deferred augmentation was changed to 0.00%, effective January 1, 2019. Augmentation that has already accrued for deferred members will still apply. Contribution stabilizer provisions were repealed. Postretirement benefit increases were changed from 1.00%per year with a provision to increase to 2.50%upon attainment of 90.00%funding ratio to 50.00%of the Social Security Cost of Living Adjustment, not less than 1.00%and not more than 1.50%, beginning January 1, 2019. For retirements on or after January 1, 2024, the first benefit increase is delayed until the retiree reaches normal retirement age; does not apply to Rule of 90 retirees, disability benefit recipients, or survivors. Actuarial equivalent factors were updated to reflect revised mortality and interest assumptions. 2017 Changes Changes in Actuarial Assumptions: The combined service annuity (CSA) loads were changed from 0.80%for active members and 60.00%for vested and nonvested deferred members. The revised CSA load are now 0.00%for active member liability, 15.00%for vested deferred member liability, and 3.00% for nonvested deferred member liability. The assumed postretirement benefit increase rate was changed for 1.00%per year for all years to 1.00%per year through 2044 and 2.50%per year thereafter. Changes in Plan Provisions: The State’s contribution for the Minneapolis Employees Retirement Fund equals $16,000,000 in 2017 and 2018, and $6,000,000 thereafter. The Employer Supplemental Contribution for the Minneapolis Employees Retirement Fund changed from $21,000,000 to $31,000,000 in calendar years 2019 to 2031. The state’s contribution changed from $16,000,000 to $6,000,000 in calendar years 2019 to 2031. 2016 Changes Changes in Actuarial Assumptions: The assumed postretirement benefit increase rate was changed from 1.00%per year through 2035 and 2.50%per year thereafter to 1.00%per year for all years. The assumed investment return was changed from 7.90%to 7.50%. The single discount rate changed from 7.90%to 7.50%. Other assumptions were changed pursuant to the experience study June 30, 2015. The assumed future salary increases, payroll growth, and inflation were decreased by 0.25%to 3.25%for payroll growth and 2.50%for inflation. Changes in Plan Provisions: There have been no changes since the prior valuation. Page 544 of 899 CITY OF LAKEVILLE NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS DECEMBER 31, 2024 (114) General Employees Fund (Continued) 2015 Changes Changes in Actuarial Assumptions: The assumed postretirement benefit increase rate was changed from 1.00%per year through 2030 and 2.50%per year thereafter to 1.00%per year through 2035 and 2.50%per year thereafter. Changes in Plan Provisions: On January 1, 2015, the Minneapolis Employees Retirement Fund was merged into the General Employees Fund, which increased the total pension liability by $1.1 billion and increase the fiduciary plan net position by $892 million. Upon consolidation, state and employer contributions were revised; the State’s contribution of $6.0 million, which meets the special funding situation definition, was due September 2015. Police and Fire Fund 2024 Changes Changes in Actuarial Assumptions There were no changes in actuarial assumptions since the prior valuation. Changes in Plan Provisions The State contribution of $9.0 million per year will continue until the earlier of 1) both the Police & Fire Plan and the State Patrol Retirement Fund attain 90 percent funded status for three consecutive years (on an actuarial value of assets basis) or 2) July 1, 2048. The contribution was previously due to expire after attaining a 90 percent funded status for one year. The additional $9.0 million contribution will continue until the Police & Fire Plan is fully funded for a minimum of three consecutive years on an actuarial value of assets basis, or July 1, 2048, whichever is earlier. This contribution was previously due to expire upon attainment of fully funded status on an actuarial value of assets basis for one year (or July 1, 2048 if earlier). 2023 Changes Changes in Actuarial Assumptions: The investment return assumption was changed from 6.5% to 7.0%. The single discount rate changed from 5.4% to 7.%. Changes in Plan Provisions: Additional one-time direct state aid contribution of 19.4 million will be contributed to the Plan on October 1, 2023. Vesting requirement for new hires after June 30, 2014, was changed from a graded 20-year vesting schedule to a graded 10-year vesting schedule, with 50% vesting after five years, increasing incrementally to 100% after 10 years. A one-time, non-compounding benefit increase of 3.0% will be payable in a lump sum for calendar year 2024 by March 31, 2024. Psychological treatment is required effective July 1, 2023, prior to approval for a duty disability benefit for a psychological condition relating to the member’s occupation. The total and permanent duty disability benefit was increased, effective July 1, 2023. Page 545 of 899 CITY OF LAKEVILLE NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS DECEMBER 31, 2024 (115) Police and Fire Fund (Continued) 2022 Changes Changes in Actuarial Assumptions: The mortality improvement scale was changed from Scale MP-2020 to Scale MP-2021. The single discount rate changed from 6.5% to 5.4%. Changes in Plan Provisions: There have been no changes since the prior valuation. 2021 Changes Changes in Actuarial Assumptions: The investment return and single discount rates were changed from 7.50%to 6.50%, for financial reporting purposes. The inflation assumption was changed from 2.50%to 2.25%. The payroll growth assumption was changed from 3.25%to 3.00%. The base mortality table for healthy annuitants and employees was changed from the RP- 2014 table to the Pub-2010 Public Safety Mortality table. The mortality improvement scale was changed from MP-2019 to MN-2020. The base mortality table for disabled annuitants was changed from the RP-2014 healthy annuitant mortality table (with future mortality improvement according to Scale MP-2019) to the Pub-2010 Public Safety disabled annuitant mortality table (with future mortality improvement according to Scale MP-2020). Assumed rates of salary increase were modified as recommended in the July 14, 2020 experience study. The overall impact is a decrease in gross salary increase rates. Assumed rates of retirement were changed as recommended in the July 14, 2020 experience study. The changes result in slightly more unreduced retirements and fewer assumed early retirements. Assumed rates of withdrawal were changed from select and ultimate rates to service-based rates. The changes result in more assumed terminations. Assumed rates of disability were increased for ages 25-44 and decreased for ages over 49. Overall, proposed rates result in more projected disabilities. Assumed percent married for active female members was changed from 60%to 70%. Minor changes to form of payment assumptions were applied. Changes in Plan Provisions: There have been no changes since the prior valuation. 2020 Changes Changes in Actuarial Assumptions: The morality projection scale was changed from MP-2018 to MP-2019. Changes in Plan Provisions: There have been no changes since the prior valuation. 2019 Changes Changes in Actuarial Assumptions: The morality projection scale was changed from MP-2017 to MP-2018. Changes in Plan Provisions: There have been no changes since the prior valuation. Page 546 of 899 CITY OF LAKEVILLE NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS DECEMBER 31, 2024 (116) Police and Fire Fund (Continued) 2018 Changes Changes in Actuarial Assumptions: The morality projection scale was changed from MP-2016 to MP-2017. Changes in Plan Provisions: Postretirement benefit increases were changed to 1.00%for all years, with no trigger. An end date of July 1, 2048 was added to the existing $9.0 million state contribution. New annual state aid will equal $4.5 million in fiscal years 2019 and 2020, and $9.0 million thereafter until the plan reaches 100%funding, or July 1, 2048, if earlier. Member contributions were changed from 10.80%to 11.30%of pay, effective January 1, 2019 and 11.80%of pay, effective January 1, 2020. Employer contributions were changed from 16.20%to 16.95%of pay, effective January 1, 2019 and 17.70%of pay, effective January 1, 2020. Interest credited on member contributions decreased from 4.00%to 3.00%, beginning July 1, 2018. Deferred augmentation was changed to 0.00%, effective January 1, 2019. Augmentation that has already accrued for deferred members will still apply. Actuarial equivalent factors were updated to reflect revised mortality and interest assumptions. 2017 Changes Changes in Actuarial Assumptions: Assumed salary increases were changed as recommended in the June 30, 2016 experience study. The net effect is proposed rates that average 0.34%lower than the previous rates. Assumed rates of retirement were changed, resulting in fewer retirements. The combined service annuity (CSA) load was 30.00%for vested and nonvested, deferred members. The CSA has been changed to 33.00%for vested members and 2.00%for nonvested members. The base mortality table for healthy annuitants was changed from the RP-2000 fully generational table to the RP-2014 fully generational table (with a base year of 2006), with male rates adjusted by a factor of 0.96. The mortality improvement scale was changed from Scale AA to Scale MP-2016. The base mortality table for disabled annuitants was changed from the RP-2000 disabled mortality table to the mortality tables assumed for healthy retirees. Assumed termination rates were decreased to 3.00%for the first three years of service. Rates beyond the select period of three years were adjusted, resulting in more expected terminations overall. Assumed percentage of married female members was decreased from 65.00%to 60.00%. Assumed age difference was changed from separate assumptions for male members (wives assumed to be three years younger) and female members (husbands assumed to be four years older) to the assumption that males are two years older than females. The assumed percentage of female members electing joint and survivor annuities was increased. The assumed postretirement benefit increase rate was changed from 1.00%for all years to 1.00%per year through 2064 and 2.50%thereafter. The single discount rate was changed from 5.60%per annum to 7.50%per annum. Page 547 of 899 CITY OF LAKEVILLE NOTES TO REQUIRED SUPPLEMENTARY INFORMATION –STATEWIDE PLANS DECEMBER 31, 2024 (117) Police and Fire Fund (Continued) 2017 Changes (Continued) Changes in Plan Provisions: There have been no changes since the prior valuation. 2016 Changes Changes in Actuarial Assumptions: The assumed postretirement benefit increase rate was changed from 1.00%per year through 2037 and 2.50%per year thereafter to 1.00%per year for all future years. The assumed investment return was changed from 7.90%to 7.50%. The single discount rate changed from 7.90%to 5.60%. The assumed future salary increases, payroll growth, and inflation were decreased by 0.25%to 3.25%for payroll growth and 2.50%for inflation. Changes in Plan Provisions: There have been no changes since the prior valuation. 2015 Changes Changes in Actuarial Assumptions: The assumed postretirement benefit increase rate was changed from 1.00%per year through 2030 and 2.50%per year thereafter to 1.00%per year through 2037 and 2.50%per year thereafter. Changes in Plan Provisions: The postretirement benefit increase to be paid after the attainment of the 90.00%funding threshold was changed from inflation up to 2.50%, to a fixed rate of 2.50%. Page 548 of 899 CITY OF LAKEVILLE NET PENSION LIABILITY (ASSET) AND RELATED RATIOS LAKEVILLE FIRE RELIEF ASSOCIATION YEAR ENDED DECEMBER 31, 2024 (118) 2024 2023 2022 2021 2020 2019 2018 2017 2016 2015 Total Pension Liability (TPL) Service Cost 501,314$ 489,087$ 438,526$ 428,876$ 356,038$ 319,546$ 255,975$ 231,712$ 270,846$ 223,785$ Interest 432,398 479,407 443,842 429,588 434,535 376,417 358,835 345,935 301,640 269,493 Differences Between Expected and Actual Experience (255,200) - 148,756 - (1,177,043) - (57,139) - (201,242) - Changes of Assumptions (126,493) - (27,176) - 163,176 - 94,736 38,230 (161,264) 353,037 Changes of Benefit Terms 1,847,064 - 1,212,453 - 1,435,979 388,025 352,464 154,012 186,369 - Benefit Payments, Including Member Contribution Refunds (790,653) (2,805,883) (491,000) (749,411) (249,778) (203,935) (602,296) (276,622) (547,241) (210,816) Net Change in Total Pension Liability 1,608,430 (1,837,389) 1,725,401 109,053 962,907 880,053 402,575 493,267 (150,892) 635,499 Total Pension Liability - Beginning 7,413,982 9,251,371 7,525,970 7,416,917 6,454,010 5,573,957 5,171,382 4,678,115 4,829,007 4,193,508 Total Pension Liability - Ending (a)9,022,412 7,413,982 9,251,371 7,525,970 7,416,917 6,454,010 5,573,957 5,171,382 4,678,115 4,829,007 Plan Fiduciary Net Position Municipal Contributions - - - - - - - - - - State Contributions 685,405 588,879 510,676 434,690 409,568 379,598 367,701 351,635 348,276 338,889 Net Investment Income 1,965,419 2,044,048 (2,204,039) 1,871,403 1,715,829 1,904,143 (314,875) 1,175,892 551,474 39,474 Benefit Payments, including refunds of member contributions (790,653) (2,805,883) (491,000) (749,411) (249,778) (203,935) (602,296) (276,622) (547,241) (210,816) Administrative Expenses (21,094) (19,686) (10,098) (15,719) (10,634) (12,474) (12,042) (11,579) (9,817) (11,292) Other - - - - - - - - - (40) Net Change in Fiduciary Net Position 1,839,077 (192,642) (2,194,461) 1,540,963 1,864,985 2,067,332 (561,512) 1,239,326 342,692 156,215 Fiduciary Net Position - Beginning 11,585,642 11,778,284 13,972,745 12,431,782 10,566,797 8,499,465 9,060,977 7,821,651 7,478,959 7,322,744 Fiduciary Net Position - Ending (b)13,424,719 11,585,642 11,778,284 13,972,745 12,431,782 10,566,797 8,499,465 9,060,977 7,821,651 7,478,959 Ending Net Pension Liability (Asset) (a-b)(4,402,307)$ (4,171,660)$ (2,526,913)$ (6,446,775)$ (5,014,865)$ (4,112,787)$ (2,925,508)$ (3,889,595)$ (3,143,536)$ (2,649,952)$ Plan Fiduciary Net Position as a Percentage of Total Pension Liability (b/a)148.79%156.27%127.31%185.66%167.61%163.72%152.49%175.21%167.20%154.88% Covered Payroll N/A N/A N/A N/A N/A N/A N/A N/A N/A N/A Net Pension Liability (Asset) as a Percentage of Covered Payroll N/A N/A N/A N/A N/A N/A N/A N/A N/A N/A *Ten Years of Data Will Eventually Be Presented When Available Schedule of Employer Contributions 2024 2023 2022 2021 2020 2019 2019 2017 2016 2015 Statutorily Required Contribution -$ -$ -$ -$ -$ -$ -$ -$ -$ -$ Contributions in Relation to the Statutorily Required Contribution - - - - - - - - - - Contribution Deficiency (Excess)-$ -$ -$ -$ -$ -$ -$ -$ -$ -$ Note: The City implemented GASB Statement No. 68 in fiscal 2015 (using a June 30, 2015 measurement date). Page 549 of 899 CITY OF LAKEVILLE SCHEDULE OF CHANGES IN THE CITY’S TOTAL OPEB LIABILITY AND RELATED RATIOS YEAR ENDED DECEMBER 31, 2024 (119) 2024 2023 2022 2021 2020 2019 2018 Total OPEB Liability Service Cost 94,527$ 77,941$ 80,068$ 92,424$ 90,590$ 89,732$ 48,551$ Interest 49,386 26,086 21,882 49,766 46,760 48,182 34,601 Changes of Benefit Terms - - - - - - - Difference Between Expected and Actual Experience - 69,035 (3,399) (459,716) - 87,715 - Changes of Assumptions 28,776 (157,857) (28,591) 135,361 - - - Benefit Payments (47,802) (43,080) (41,533) (66,232) (51,097) (50,869) (42,312) Net Change in Total OPEB Liability 124,887 (27,875) 28,427 (248,397) 86,253 174,760 40,840 Total OPEB Liability - Beginning 1,074,960 1,102,835 1,074,408 1,322,805 1,236,552 1,061,792 1,020,952 Total OPEB Liability - Ending 1,199,847$ 1,074,960$ 1,102,835$ 1,074,408$ 1,322,805$ 1,236,552$ 1,061,792$ Total OPEB Liability 1,199,847$ 1,074,960$ 1,102,835$ 1,074,408$ 1,322,805$ 1,236,552$ 1,061,792$ Plan Fiduciary Net Position as a Percentage of the Total OPEB Liability 0.00%0.00%0.00%0.00%0.00%0.00%0.00% Covered Employee Payroll 20,237,799$ 20,991,155$ 18,582,335$ 17,204,233$ 14,711,089$ 14,711,089$ 15,084,789$ City's Total OPEB Liability as a Percentage of the Covered Employee Payroll 5.93%5.12%5.93%6.25%8.99%8.41%7.04% Note: The City implemented GASB Statement No. 75 in fiscal 2018. The schedule is provided prospectively beginning with the City’s fiscal year ended December 31, 2018 and is intended to show a 10-year trend. Additional years will be reported as they become available. Notes to Schedule: Valuation date:1/1/2023 Measurement date:1/1/2024 Methods and assumptions used to determine the contribution rates: Actuarial cost method Entry age Amortization method Level percentage of payroll, closed Amortization period Average of expected rem aining service on a closed basis for differences between expected and actual experience and assum ption changes. Inflation 0.03 Healthcare cost trend rate 5.50% for 2024, decreasing to 5.00% by 2026 Salary increases 0.03 Discount rate 4.00% (20-year municipal bond yield) Mortality RP-2014 W hite Collar Mortality Tables with MP-2021 Generational Improvement Scale (with Blue Collar adjustment for Police and Fire Personnel) The City holds no assets in trust related to this OPEB plan. 2024 Changes Changes in Actuarial Assumptions: Discount rate of 4.31% was updated to 4.00%. Changes in Plan Provisions: There have been no changes since the prior valuation. Page 550 of 899 CITY OF LAKEVILLE SCHEDULE OF CHANGES IN THE CITY’S TOTAL OPEB LIABILITY AND RELATED RATIOS (CONTINUED) YEAR ENDED DECEMBER 31, 2024 (120) 2023 Changes Changes in Actuarial Assumptions: The discount rate used is the 20-year municipal bond index, as the plan is not funded. This assumed rate increased from 2.25% to 4.31%. Improvement Scale MP-2021 was applied to mortality tables. Medical trend was reset at 6.25% in 2023, decreasing .25% each year, down to 5.00% in 2028 and onwards. Changes in Plan Provisions: There have been no changes since the prior valuation. 2022 Changes Changes in Actuarial Assumptions: Discount rate of 1.93% was updated to 2.25%. Changes in Plan Provisions: There have been no changes since the prior valuation. 2021 Changes Changes in Actuarial Assumptions: Discount rate of 3.60% was updated to 1.93%. Mortality Improvement Scale of MP-2019 was replaced with new Mortality Improvement Scale of MP-2020 and applied to RP-2014 Mortality tables. Healthcare cost trend is assumed to be 6.25% in 2021 decreasing .25% each year to an ultimate rate of 5.00% in 2026 and thereafter. Changes in Plan Provisions: There have been no changes since the prior valuation. Page 551 of 899 COMBINING AND INDIVIDUAL FUND STATEMENTS AND SCHEDULES Page 552 of 899 (121) NONMAJOR GOVERNMENTAL FUNDS Special Revenue Funds -These funds are used to account for revenues and expenditures that have a legally restricted or committed use for a specific purpose. Communications Fund This fund accounts for franchise fees from cable TV provider operations.Expenditures and other financing uses are used to finance the City’s cable TV channels and public communications, including long-term replacement of equipment. Downtown Special Service District Fund The Downtown Special Service District was created in 1998 pursuant to Minnesota Statute 428A. A service charge, payable with property taxes, is levied against the commercial properties in the Downtown Business District for the purpose of financing budgeted programs and activities within the District. Opioid Settlement Fund This fund is used to account for opioid settlement revenues and the related expenditures restricted to opioid remediation activities. Local Affordable Housing Aid This fund is used to account for local affordable housing aid revenues and the related expenditures restricted to local affordable housing activities. Page 553 of 899 CITY OF LAKEVILLE SPECIAL REVENUE FUNDS (NONMAJOR) COMBINING BALANCE SHEET DECEMBER 31, 2024 (122) Downtown Local Special Opioid Affordable Communications Service District Settlement Housing Aid Totals ASSETS Cash and investments 1,203,788$ 13,327$ 110,717$ 229,465$ 1,557,297$ Interest receivable 7,803 80 191 - 8,074 Accounts receivable 129,767 - 738,964 - 868,731 Total Assets 1,341,358$ 13,407$ 849,872$ 229,465$ 2,434,102$ LIABILITIES, DEFERRED INFLOWS OF RESOURCES, AND FUND BALANCE LIABILITIES Salaries payable 10,702$ -$ -$ -$ 10,702$ Accounts payable 2,724 - - - 2,724 Total Liabilities 13,426 - - - 13,426 DEFERRED INFLOWS OF RESOURCES Unavailable revenue - special assessments - - - - - Leases 45,167 - - - 45,167 Unavailable revenue - other - - 738,964 - 738,964 Total Deferred Inflows of Resources 45,167 - 738,964 - 784,131 FUND BALANCE Restricted 186,233 13,407 110,908 229,465 540,013 Committed 1,096,532 - - - 1,096,532 Total Fund Balance 1,282,765 13,407 110,908 229,465 1,636,545 Total Liabilities, Deferred Inflows of Resources, and Fund Balance 1,341,358$ 13,407$ 849,872$ 229,465$ 2,434,102$ Page 554 of 899 CITY OF LAKEVILLE SPECIAL REVENUE FUNDS (NONMAJOR) COMBINING STATEMENT OF REVENUES, EXPENDITURES, AND CHANGES IN FUND BALANCES YEAR ENDED DECEMBER 31, 2024 (123) Downtown Local Special Opioid Affordable Communications Service District Settlement Housing Aid Totals REVENUE Franchise Taxes 531,252$ -$ -$ -$ 531,252$ Intergovernmental: State-aid PERA 742 - - 229,465 230,207 Charges for services 38,198 350 - - 38,548 Interest income 31,952 326 781 - 33,059 Change in fair value of investments 27,034 276 661 - 27,971 Miscellaneous 2,000 - 185,148 - 187,148 Total revenue 631,178 952 186,590 229,465 1,048,185 EXPENDITURES Current: General government 719,945 248 - - 720,193 Capital outlay: General government 6,155 - 18,703 - 24,858 Total expenditures 726,100 248 18,703 - 745,051 EXCESS (DEFICIENCY) OF REVENUE OVER (UNDER) EXPENDITURES (94,922) 704 167,887 229,465 303,134 OTHER FINANCE SOURCES (USES) Transfers Out (7,300) - (196,998) - (204,298) NET CHANGE IN FUND BALANCES (102,222) 704 (29,111) 229,465 98,836 FUND BALANCES Beginning of Year 1,384,987 12,703 140,019 - 1,537,709 End of Year 1,282,765$ 13,407$ 110,908$ 229,465$ 1,636,545$ Page 555 of 899 (124) PROPRIETARY FUNDS Internal Service Funds -These funds are used as an accounting device to accumulate and allocate costs internally amount the City’s various functions. Municipal Reserves Fund This fund accounts for the City’s risk management program relating to general liability, excess liability, property, workers compensation, and casualty insurance costs which are charged to other City departments on a cost reimbursement basis. Compensated Leave Fund This fund accounts for the accrued liability of employee benefits attributed to compensated leave. Funding was initially provided by transfers from the General Fund. Future revenue sources are charges to benefited programs and departments. Benefits paid to Enterprise Fund employees are accounted for in their respective funds. Page 556 of 899 CITY OF LAKEVILLE INTERNAL SERVICE FUNDS COMBINING STATEMENT OF NET POSITION DECEMBER 31, 2024 (125) Municipal Compensated Reserves Leave Totals ASSETS CURRENT ASSETS Cash and investments 515,966$ 609,640$ 1,125,606$ Interest receivable 1,947 4,432 6,379 Accounts receivable 14,762 - 14,762 Total current assets 532,675 614,072 1,146,747 Total Assets 532,675$ 614,072$ 1,146,747$ LIABILITIES AND NET POSITION CURRENT LIABILITIES Accounts payable 4,208$ -$ 4,208$ Accrued compensated absences - 2,598,292 2,598,292 Total current liabilities 4,208 2,598,292 2,602,500 NONCURRENT LIABILITIES Accrued compensated absences - 1,253,099 1,253,099 Total liabilities 4,208 3,851,391 3,855,599 NET POSITION Unrestricted 528,467 (3,237,319) (2,708,852) Total Liabilities and Net Position 532,675$ 614,072$ 1,146,747$ Governmental Activities - Internal Service Funds Page 557 of 899 CITY OF LAKEVILLE INTERNAL SERVICE FUNDS COMBINING STATEMENT OF REVENUES, EXPENSES, AND CHANGES IN NET POSITION YEAR ENDED DECEMBER 31, 2024 (126) Municipal Compensated Reserves Leave Totals OPERATING REVENUE User charges 496,722$ 209,800$ 706,522$ Other 316,592 - 316,592 Total operating revenue 813,314 209,800 1,023,114 OPERATING EXPENSES Personnel services - 289,838 289,838 Other charges and services 669,167 - 669,167 Total operating expenses 669,167 289,838 959,005 OPERATING INCOME (LOSS)144,147 (80,038) 64,109 NONOPERATING REVENUE (EXPENSES) Interest Income 7,972 18,147 26,119 Change in Fair Value of Investments 6,745 - 6,745 Total nonoperating revenue (expenses)14,717 18,147 32,864 CHANGE IN NET POSITION 158,864 (61,891) 96,973 NET POSITION Beginning of Year 369,603 (3,175,428) (2,805,825) End of Year 528,467$ (3,237,319)$ (2,708,852)$ Governm ental Activities - Internal Service Funds Page 558 of 899 CITY OF LAKEVILLE INTERNAL SERVICE FUNDS COMBINING STATEMENT OF CASH FLOWS YEAR ENDED DECEMBER 31, 2024 (127) Municipal Compensated Reserves Leave Totals CASH FLOWS FROM OPERATING ACTIVITIES Cash received from general service charges 801,025$ 209,800$ 1,010,825$ Cash paid to suppliers (736,878) - (736,878) Cash paid to and for employees - (226,296) (226,296) Net Cash Provided (Used) by Operating Activities 64,147 (16,496) 47,651 CASH FLOWS FROM INVESTING ACTIVITIES Investment incom e received 14,006 16,001 30,007 NET INCREASE (DECREASE) IN CASH AND CASH EQUIVALENTS 78,153 (495) 77,658 Cash and Cash Equivalents - Beginning of the Year 437,813 610,135 1,047,948 CASH AND CASH EQUIVALENTS - END OF THE YEAR 515,966$ 609,640$ 1,125,606$ RECONCILIATION OF OPERATING INCOME (LOSS) TO NET CASH PROVIDED (USED) BY OPERATING ACTIVITIES Operating Income (Loss) 144,147$ (80,038)$ 64,109$ Adjustm ents: (Increase) decrease in assets and deferred outflows: Accounts receivable (12,289) - (12,289) Increase (decrease) in liabilities and deferred inflows: Accounts payable (67,711) - (67,711) Accrued compensated absences - 63,542 63,542 Net Cash Provided (Used) by Operating Activities 64,147$ (16,496)$ 47,651$ Governmental Activities - Internal Service Funds Page 559 of 899 STATISTICAL SECTION Page 560 of 899 (128) Statistical Section This part of the City of Lakeville’s annual comprehensive financial report presents detailed information as a context for understanding what the information in the financial statements, note disclosures, and required supplementary information says about the government’s overall financial health. Financial Trends 129 These schedules contain trend information to help the reader understand how the City’s financial performance and well-being have changed over time. Net Position by Component –Government-wide Changes in Net Position by Component –Governmental Activities Changes in Net Position by Component –Business-type Activities Changes in Net Position by Component –Total Governmental and Business-type Activities Fund Balances –Governmental Funds Changes in Fund Balances –Governmental Funds Revenue Capacity 141 These schedules contain information to help the reader assess the City’s most significant local revenue sources; electric sales and property taxes. Tax Capacity Valuation and Assessor’s Taxable Market Value of Taxable Property Property Tax Rates –Direct and Overlapping Governments Principal Property Taxpayers Property Tax Levy and Collections Debt Capacity 146 These schedules present information to help the reader assess the affordability of the City’s current levels of outstanding debt and the City’s ability to issue additional debt in the future. Ratio of Total Debt by Type Ratio of Net Bonded Debt Outstanding Direct and Overlapping Governmental Debt Legal Debt Margin Pledged Revenue Coverage Demographic and Economic Information 151 These schedules offer demographic and economic indicators to help the reader understand the environment within which the City’s financial activities take place. Demographic and Economic Statistics Principal Employers Commercial and Industrial Building Permits Issued Operating Information 154 These schedules contain service and infrastructure data to help the reader understand how the information in the City’s financial report relates to the services the City provides and the activities it performs. Employees by Function/Program (Full-Time Equivalent) Operating Indicators by Function Capital Asset Statistics by Function Sources: Unless otherwise noted, the information in these schedules is derived from the annual comprehensive financial reports for the relevant year. Page 561 of 899 CITY OF LAKEVILLE NET POSITION BY COMPONENT –GOVERNMENT-WIDE LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (129) 2015 2016 2017 2018 Governmental Activities: Net Investment in Capital Assets 141,868,136$ 149,196,480$ 144,581,700$ 142,300,205$ Restricted 33,860,946 35,860,604 46,683,603 45,267,313 Unrestricted (4,929,168) 4,277,626 6,036,382 15,427,439 Total Governmental Activities Net Position 170,799,914$ 189,334,710$ 197,301,685$ 202,994,957$ Business-Type Activities: Net Investment in Capital Assets 116,288,771$ 129,086,090$ 135,324,120$ 138,725,763$ Restricted 323,875 323,875 323,875 - Unrestricted 8,420,410 9,757,400 10,791,344 13,878,208 Total Business-Type Activities Net Position 125,033,056$ 139,167,365$ 146,439,339$ 152,603,971$ Primary Government: Net Investment in Capital Assets 258,156,907$ 278,282,570$ 279,905,820$ 281,025,968$ Restricted 34,184,821 36,184,479 47,007,478 45,267,313 Unrestricted 3,491,242 14,035,026 16,827,726 29,305,647 Total Primary Government Net Position 295,832,970$ 328,502,075$ 343,741,024$ 355,598,928$ (1)(2) Notes: (1) The City implemented GASB Statement No. 68 in 2015, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. (2) The City implemented GASB Statement No. 75 in 2018, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. (3) The City implemented GASB Statement No. 84 in 2019, recording a change in accounting principle that increased restricted net position. Prior year balances were not restated. Page 562 of 899 CITY OF LAKEVILLE NET POSITION BY COMPONENT –GOVERNMENT-WIDE (CONTINUED) LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (130) 2019 2020 2021 2022 2023 2024 154,468,792$ 167,619,658$ 183,876,386$ 218,867,352$ 240,978,608$ 259,538,899$ 56,356,434 69,458,557 69,329,217 82,302,974 73,224,358 72,430,099 24,178,084 32,249,615 39,709,366 16,378,884 17,814,210 18,284,630 235,003,310$ 269,327,830$ 292,914,969$ 317,549,210$ 332,017,176$ 350,253,628$ 143,501,608$ 151,132,001$ 170,514,908$ 180,563,445$ 188,259,693$ 199,011,990$ - - - - - - 15,142,309 18,258,536 25,479,132 28,938,525 32,950,342 37,450,763 158,643,917$ 169,390,537$ 195,994,040$ 209,501,970$ 221,210,035$ 236,462,753$ 297,970,400$ 318,751,659$ 354,391,294$ 399,430,797$ 429,238,301$ 458,550,889$ 56,356,434 69,458,557 69,329,217 82,302,974 73,224,358 72,430,099 39,320,393 50,508,151 65,188,498 45,317,409 50,764,552 55,735,393 393,647,227$ 438,718,367$ 488,909,009$ 527,051,180$ 553,227,211$ 586,716,381$ (3) Page 563 of 899 CITY OF LAKEVILLE CHANGES IN NET POSITION BY COMPONENT –GOVERNMENTAL ACTIVITIES LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (131) 2015 2016 2017 2018 Expenses: General government 5,893,261$ 8,028,316$ 4,579,478$ 7,203,308$ Public safety 12,236,411 16,369,670 14,250,572 14,141,045 Public works 15,365,976 17,711,240 18,944,454 22,336,416 Parks and recreation 5,762,890 5,626,149 6,645,057 6,661,852 Interest on long-term debt 3,296,665 3,930,168 3,268,426 3,468,814 Total expenses 42,555,203 51,665,543 47,687,987 53,811,435 Program Revenues: Charges for Services: General government 3,730,342 4,094,298 4,348,910 5,584,036 Public safety 926,168 954,395 934,444 1,059,236 Public works 8,311,017 8,401,512 7,081,317 6,792,249 Parks and recreation 3,699,025 3,685,202 2,369,615 2,455,851 Operating Grants and Contributions General government 7,132 772,998 68,095 23,772 Public safety 980,310 989,342 1,061,252 1,149,691 Public works 4,145,806 4,942,834 1,382,380 4,313,934 Parks and recreation 186,118 91,869 55,300 11,422 Capital Grants and Contributions General government 77,006 138,593 62,101 61,193 Public safety - 8,500 - - Public works 12,702,266 23,604,519 13,018,689 9,183,039 Parks and recreation 1,004,480 2,932,612 182,387 194,327 Total program revenues 35,769,670 50,616,674 30,564,490 30,828,750 Net Revenue (Expense): General government (2,078,781) (3,022,427) (100,372) (1,534,307) Public safety (10,329,933) (14,417,433) (12,254,876) (11,932,118) Public works 9,793,113 19,237,625 2,537,932 (2,047,194) Parks and recreation (873,267) 1,083,534 (4,037,755) (4,000,252) Interest on long-term debt (3,296,665) (3,930,168) (3,268,426) (3,468,814) Total net (expense) revenue (6,785,533) (1,048,869) (17,123,497) (22,982,685) General Revenues and Other Changes in Net Position: Property taxes 25,338,778 26,173,822 27,317,169 28,641,302 Franchise taxes - - - - Investment earnings (charges)368,232 388,672 597,513 907,138 Transfers in (out)(1,549,881) (6,978,829) (2,824,210) (492,418) Total general revenues and other (net)24,157,129 19,583,665 25,090,472 29,056,022 Change in Net Position: Governmental Activities 17,371,596$ 18,534,796$ 7,966,975$ 6,073,337$ (1)(2) Notes: (1) The City implemented GASB Statement No. 68 in 2015, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. (2) The City implemented GASB Statement No. 75 in 2018, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. (3) The City implemented GASB Statement No. 84 in 2019, recording a change in accounting principle that increased restricted net position. Prior year balances were not restated. Page 564 of 899 CITY OF LAKEVILLE CHANGES IN NET POSITION BY COMPONENT –GOVERNMENTAL ACTIVITIES (CONTINUED) LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (132) 2019 2020 2021 2022 2023 2024 7,902,490$ 8,994,404$ 8,966,246$ 9,999,721$ 9,899,710$ 9,524,931$ 14,927,426 16,063,433 14,226,059 19,313,383 20,139,088 21,818,556 21,015,480 22,623,378 21,462,578 25,477,542 29,136,552 27,274,347 7,178,164 6,578,004 7,791,954 7,762,349 10,117,834 11,644,154 3,332,465 3,147,896 1,199,275 3,966,703 2,903,304 3,535,602 54,356,025 57,407,115 53,646,112 66,519,698 72,196,488 73,797,590 6,506,302 6,573,673 6,303,733 7,064,177 6,587,921 7,452,928 838,664 638,887 817,539 810,708 835,053 819,342 9,166,886 11,300,325 10,569,326 9,903,121 6,620,758 5,774,455 4,098,580 3,071,803 5,501,844 5,568,006 2,506,421 4,796,412 97,964 917,379 156,783 206,244 76,861 175,668 1,168,857 5,100,592 1,270,607 6,425,656 4,655,977 1,823,715 3,142,430 3,461,526 547,841 7,056,438 3,681,717 249,629 204,737 316,067 89,442 668,708 978,532 119,004 116,750 149,610 79,173 55,044 304,539 380,326 - - - - - - 21,234,628 23,710,868 24,529,021 22,352,046 16,919,544 18,802,885 112,725 180,924 195,025 165,277 205,018 295,363 46,688,523 55,421,654 50,060,334 60,275,425 43,372,341 40,689,727 (1,181,474) (1,353,742) (2,426,557) (2,674,256) (2,930,389) (1,516,009) (12,919,905) (10,323,954) (12,137,913) (12,077,019) (14,648,058) (19,175,499) 12,528,464 15,849,341 14,183,610 13,834,063 (1,914,533) (2,447,378) (2,762,122) (3,009,210) (2,005,643) (1,360,358) (6,427,863) (6,433,375) (3,332,465) (3,147,896) (1,199,275) (3,966,703) (2,903,304) (3,535,602) (7,667,502) (1,985,461) (3,585,778) (6,244,273) (28,824,147) (33,107,863) 30,897,445 33,033,079 35,051,089 36,822,483 40,247,761 44,289,880 - - - - - 531,252 2,769,074 2,144,654 (1,003,311) (6,316,145) 5,834,294 5,630,680 1,162,124 1,132,248 (6,874,861) 372,176 (2,789,942) 892,503 34,828,643 36,309,981 27,172,917 30,878,514 43,292,113 51,344,315 27,161,141$ 34,324,520$ 23,587,139$ 24,634,241$ 14,467,966$ 18,236,452$ (3) Page 565 of 899 CITY OF LAKEVILLE CHANGES IN NET POSITION BY COMPONENT –BUSINESS-TYPE ACTIVITIES LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (133) 2015 2016 2017 2018 Expenses: Liquor 12,852,980$ 13,268,419$ 13,638,043$ 14,234,337$ Utility 11,946,778 13,558,839 14,138,885 14,815,914 Total expenses 24,799,758 26,827,258 27,776,928 29,050,251 Program Revenues: Charges for Services: Liquor 13,611,294 14,130,830 14,583,514 15,276,433 Utility 9,216,463 10,692,185 12,585,450 13,613,145 Operating Grants and Contributions Liquor 3,762 3,762 6,716 13,421 Utility 85,754 111,572 166,227 51,035 Capital Grants and Contributions Utility 6,009,075 8,973,280 4,791,313 4,075,854 Total program revenues 28,926,348 33,911,629 32,133,220 33,029,888 Net Revenue (Expense): Liquor 762,076 866,173 952,187 1,055,517 Utility 3,364,514 6,218,198 3,404,105 2,924,120 Total net (expense) revenue 4,126,590 7,084,371 4,356,292 3,979,637 General Revenues and Other Changes in Net Position: Investment income (charges)52,461 71,109 91,472 160,165 Disposal of capital assets - - - 1,601,334 Transfers in (out)1,549,881 6,978,829 2,824,210 492,418 Total general revenues and other (net)1,602,342 7,049,938 2,915,682 2,253,917 Change in Net Position: Business-type Activities 5,728,932$ 14,134,309$ 7,271,974$ 6,233,554$ (1)(2) Notes: (1) The City implemented GASB Statement No. 68 in 2015, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. (2) The City implemented GASB Statement No. 75 in 2018, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. Page 566 of 899 CITY OF LAKEVILLE CHANGES IN NET POSITION BY COMPONENT –BUSINESS-TYPE ACTIVITIES (CONTINUED) LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (134) 2019 2020 2021 2022 2023 2024 15,267,133$ 16,735,031$ 18,069,171$ 20,652,588$ 21,726,194$ 21,357,518$ 16,386,516 17,518,091 17,512,988 20,307,370 22,854,878 22,236,710 31,653,649 34,253,122 35,582,159 40,959,958 44,581,072 43,594,228 16,288,986 18,262,397 19,683,002 21,894,980 22,692,555 22,647,127 14,215,952 17,308,481 21,235,961 22,031,929 22,715,704 21,287,682 6,453 76,810 5,445 8,778 163 38,882 643,919 85,499 489,647 786,804 1,028,276 178,555 7,240,758 10,045,894 14,094,676 11,492,752 5,739,878 9,866,907 38,396,068 45,779,081 55,508,731 56,215,243 52,176,576 54,019,153 1,028,306 1,604,176 1,619,276 1,251,170 966,524 1,328,491 5,714,113 9,921,783 18,307,296 14,004,115 6,628,980 9,096,434 6,742,419 11,525,959 19,926,572 15,255,285 7,595,504 10,424,925 459,651 352,909 (197,930) (1,375,179) 1,322,619 1,368,137 - - - - - - (1,162,124) (1,132,248) 6,874,861 (372,176) 2,789,942 (892,503) (702,473) (779,339) 6,676,931 (1,747,355) 4,112,561 475,634 6,039,946$ 10,746,620$ 26,603,503$ 13,507,930$ 11,708,065$ 10,900,559$ Page 567 of 899 CITY OF LAKEVILLE CHANGES IN NET POSITION BY COMPONENT –TOTAL GOVERNMENTAL AND BUSINESS-TYPE ACTIVITIES LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (135) 2015 2016 2017 2018 Expenses: Governmental activities 42,555,203$ 51,665,543$ 47,687,987$ 53,811,435$ Business-type activities 24,799,758 26,827,258 27,776,928 29,050,251 Total expenses 67,354,961 78,492,801 75,464,915 82,861,686 Program Revenues: Governmental activities 35,769,670 50,616,674 30,564,490 30,828,750 Business-type activities 28,926,348 33,911,629 32,133,220 33,029,888 Total program revenues 64,696,018 84,528,303 62,697,710 63,858,638 Net Revenue (Expense): Governmental activities (6,785,533) (1,048,869) (17,123,497) (22,982,685) Business-type activities 4,126,590 7,084,371 4,356,292 3,979,637 Total net (expense) revenue (2,658,943) 6,035,502 (12,767,205) (19,003,048) General Revenues and Other Changes in Net Position: Governmental activities 24,157,129 19,583,665 25,090,472 29,056,022 Business-type activities 1,602,342 7,049,938 2,915,682 2,253,917 Total general revenues and other (net)25,759,471 26,633,603 28,006,154 31,309,939 Change in Net Position: Governmental activities 17,371,596 18,534,796 7,966,975 6,073,337 Business-type activities 5,728,932 14,134,309 7,271,974 6,233,554 Total change in net position 23,100,528$ 32,669,105$ 15,238,949$ 12,306,891$ (1) Note: (1) The City implemented GASB Statement No. 68 in 2015, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. (2) The City implemented GASB Statement No. 75 in 2018, recording a change in accounting principle that decreased unrestricted net position. Prior year balances were not restated. (3) The City implemented GASB Statement No. 84 in 2019, recording a change in accounting principle that increased restricted net position. Prior year balances were not restated. Page 568 of 899 CITY OF LAKEVILLE CHANGES IN NET POSITION BY COMPONENT –TOTAL GOVERNMENTAL AND BUSINESS-TYPE ACTIVITIES (CONTINUED) LAST TEN FISCAL YEARS (ACCRUAL BASIS OF ACCOUNTING) (136) 2019 2020 2021 2022 2023 2024 54,356,025$ 57,407,115$ 53,646,112$ 66,519,698$ 72,196,488$ 73,797,590$ 31,653,649 34,253,122 35,582,159 40,959,958 44,581,072 43,594,228 86,009,674 91,660,237 89,228,271 107,479,656 116,777,560 117,391,818 46,688,523 55,421,654 50,060,334 60,275,425 43,372,341 40,689,727 38,396,068 45,779,081 55,508,731 56,215,243 52,176,576 54,019,153 85,084,591 101,200,735 105,569,065 116,490,668 95,548,917 94,708,880 (7,667,502) (1,985,461) (3,585,778) (6,244,273) (28,824,147) (33,107,863) 6,742,419 11,525,959 19,926,572 15,255,285 7,595,504 10,424,925 (925,083) 9,540,498 16,340,794 9,011,012 (21,228,643) (22,682,938) 34,828,643 36,309,981 27,172,917 30,878,514 43,292,113 51,344,315 (702,473) (779,339) 6,676,931 (1,747,355) 4,112,561 475,634 34,126,170 35,530,642 33,849,848 29,131,159 47,404,674 51,819,949 27,161,141 34,324,520 23,587,139 24,634,241 14,467,966 18,236,452 6,039,946 10,746,620 26,603,503 13,507,930 11,708,065 10,900,559 33,201,087$ 45,071,140$ 50,190,642$ 38,142,171$ 26,176,031$ 29,137,011$ (2)(3) Page 569 of 899 CITY OF LAKEVILLE FUND BALANCES –GOVERNMENTAL FUNDS LAST TEN FISCAL YEARS (MODIFIED ACCRUAL BASIS OF ACCOUNTING) (137) 2015 2016 2017 2018 General Fund: Nonspendable 447,284$ 695,830$ 914,375$ 876,394$ Restricted - - - - Committed 45,000 - - - Assigned - 1,478,522 741,864 705,500 Unassigned 11,882,644 12,902,148 13,613,203 14,011,567 Total general fund 12,374,928 15,076,500 15,269,442 15,593,461 All Other Governmental Funds: Nonspendable - - - 11,630 Restricted 35,659,756 37,947,697 29,887,820 25,773,762 Committed 17,937,431 21,651,118 26,519,559 30,327,238 Unassigned (3,492,389) (726,681) (876,594) (415,577) Total all other governmental funds 50,104,798 58,872,134 55,530,785 55,697,053 Total Governmental Funds: Nonspendable 447,284 695,830 914,375 888,024 Restricted 35,659,756 37,947,697 29,887,820 25,773,762 Committed 17,982,431 21,651,118 26,519,559 30,327,238 Assigned - 1,478,522 741,864 705,500 Unassigned 8,390,255 12,175,467 12,736,609 13,595,990 Total governmental funds 62,479,726$ 73,948,634$ 70,800,227$ 71,290,514$ All governmental funds percentage change 67.6%18.4%-4.3%0.7% Page 570 of 899 CITY OF LAKEVILLE FUND BALANCES –GOVERNMENTAL FUNDS (CONTINUED) LAST TEN FISCAL YEARS (MODIFIED ACCRUAL BASIS OF ACCOUNTING) (138) 2019 2020 2021 2022 2023 2024 748,231$ 811,338$ 666,451$ 254,180$ 279,568$ 352,765$ 175,590 - 5,000 - 1,850,000 1,850,000 100,000 200,000 - - - - 749,675 1,675,125 2,493,300 2,711,000 1,528,414 - 15,429,752 22,053,166 20,821,071 19,042,227 18,715,015 20,983,864 17,203,248 24,739,629 23,985,822 22,007,407 22,372,997 23,186,629 - - - - - - 36,333,665 41,694,538 46,337,784 63,559,319 51,346,145 57,262,599 36,071,889 40,241,806 44,233,989 44,954,814 48,514,099 47,971,292 (428,702) (1,084,565) (993,783) (622,177) (30,377) (315,779) 71,976,852 80,851,779 89,577,990 107,891,956 99,829,867 104,918,112 748,231 811,338 666,451 254,180 279,568 352,765 36,509,255 41,694,538 46,342,784 63,559,319 53,196,145 59,112,599 36,171,889 40,441,806 44,233,989 44,954,814 48,514,099 47,971,292 749,675 1,675,125 2,493,300 2,711,000 1,528,414 - 15,001,050 20,968,601 19,827,288 18,420,050 18,684,638 20,668,085 89,180,100$ 105,591,408$ 113,563,812$ 129,899,363$ 122,202,864$ 128,104,741$ 25.1%18.4%7.6%14.4%-5.9%4.8% Page 571 of 899 CITY OF LAKEVILLE CHANGES IN FUND BALANCES –GOVERNMENTAL FUNDS LAST TEN FISCAL YEARS (MODIFIED ACCRUAL BASIS OF ACCOUNTING) (139) 2015 2016 2017 2018 Revenues: Property taxes and tax increment 25,215,734$ 26,131,569$ 27,401,195$ 28,612,384$ Licenses and permits 3,325,293 3,706,567 3,988,189 3,899,604 Intergovernmental 5,232,193 9,043,356 3,771,886 5,090,762 Charges for services 12,443,152 13,289,708 10,016,017 11,828,549 Special assessments 1,736,905 2,308,223 2,812,587 3,139,103 Investment income (charges)366,555 387,604 597,513 907,138 Donations 356,446 550,255 238,383 309,970 Miscellaneous 1,155,073 2,828,177 846,035 835,986 Total Revenues 49,831,351 58,245,459 49,671,805 54,623,496 Expenditures: General government 5,226,864 5,783,013 6,424,260 6,656,824 Public safety 10,892,071 11,513,170 12,775,807 13,061,572 Public works 3,856,984 4,245,072 9,786,321 4,741,200 Parks and recreation 3,532,376 3,497,041 5,222,503 3,998,735 Capital outlay 31,649,447 37,938,823 11,995,449 25,065,276 Debt Service: Principal retirement 7,385,000 5,935,000 6,885,000 10,420,000 Interest on debt 3,735,120 3,970,010 3,881,179 3,948,999 Fiscal charges 33,071 327,052 129,158 96,729 Total Expenditures 66,310,933 73,209,181 57,099,677 67,989,335 Excess (Deficiency) of Revenues Over (Under) Expenditures (16,479,582) (14,963,722) (7,427,872) (13,365,839) Other Financing Sources (Uses): Transfers in 6,883,879 5,179,668 8,355,474 6,038,479 Transfers out (4,928,951) (3,222,237) (6,661,840) (4,167,132) Bond, note, loan and lease proceeds 16,545,000 31,075,000 11,987,171 13,805,000 Payment on refunded bonds called (12,460,000) (9,535,000) (11,368,146) (3,320,000) Premium on bonds issued 1,005,509 2,626,731 1,309,907 1,005,336 Sale of capital assets - - 516,380 530,734 Total Other Financing Sources (Uses)7,045,437 26,124,162 4,138,946 13,892,417 Net Change in Fund Balances (9,434,145)$ 11,160,440$ (3,288,926)$ 526,578$ Debt Service as a Percentage of Noncapital Expenditures 25.6%19.6%22.6%26.9% Note: The City has no taxes other than property taxes and tax increment. Page 572 of 899 CITY OF LAKEVILLE CHANGES IN FUND BALANCES –GOVERNMENTAL FUNDS (CONTINUED) LAST TEN FISCAL YEARS (MODIFIED ACCRUAL BASIS OF ACCOUNTING) (140) 2019 2020 2021 2022 2023 2024 30,855,832$ 32,983,369$ 35,146,364$ 36,815,539$ 40,226,889$ 44,329,727$ 4,492,109 5,600,853 5,081,480 4,490,895 4,091,103 3,052,954 8,901,495 14,571,858 3,813,869 17,279,101 15,259,457 3,985,196 15,046,177 15,239,684 17,343,792 17,586,719 11,096,772 14,461,853 3,683,354 3,953,438 3,023,130 3,478,667 7,934,564 2,945,985 2,769,074 2,144,654 (1,003,311) (6,316,145) 5,834,294 5,630,680 211,969 232,689 268,898 200,642 309,521 333,933 861,800 800,067 775,140 1,310,631 953,242 1,059,472 66,821,810 75,526,612 64,449,362 74,846,049 85,705,842 75,799,800 7,028,626 8,061,485 7,950,888 8,377,090 8,238,696 8,583,505 13,496,719 14,251,367 15,283,047 15,836,333 17,432,946 19,567,238 4,802,149 4,692,478 4,987,928 5,139,700 5,844,020 5,611,535 4,178,410 3,888,960 4,486,389 4,863,528 5,407,841 5,995,649 20,906,745 34,788,668 32,856,512 42,577,218 54,049,585 34,781,975 8,920,000 9,715,000 9,160,000 7,861,201 13,161,000 17,164,120 3,877,764 3,871,110 4,064,943 4,179,644 5,006,042 4,936,874 44,429 38,098 82,573 324,787 42,577 109,177 63,254,842 79,307,166 78,872,280 89,159,501 109,182,707 96,750,073 3,566,968 (3,780,554) (14,422,918) (14,313,452) (23,476,865) (20,950,273) 5,120,699 6,522,720 9,636,510 15,996,085 8,829,311 3,254,905 (2,980,605) (4,180,711) (7,736,781) (14,621,216) (6,576,539) (1,097,886) 6,295,000 15,164,036 19,294,225 47,874,860 12,361,337 22,295,792 ---(23,540,000) -- 1,065,624 2,391,960 1,090,191 4,115,966 779,235 1,389,304 107,645 249,015 258,880 868,415 307,368 414,647 9,608,363 20,147,020 22,543,025 30,694,110 15,700,712 26,256,762 13,175,331$ 16,366,466$ 8,120,107$ 16,380,658$ (7,776,153)$ 5,306,489$ 25.7%25.8%24.5%22.0%22.0%31.1% Page 573 of 899 CITY OF LAKEVILLE TAX CAPACITY VALUATION AND ASSESSOR’S TAXABLE MARKET VALUE OF TAXABLE PROPERTY LAST TEN FISCAL YEARS (141) Fiscal Year 2015 2016 2017 2018 Taxable Net Tax Capacity Valuation of Taxable Property Tax capacity value 62,811,855$ 65,634,896$ 69,887,094$ 75,422,344$ Less: Captured tax increment tax capacity (446,760) (497,171) (596,348) (609,048) Contributions to fiscal disparities pool (5,481,001) (5,411,614) (5,524,685) (5,828,030) Plus: Distribution from fiscal disparities pool 6,323,361 6,635,572 7,139,972 7,672,379 Total taxable net tax capacity 63,207,455$ 66,361,683$ 70,906,033$ 76,657,645$ Taxable Net Tax Capacity Valuation by Class of Property Homestead residential 46,374,248$ 49,048,168$ 52,427,026$ 57,017,144$ Commercial/industrial, public utility, and personal property 14,223,709 14,754,095 15,842,447 16,870,980 Non-homestead residential/apartments 1,629,527 1,656,581 1,736,856 1,938,329 Agriculture and seasonal/recreational 979,971 902,839 899,704 831,192 Total taxable net tax capacity 63,207,455$ 66,361,683$ 70,906,033$ 76,657,645$ Assessor’s taxable market valuation 5,553,395,148$ 5,825,279,418$ 6,201,221,856$ 6,702,242,762$ Taxable net tax capacity as a percentage of assessor's taxable market value 1.138%1.139%1.143%1.144% Direct tax capacity rate 38.948%38.669%37.510%36.419% Notes: Taxes are determined by multiplying the taxable net tax capacity by the direct tax capacity rate as expressed as a percentage. The foregoing direct tax capacity rates do not reflect reductions for state property tax credits. Source: Dakota County Auditor and Treasurer’s Office. Page 574 of 899 CITY OF LAKEVILLE TAX CAPACITY VALUATION AND ASSESSOR’S TAXABLE MARKET VALUE OF TAXABLE PROPERTY (CONTINUED) LAST TEN FISCAL YEARS (142) 2019 2020 2021 2022 2023 2024 82,737,259$ 90,729,405$ 97,138,303$ 106,343,200$ 130,077,811$ 142,366,672$ (774,382) (856,909) (1,085,470) (1,084,201) (647,312) (854,791) (6,190,357) (6,645,636) (6,925,361) (7,645,703) (7,858,132) (8,872,466) 8,151,580 9,049,794 9,522,500 10,270,657 11,246,438 11,867,551 83,924,100$ 92,276,654$ 98,649,972$ 107,883,953$ 132,818,805$ 144,506,966$ 63,032,149$ 69,577,579$ 73,762,668$ 81,813,145$ 101,495,866$ 108,705,378$ 17,893,911 19,164,426 20,997,684 21,583,053 25,302,537 28,643,461 2,206,240 2,738,491 3,143,112 3,810,748 5,256,004 6,594,941 791,800 796,158 746,508 677,007 764,398 563,186 83,924,100$ 92,276,654$ 98,649,972$ 107,883,953$ 132,818,805$ 144,506,966$ 7,374,033,988$ 8,106,672,140$ 8,636,691,303$ 9,503,255,659$ 11,592,195,438$ 12,546,610,519$ 1.138%1.138%1.142%1.135%1.146%1.152% 35.607%34.615%34.351%32.846%29.676%30.213% Page 575 of 899 CITY OF LAKEVILLE PROPERTY TAX RATES –DIRECT AND OVERLAPPING GOVERNMENTS LAST TEN FISCAL YEARS (143) Operating Debt Service Total Debt Service 2015 30.605%8.343%38.948%- 29.633%- 192 53.474%0.11550%5.033%127.088%0.11550% 194 31.459%0.24871%105.073%0.24871% 196 23.271%0.25484%96.885%0.25484% 2016 30.455%8.214%38.669%- 28.570%- 192 57.584%0.19065%5.063%129.886%0.19065% 194 35.319%0.27898%107.621%0.27898% 196 24.317%0.26999%96.619%0.26999% 2017 29.342%8.168%37.510%- 28.004%- 192 54.269%0.18481%4.907%124.690%0.18481% 194 32.914%0.25441%103.335%0.25441% 196 23.336%0.27380%93.757%0.27380% 2018 29.305%7.114%36.419%- 26.580%- 192 52.825%0.18495%4.307%120.131%0.18495% 194 32.992%0.26835%100.298%0.26835% 196 21.352%0.26715%88.658%0.26715% 2019 27.192%8.415%35.607%- 25.386%- 192 51.401%0.18968%4.227%116.621%0.18968% 194 32.535%0.26992%97.755%0.26992% 196 20.613%0.26162%85.833%0.26162% 2020 26.682%7.933%34.615%- 24.133%- 192 53.105%0.18904%4.030%115.883%0.18904% 194 34.851%0.31225%97.629%0.31225% 196 19.860%0.34367%82.638%0.34367% 2021 26.281%8.070%34.351%- 22.716%- 192 50.805%0.18392%3.802%111.674%0.18392% 194 33.894%0.27269%94.763%0.27269% 196 20.046%0.32712%80.915%0.32712% 2022 25.755%7.091%32.846%- 21.630%- 192 49.481%0.18244%3.729%107.686%0.18244% 194 33.983%0.25582%92.188%0.25582% 196 19.971%0.31336%78.176%0.31336% 2023 22.485%7.191%29.676%- 18.816%- 192 38.497%0.18725%3.201%90.190%0.18725% 194 29.473%0.26581%81.166%0.26581% 196 17.904%0.29771%69.597%0.29771% 2024 22.476%7.737%30.213%- 18.323%- 192 36.439%0.19446%3.264%88.239%0.19446% 194 29.650%0.27666%81.450%0.27666% 196 23.624%0.30078%75.424%0.30078% Notes: Taxes are determined by multiplying the taxable net tax capacity by the tax capacity rate and market valued based rate expressed as a percentage. The foregoing tax capacity rates do not reflect reductions for state property tax credits. Special Districts include: Metropolitan Mosquito Control, Metropolitan Council, Metropolitan Transit District, Dakota County Community Development Agency, Light Rail Authority, and Vermillion River Watershed District. Source: Dakota County Auditor and Treasurer’s Office. Per Dakota County - Final Tax Rates Pay 2024 table Fiscal Year Referendum Levy (Market Value-based) General Levy (Tax Capacity- based) Referendum Levy (Market Value-based) General Levy (Tax Capacity- based) Referendum Levy (Market Value-based) Ind. School District Overlapping Rates City of Lakeville Total Direct and Direct Rates Dakota County School District Overlapping RatesSpecial Districts Levy (Tax Capacity- based) Tax Capacity - based Market Value- based General Levy (Tax Capacity-based) Page 576 of 899 CITY OF LAKEVILLE PRINCIPAL PROPERTY TAXPAYERS FISCAL YEARS ENDED DECEMBER 31, 2024 AND DECEMBER 31, 2015 (144) Percentage Percentage Taxable of Taxable Taxable of Taxable Tax Tax Tax Tax Capacity Capacity Capacity Capacity Principal Property Taxpayer Type of Business Value Rank Value Value Rank Value SP Lakeville Development LLC Industrial 1,160,944$ 1 0.8%0.0% Continental 476 Fund LLC Apartment 744,778 2 0.5%0.0% IRET Southfork Apartments LLC Apartments 698,650 3 0.5%308,528 3 0.5% NLL LLC Apartments 515,698 4 0.4% ARRIS LLC Apartments 495,646 5 0.0% Minnegasco/Centerpoint Utility 495,350 6 0.3%265,484 6 0.4% Fulford Group, LLC Agriculture 488,779 7 0.3% First Industrial LP Industrial 478,834 8 0.3% Setzer Properties SMN LLC Industrial 452,144 9 0.3% KJPL Lakeville LLC Apartment 421,475 10 0.3% Lakeville 2004, LLC Commercial 331,278 1 0.5% EREP Heritage Commons, LLC Retail 323,038 2 0.5% Inland Argonne Village, LLC Retail 285,031 4 0.5% Dakota Electric Association Utility 268,928 5 0.4% Walker Highview Hills, LLC Apartments 259,216 7 0.4% Target Corporation Retail 256,414 8 0.4% LFT Real Estate Company Inc.Real Estate 238,810 9 0.4% FR/CAL Interstate South LLC Industrial 229,776 10 0.4% Total principal taxpayers 5,952,298 4.1%2,766,503 4.4% All other taxpayers 138,554,668 95.9%60,440,952 95.6% Total City of Lakeville taxpayers 144,506,966$ 100.0%63,207,455$ 100.0% Source: Dakota County Auditor and Treasurer’s Office. 2024 2015 Page 577 of 899 CITY OF LAKEVILLE PROPERTY TAX LEVY AND COLLECTIONS LAST TEN FISCAL YEARS (145) Percentage of Total Total Tax Collection Collections Fiscal Levy for of Prior Total To Tax Levy Year Fiscal Year (1)Amount (2)Percent Year Levy (3)Collections Certified 2015 24,728,549$ 24,568,028$ 99.35%160,521$ 24,728,549$ 100.00% 2016 25,679,619 25,566,236 99.56%113,383 25,679,619 100.00% 2017 26,679,614 26,534,636 99.46%144,978 26,679,614 100.00% 2018 28,001,550 27,857,045 99.48%144,505 28,001,550 100.00% 2019 29,948,890 29,815,159 99.55%133,731 29,948,890 100.00% 2020 32,031,000 31,840,067 99.40%190,922 32,030,989 100.00% 2021 33,911,570 33,753,733 99.53%155,962 33,909,695 99.99% 2022 35,590,000 35,485,096 99.71%104,904 35,590,000 100.00% 2023 39,771,000 39,513,394 99.35%257,606 39,771,000 100.00% 2024 43,596,800 43,351,372 99.44%- 43,351,372 99.44% Notes (1)Total levy is net of current year cancellations and abatem ents. (2)Total tax levy and current tax collections include state paid credits. (3)Includes county adjustments for prior year over collections, cancellations, and abatements. Collection of Current Year's Levy Page 578 of 899 CITY OF LAKEVILLE RATIO OF TOTAL DEBT BY TYPE LAST TEN FISCAL YEARS (146) Total General Loans and Total Outstanding Fiscal Obligation Other Notes Financed Lease Revenue Outstanding Population Debt Year Bonds Bonds Payable Purchase Liability Bond Debt (1)Per Capita 2015 104,062,522$ 7,886,294$ 1,159,843$ -$ -$ 2,911,996$ 116,020,655$ 59,991 3.6 1,934$ 2016 121,958,354 7,781,645 1,159,843 - - 9,952,577 140,852,419 60,965 4.2 2,310 2017 113,666,228 7,417,448 1,897,014 - - 8,258,468 131,239,158 61,993 3.7 2,117 2018 112,553,287 7,018,251 3,897,014 - - 8,571,877 132,040,429 64,334 3.4 2,052 2019 111,718,611 6,614,054 2,897,014 - - 8,876,565 130,106,244 65,831 3.2 1,976 2020 115,000,111 6,199,857 7,071,050 1,810,000 - 11,566,742 136,473,724 69,490 3.0 1,964 2021 124,710,301 5,685,403 12,945,275 1,570,000 - 11,729,716 155,070,695 72,135 3.2 2,150 2022 148,534,254 - 12,408,934 1,325,000 3,689,281 10,605,601 176,563,070 73,828 3.4 2,392 2023 146,062,184 - 13,024,271 1,075,000 3,374,280 9,386,085 172,921,820 75,217 3.1 2,299 2024 155,757,324 - 8,230,944 815,000 3,047,078 8,140,730 175,991,076 76,746 N/A 2,293 Source: (1) Metropolitan Council as of April 1 (except for 2020 Federal Census). (2) See Demographic and Economic Statistics page. N/A - Not available. Governmental Activities Income (2) Personal % of Business-type Activities Page 579 of 899 CITY OF LAKEVILLE RATIO OF NET BONDED DEBT OUTSTANDING LAST TEN FISCAL YEARS (147) Percentage Net Gross Debt Payable Debt Service Net Taxable of Net Bonded Bonded Fiscal Bonded From Other Monies Bonded Net Tax Debt to Taxable (3)Debt Year Debt Sources (1)Av ailable (2)Debt Capacity Net Tax Capacity Population Per Capita 2015 104,062,522$ 44,340,000$ 18,541,682$ 41,180,840$ 63,207,455$ 65.15%59,991 686$ 2016 121,958,354 64,845,000 15,928,687 41,184,667 66,361,683 62.06%60,965 676 2017 123,338,676 67,940,000 6,261,464 49,137,212 70,906,033 69.30%61,993 793 2018 121,826,538 70,660,000 4,128,788 47,037,750 76,657,645 61.36%64,334 731 2019 120,372,665 71,840,000 4,239,541 44,293,124 83,924,100 52.78%65,831 673 2020 124,906,982 75,440,000 4,355,292 45,111,690 92,276,654 48.89%69,490 649 2021 124,710,301 69,405,000 4,373,669 50,931,632 98,649,972 51.63%72,135 706 2022 148,534,254 73,205,000 1,648,727 73,680,527 107,883,953 68.30%73,828 998 2023 146,062,183 66,690,000 5,664,382 73,707,801 132,818,805 55.50%75,217 980 2024 155,757,324 66,185,000 7,316,263 82,256,061 144,506,966 56.92%76,746 1,072 Source: (1) G.O. Improvement bonds, tax increment bonds, State-aid street revenue bonds, water connection revenue bonds, and arena revenue bonds. (2) Debt service monies available include amounts restricted in the debt service funds repaying the related debt. W e believe this is the most accurate and consistent representation of the resources restricted for debt service when crossover refunding bonds are being held in escrow, as those resources are not included in the governmental activities net position restricted for debt service due to conversion for full accrual accounting. (3) Metropolitan Council as of April 1, except for 2020 (Federal Census). Page 580 of 899 CITY OF LAKEVILLE DIRECT AND OVERLAPPING GOVERNMENTAL DEBT LAST TEN FISCAL YEARS (148) Debt Applicable to Taxable Debt Net Tax Capacity in the City Governmental Unit Outstanding (2)Percentage (2)Am ount Overlapping Debt (1) Independent School District #194 179,275,000$ 75.20%134,814,800$ Independent School District #192 97,115,000 22.82%22,161,643 Independent School District #196 372,305,000 8.07%30,045,014 Special District Metropolitan Council 238,225,000 2.39%5,671,407 192,692,864 Direct Debt City of Lakeville bonded debt 155,180,943 100.00%155,180,943 347,873,807$ Source: Debt figures and applicable percentages for other than the City of Lakeville are provided by the City’s fiscal consultant Northland Securities. Notes: (1) (2) Total overlapping debt Total direct and overlapping debt The percentage of overlapping debt applicable is estimated using taxable property market values. Applicable percentages were estimated by determining the portion of the county’s taxable market value that is within the City’s boundaries and dividing it by the county’s total taxable market value. Overlapping governments are those that coincide, at least in part, with the geographical boundaries of the City. This schedule estimates the portion of the outstanding debt of those overlapping governments that is borne by the residents and businesses of the City. This process recognizes that, when considering the government’s ability to issue and repay long-term debt, the entire debt burden borne by the residents and businesses should be taken into account. However, this does not imply that every taxpayer is a resident, and therefore responsible for repaying the debt, of each overlapping government. Page 581 of 899 CITY OF LAKEVILLE LEGAL DEBT MARGIN LAST TEN FISCAL YEARS (149) Net Bonded Assessor’s Net Bonded Debt Applicable Taxable Debt Legal to Debt Limit as Fiscal Market Legal Ap plicable to Debt a Percentage of Year Valuation Debt Limit Debt Limit Margin Legal Debt Limit 2015 5,553,395,148$ 166,601,854$ 36,323,318$ 130,278,536$ 21.80% 2016 5,825,279,418 174,758,383 34,776,313 139,982,070 19.90% 2017 6,201,221,856 186,036,656 32,593,536 153,443,120 17.52% 2018 6,702,242,762 201,067,283 32,676,212 168,391,071 16.25% 2019 7,374,033,988 221,221,020 30,120,459 191,100,561 13.62% 2020 8,106,672,140 243,200,164 25,799,708 217,400,456 10.61% 2021 8,636,691,303 259,100,739 42,081,331 217,019,408 16.24% 2022 9,503,255,659 285,097,670 63,586,273 221,511,397 22.30% 2023 11,592,195,438 347,765,863 64,670,618 283,095,245 18.60% 2024 12,546,610,519 376,398,316 73,548,737 302,849,579 19.54% Legal Debt Margin Calculation:Fiscal Year 2024 Assessor’s taxable market valuation 12,546,610,519$ Legal debt limit: 3% of Assessor’s taxable market valuation 376,398,316$ Amount of debt applicable to legal debt limit: Gross bonded debt 155,450,000$ Less debt payable from sources other than taxes: G.O. Improvement bonds 57,800,000$ State-aid street revenue bonds 3,260,000 Water connection revenue bonds 5,125,000 HRA lease revenue 815,000 Water revenue bonds 7,415,000 Street Light revenue bonds 100,000 Sewer revenue bonds 70,000 (74,585,000) Debt payable from taxes 80,865,000 Less debt service monies available to pay principal and interest (7,316,263) Net bonded debt applicable to debt limit 73,548,737 73,548,737 Legal debt margin 302,849,579$ Note: Minnesota Statutes § 475.53, Subdivision 1, No municipality, except a school district or a city of the first class, shall incur or be subject to a net debt in excess of three percent of the taxable market value of taxable property in the municipality for years 2008 and beyond. Source: Dakota County Auditor and Treasurer’s Office. Page 582 of 899 CITY OF LAKEVILLE PLEDGED REVENUE COVERAGE LAST TEN FISCAL YEARS (150) Net Revenue Av ailable Fiscal Gross (1)Operating For Debt Times Year Revenues Expenses Service Principal Interest Total Coverage 2015 9,283,053$ 4,948,633$ 4,334,420$ 2,670,000$ 594,489$ 3,264,489$ 1.33 2016 10,530,436 5,389,869 5,140,567 595,000 652,577 1,247,577 4.12 2017 12,234,365 5,193,095 7,041,270 1,005,000 690,010 1,695,010 4.15 2018 8,361,880 3,099,485 5,262,395 865,000 513,715 1,378,715 3.82 2019 8,610,576 3,156,154 5,454,422 895,000 478,105 1,373,105 3.97 2020 11,989,250 6,222,639 5,766,611 750,000 439,350 1,189,350 4.85 2021 14,204,060 3,975,650 10,228,410 785,000 408,525 1,193,525 8.57 2022 13,233,699 5,077,177 8,156,522 420,000 368,110 788,110 10.35 2023 13,654,066 7,104,056 6,550,010 645,000 312,600 957,600 6.84 2024 10,737,574 5,817,588 4,919,986 680,000 281,575 961,575 5.12 Notes: (1) The primary revenue source for debt service includes water system connection charges, water system user fees, ice arena net operating revenue and contributions from one organization conducting lawful gambling at approved locations, and liquor fund gross profits. (2) Revenue bonds include water connection revenue, arena revenue, and liquor revenue. Requirements (2) Page 583 of 899 CITY OF LAKEVILLE DEMOGRAPHIC AND ECONOMIC STATISTICS LAST TEN FISCAL YEARS (151) Percentage Personal Per Capita (1)Increase from Income (2)Personal Housing units Year Population Previous Year (in thousands)Income Single Multiple Total Valuation 2015 59,991 1.06%3,222,117$ 53,710$ 366 54 420 125,929,000 2016 60,965 1.62%3,351,551 54,975 403 62 465 139,008,000 2017 61,993 1.69%3,573,153 57,638 487 44 531 160,520,000 2018 64,334 3.78%3,901,921 60,651 478 49 527 159,251,000 2019 65,831 2.33%4,075,861 61,914 556 64 620 180,622,000 2020 69,490 5.56%4,499,339 64,748 742 73 815 223,050,000 2021 72,135 3.81%4,899,914 67,927 663 73 736 205,419,000 2022 73,828 2.35%5,166,779 69,984 387 160 547 139,685,000 2023 75,217 1.88%5,642,704 75,019 367 94 461 123,241,000 2024 76,746 2.03%N/A N/A 385 49 434 123,839,003 Annual percentage increase average last ten fiscal years 2.61%127.93%16,755 Labor Unemployment Labor Unemployment State of United Year Force Rate Force Rate Minnesota States 2015 33,876 2.7%234,299 3.1%3.7% 4.8% 2016 33,793 3.0%232,091 3.4%4.1% 4.5% 2017 34,911 2.5%239,356 2.7%3.3% 4.1% 2018 35,758 2.4%240,195 2.7%3.2% 3.7% 2019 36,610 2.7%242,855 2.9%3.5% 3.4% 2020 36,025 3.8%233,902 4.3%4.9% 6.5% 2021 37,007 2.2%236,441 2.4%2.7% 3.7% 2022 38,904 2.5%241,966 2.7%3.2% 3.3% 2023 38,692 2.5%240,731 2.7%3.2% 3.3% 2024 43,071 2.0%249,642 2.2%2.6% 3.8% Source: (1) Metropolitan Council as of April 1 (except for 2020 Federal Census). (2) U.S. Department of Commerce Bureau of Economic Analysis as of December 31, 2024, not seasonally adjusted. (3) City of Lakeville Inspections Department. N/A - Not available. Building Permits Issued Family Dwellings (3) Labor Force and Unemployment Rate (not seasonally adjusted) (2) City of Lakeville Dakota County Rates Page 584 of 899 CITY OF LAKEVILLE PRINCIPAL EMPLOYERS FISCAL YEARS ENDED DECEMBER 31, 2024 AND DECEMBER 31, 2015 (152) Principal Employer (1)Product/Service Employees Rank %Employees Rank % Independent School District #194 Elementary & secondary schools 1,334 1 3.4%1,370 1 4.0% Hearthside Food Solutions Food service contractors 707 2 1.8%715 2 2.1% Treehouse Brands Breakfast cereal products 500 3 1.3%515 3 1.5% Amazon XL Fulfillment Center Warehouse & distribution 450 4 1.2%- Post Consumer Brands Cereal production 415 5 1.1%250 5 0.7% BTD Manufacturing Metal manufacturing 390 6 1.0%210 8 0.6% Buddy's Kitchen Food manufacturing and packaging 300 7 0.8%- Menasha Corporation Corrugated & solid fiber box mfg.286 8 0.7%237 6 0.7% Schmitty & Sons Bus Company Transportation 270 9 0.7%400 4 1.2% City of Lak eville (2)City government 265 10 0.7%209 9 0.6% Despatch Industries, Inc.Industrial furnace & oven mfg.-230 7 0.7% Jeff Belzer's Chevy-Dodge-KIA New & used auto dealership -200 10 0.6% Total principal employers 4,917 12.7% 4,336 12.8% All other employers 33,775 87.3%29,540 87.2% Total City of Lakeville civilian labor force (3)38,692 100.0% 33,876 100.0% Source: (1) Reference USA. (2) As of December 31, 2024 (full-time equivalent). (3) MN Department of Employment and Economic Development (DEED) as of December 31, 2024. 2024 2015 Page 585 of 899 CITY OF LAKEVILLE COMMERCIAL AND INDUSTRIAL BUILDING PERMITS ISSUED YEARS 2024 AND 2023 (153) BUSINESS PRODUCT/SERVICE VALUATION (1) RL Cold Cold storage facility 32,000,000$ Sweet Harvest Foods Office warehouse 16,192,000 New Creations Child Care Center Childcare Facility 3,900,000 Midwest ENT Specialists Medical office 3,000,000 Goodwill Retail building 3,000,000 PetSuites of America Pet boarding facility 2,800,000 Panda Express Drive-thru restaurant 1,957,000 Kenwood Commons Office building 1,300,000 Taco Bell Drive-thru restaurant 1,000,000 Cedar Hills Amenity Building Association assembly space 596,000 BUSINESS PRODUCT/SERVICE VALUATION (1) Post Consumer Brands R&D facility & office space 9,565,000$ Midwest ENT Specialists Medical office 2,200,000 Children’s Dental Care Dentist office 1,750,000 Dick’s Sanitation Refuse/Recycling & office space 1,439,000 Christian Heritage Academy Private School 1,200,000 Goldfish Swim School Swim School 960,000 Planet Fitness Exercise Gym 822,000 Northland Collision Auto repair shop 800,000 Action Behavior Centers Autism Therapy 700,000 Exuberance Chiropractic Chiropractic clinic 500,000 Notes: (1) Valuation excludes land and personal property. Source: City of Lakeville Inspections Departm ent. NEW BUILDING PERMITS 2024 AND 2023 (in excess of $500,000) EXPANSION OR REMODEL BUILDING PERMITS 2024 AND 2023 (in excess of $500,000) Page 586 of 899 CITY OF LAKEVILLE EMPLOYEES BY FUNCTION/PROGRAM (FULL-TIME EQUIVALENT) LAST TEN FISCAL YEARS (154) Function/Program 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 General government City administration 3.0 3.0 3.0 3.0 3.0 3.0 3.0 2.6 3.0 2.9 Communications 4.0 3.9 4.5 5.2 5.2 5.0 5.2 5.2 4.9 4.2 City clerk 1.0 1.0 1.0 1.0 1.0 1.0 1.0 1.6 1.0 1.0 Finance 6.6 6.7 7.0 7.0 6.7 6.7 6.7 7.1 8.5 7.8 Information Technology 3.0 3.1 3.8 4.0 4.0 4.0 4.0 4.0 3.6 4.0 Human resources 3.2 4.0 4.0 4.0 4.0 4.0 4.0 4.0 5.0 5.2 Planning 3.5 3.5 4.2 4.5 4.5 4.5 4.2 4.8 3.5 - Community and economic development 2.5 2.5 2.4 2.5 2.5 2.5 2.5 3.3 2.5 5.8 Protective inspection 7.6 8.0 8.4 9.0 9.1 9.8 10.3 10.5 10.2 9.9 General government buildings 3.0 4.6 5.5 6.0 6.2 6.5 5.7 5.3 5.4 5.4 Total general government 37.4 40.2 43.8 46.2 46.2 47.0 46.6 48.4 47.6 46.2 Public safety Police officers (sworn)52.8 54.7 54.6 57.0 61.0 61.7 61.0 66.4 65.5 67.0 Police administration 12.5 13.4 14.8 13.1 13.6 14.5 13.7 12.1 13.8 14.0 Fire (excluding volunteer firefighters)5.3 5.5 5.4 5.4 5.4 5.4 5.4 6.0 6.3 13.0 Total public safety 70.6 73.6 74.8 75.5 80.0 81.6 80.1 84.5 85.6 94.0 Public works Engineering 6.4 6.6 7.6 7.3 7.5 7.3 8.3 7.3 7.3 7.9 Forestry N/A N/A N/A N/A N/A N/A N/A N/A 2.0 1.8 Construction Services 3.9 3.7 3.3 4.0 4.7 4.9 5.3 4.1 4.5 3.2 Street maintenance 20.4 21.6 21.7 21.9 22.7 23.0 22.2 22.9 22.1 20.7 Total public works 30.7 31.9 32.6 33.2 34.9 35.2 35.8 34.3 35.9 33.6 Parks and recreation Park maintenance 14.8 14.0 15.1 16.4 16.6 16.3 15.4 16.5 18.2 18.4 Recreation 5.5 5.8 6.5 6.4 6.5 6.3 7.8 7.5 6.5 6.5 Arts center 3.7 3.7 3.6 3.8 3.7 3.2 4.3 4.5 4.0 4.0 Total parks and recreation 24.0 23.5 25.2 26.6 26.8 25.8 27.5 28.5 28.7 28.9 Total governmental activities 162.7 169.2 176.4 181.5 187.9 189.6 190.0 195.7 197.8 202.7 Liquor 24.4 25.3 26.1 26.0 26.3 26.5 29.9 36.6 36.6 38.4 Utility 21.6 21.3 23.1 24.3 24.6 24.0 24.0 25.8 23.1 23.4 Total business-type activities 46.0 46.6 49.2 50.3 50.9 50.5 53.9 62.4 59.7 61.8 Total employees 208.7 215.8 225.6 231.8 238.8 240.1 243.9 258.1 257.5 264.5 Source: City of Lakeville Human Resources Department. Note: Includes full-time equivalent for both full and part time employees and accounts for overtime. Seasonal employees are not included for purposes of this report. Page 587 of 899 CITY OF LAKEVILLE OPERATING INDICATORS BY FUNCTION LAST TEN FISCAL YEARS (155) Function 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 General government Number of registered voters N/A 41,124 N/A 41,693 N/A 44,511 N/A 48,064 N/A 49,723 Number of final plats approved 23 19 20 25 16 20 20 22 8 16 Number of building permits issued 2,030 1,889 1,829 1,875 4,260 3,376 3,129 3,612 4,221 2,659 Valuation of building perm its issued (in m illions)183$ 218$ 248$ 234$ 276$ 403$ 331$ 292$ 218$ 227$ Public safety Total calls for service 47,072 47,724 38,036 43,268 46,006 32,327 35,784 42,258 51,565 53,165 Traffic stops 17,681 18,239 15,680 18,412 18,700 8,024 6,214 9,605 12,143 11,795 Non-traffic related calls 29,391 29,485 22,356 24,856 27,306 24,303 27,783 32,653 39,422 41,370 Number of volunteer firefighters 83 85 86 82 88 85 90 90 70 65 Number of full-tim e firefighters - - - - - - - - - 6 Number of annual fire calls 1,192 1,347 1,477 1,500 1,694 1,998 2,794 3,114 3,266 3,593 Public w orks City street m iles added 4.5 17.0 3.1 3.6 7.5 7.0 10.8 5.4 4.7 5.3 Parks and recreation Park acres mowed 430 430 430 430 430 430 430 450 455 455 Park facility reservations taken 1,024 742 551 562 580 304 574 617 467 481 Program activity registrations taken 9,231 8,141 6,294 6,490 7,510 4,250 7,806 8,170 6,291 6,480 Liquor Annual sales (in millions)13.6$ 14.1$ 14.6$ 16.9$ 16.4$ 18.3$ 19.6$ 21.7$ 22.6$ 22.6$ Utility (in millions of gallons) Water (average daily consumption)5.2 5.5 5.8 5.8 5.2 6.3 7.5 7.4 7.8 6.2 Sanitary sewer (1)3.2 3.4 3.4 3.5 3.5 3.6 3.8 3.8 4.0 3.9 (average daily treatment) Notes: (1) Sewage is treated by the Metropolitan Council Environmental Services. N/A Indicates information is not available for this period at the printing of this report. Source: Various City of Lakeville Departments. Page 588 of 899 CITY OF LAKEVILLE CAPITAL ASSET STATISTICS BY FUNCTION LAST TEN FISCAL YEARS (156) Function (1)2015 2016 2017 2018 2019 2020 2021 2022 2023 2024 Public safety Police station 1 1 1 1 1 1 1 1 1 1 Fire stations 4 4 4 4 4 4 4 4 4 4 Public works City streets (miles)271.3 288.3 291.4 295.0 302.5 309.5 320.3 325.7 330.4 335.7 Parks and recreation Acres of parks, conservation areas, and greenways 1,590 1,600 1,600 1,600 1,677 1,677 1,677 1,706 1,706 1,706 Parks 59 60 60 61 61 61 61 65 67 67 Conservation areas 20 20 20 20 20 20 20 20 20 20 Trails and sidewalks - paved (miles)109 110 111 117 118 120 120 130 142 142 Ice rinks - outdoor (fully boarded)11 11 11 11 11 11 11 11 11 11 Ice rinks - indoor 3 3 3 3 3 3 3 3 3 3 Fields (softball, soccer, baseball, football, Lacrosse)96 96 96 97 97 97 97 98 101 101 Courts (basketball, volleyball, tennis, pickleball)38 38 43 43 43 43 47 47 56 56 Playgrounds 43 44 44 46 46 46 47 47 50 50 Swimming beaches 3 3 3 3 2 2 2 2 2 2 Liquor Number of on-sale stores owned 2 2 2 1 1 1 2 2 2 2 Number of on-sale stores leased 1 1 1 2 2 2 2 2 2 2 Utility Water Water mains (miles)321 321 346 350 358 367 380 387 396 396 Fire hydrants 3,572 3,572 3,818 3,885 3,969 4,080 4,374 4,494 4,595 4,595 Wells 17 18 18 19 19 19 19 19 19 19 Water Towers 5 5 6 6 6 6 6 6 6 6 Sanitary sewer Sanitary sewer mains (miles)261 261 261 264 270 278 288 295 303 304 Sanitary sewer lift stations 20 20 20 20 20 20 20 20 19 18 Notes: (1) Indicators for general government functions are not available. Source: Various City of Lakeville Departments. Page 589 of 899 CITY OF LAKEVILLE, MINNESOTA EXECUTIVE AUDIT SUMMARY YEAR ENDED DECEMBER 31, 2024 Page 590 of 899 (1) September 30, 2025 To the City Council and Management City of Lakeville, Minnesota We have prepared this management report in conjunction with our audit of the City of Lakeville, Minnesota’s (the City) financial statements for the year ended December 31, 2024. The purpose of this report is to provide comments resulting from our audit process and to communicate information relevant to city finances in Minnesota. We have organized this report into the following sections:  Audit Summary  Governmental Funds Overview  Enterprise Funds Overview  Government-Wide Financial Statements  Legislative Updates  Accounting and Auditing Updates We would be pleased to further discuss any of the information contained in this report or any other concerns that you would like us to address. We would also like to express our thanks for the courtesy and assistance extended to us during the course of our audit. The purpose of this report is solely to provide those charged with governance of the City, management, and those who have responsibility for oversight of the financial reporting process comments resulting from our audit process and information relevant to city finances in Minnesota. Accordingly, this report is not suitable for any other purpose. Christopher Knopik, CPA, CFE Minneapolis, Minnesota September 30, 2025 Page 591 of 899 (2) AUDIT SUMMARY The following is a summary of our audit work, key conclusions, and other information that we consider important or that is required to be communicated to the City Council, administration, or those charged with governance of the City. OUR RESPONSIBILITY UNDER AUDITING STANDARDS GENERALLY ACCEPTED IN THE UNITED STATES OF AMERICA AND GOVERNMENT AUDITING STANDARDS We have audited the financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City as of and for the year ended December 31, 2024, and the related notes to the financial statements. Professional standards require that we provide you with information about our responsibilities under auditing standards generally accepted in the United States of America and Government Auditing Standards, as well as certain information related to the planned scope and timing of our audit. We have communicated such information to you verbally, in our Governance Communication Letter, and in our audit engagement letter. Professional standards also require that we communicate the following information related to our audit. PLANNED SCOPE AND TIMING OF THE AUDIT We performed the audit according to the planned scope and timing previously discussed and coordinated in order to obtain sufficient audit evidence and complete an effective audit. AUDIT OPINION AND FINDINGS Based on our audit of the City's financial statements for the year ended December 31, 2024:  We issued an unmodified opinion on the City's basic financial statements.  We issued an unmodified opinion on the City’s compliance with major federal award programs.  We reported no deficiencies in the City's internal control over financial reporting that we considered to be material weaknesses.  We reported no deficiencies in the City's internal control over financial reporting that we considered to be a significant deficiency.  The results of our testing disclosed no instances of noncompliance required to be reported under Government Auditing Standards. Overall, we found the City’s financial records to be in excellent condition. This not only provides for an efficient year-end audit, but should also provide confidence in the interim financial data used to manage the City throughout the year. Page 592 of 899 (3) GOVERNMENTAL FUNDS OVERVIEW This section of the report provides you with an overview of the financial trends and activities of the City’s governmental funds, which include the General, special revenue, debt service, and capital project funds. These funds are used to account for the basic services the City provides to all of its citizens, which are financed primarily with property taxes. The governmental fund information in the City’s financial statements focuses on budgetary compliance, and the sufficiency of each governmental fund’s current assets to finance its current liabilities. PROPERTY TAXES Minnesota cities rely heavily on local property tax levies to support their governmental fund activities. For the 2022 fiscal year (the most recent comparative state-wide data available), local ad valorem property tax levies provided 44.1 percent of the total governmental fund revenues for cities over 2,500 in population, and 35.2 percent for cities under 2,500 in population. Total property taxes levied by all Minnesota cities for taxes payable in 2024 increased 7.6 percent compared to the prior year, and 7.7 percent for taxes payable in 2025. The taxable net tax capacity value of property in Minnesota cities increased about 8.3 percent for the 2024 levy year. The tax capacity values used for levying property taxes are based on the assessed market values for the previous fiscal year (e.g., tax capacity values for taxes levied in 2024 were based on assessed market values as of January 1, 2023), so the trend of change in these tax capacity values lags somewhat behind the housing market and economy in general. The total market value of property in Minnesota cities increased 7.38 percent for the 2024 levy year, following an increase of 16.0 percent for levy year 2023, and an increase of 17.0 percent for 2022. The City’s taxable market value increased 22.0 percent for taxes payable in 2023 and 8.2 percent for taxes payable in 2024. The following graph shows the City’s changes in taxable market value over the past 10 years including 2024: $- $2 $4 $6 $8 $10 $12 $14 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024BillionsTaxable Market Value Taxable Market Value Page 593 of 899 (4) Tax capacity is considered the actual base available for taxation. It is calculated by applying the state’s property classification system to each property’s market value. Each property classification, such as commercial or residential, has a different calculation and uses different rates. Consequently, a city’s total tax capacity will change at a different rate than its total market value, as tax capacity is affected by the proportion of the City’s tax base that is in each property classification from year-to-year, as well as legislative changes to tax rates and exemptions. The City’s tax capacity increased 9.4 percent and 22.3 percent for taxes payable in 2024 and 2023, respectively. The following graph shows the City’s change in tax capacities over the past 10 years: 0.00% 5.00% 10.00% 15.00% 20.00% 25.00% 30.00% 35.00% 40.00% 45.00% $- $20 $40 $60 $80 $100 $120 $140 $160 2015 2016 2017 2018 2019 2020 2021 2022 2023 2024MillionsTax Capacity vs. Tax Rate (City Only) Local Net Tax Capacity Tax Rate Page 594 of 899 (5) The following chart provides a comparison of the City’s 2024 tax capacity rate with other comparable cities: 20.956 24.453 28.470 30.303 33.668 27.402 30.213 33.585 33.319 32.892 36.789 39.820 37.606 50.132 0.000 10.000 20.000 30.000 40.000 50.000 60.000 $(100) $100 $300 $500 $700 $900 $1,100 $1,300 $1,500 $1,700 $1,900 Estimated City Property Taxes This chart is based on the City of Lakeville’s 2023 median home estimated market value of $440,353 and estimated taxable market value of $449,700. The City of Lakeville when compared to other local cities is right in the middle. This chart is an estimate of only the City’s portion of taxes and excludes other taxing jurisdictions (i.e. schools, county, special districts). Page 595 of 899 (6) GOVERNMENTAL FUND BALANCES The following table summarizes the changes in the fund balances of the City’s governmental funds during the year ended December 31, 2024, presented both by fund balance classification and by fund: Increase 2024 2023 (Decrease) Fund Balances of Governmental Funds Total by Classification Nonspendable 352,765$ 279,568$ 73,197$ Restricted 59,112,599 53,196,145 5,916,454$ Committed 47,971,292 48,514,099 (542,807)$ Assigned - 1,528,414 (1,528,414)$ Unassigned 20,668,085 18,684,638 1,983,447$ Total governmental funds 128,104,741$ 122,202,864$ 5,901,877$ Total by Fund General 23,186,629$ 22,372,997$ 813,632$ Debt Service 23,590,844 22,191,294 1,399,550$ Capital Projects 79,690,723 76,100,864 3,589,859$ Nonmajor Funds 1,636,545 1,537,709 98,836$ Total governmental funds 128,104,741$ 122,202,864$ 5,901,877$ Fund Balance As of December 31, In total, the fund balances of the City’s governmental funds increased $5,901,877 during the year ended December 31, 2024. The majority of the increase was due to the restricted fund balances of $5.9 million, and capital projects balances of $3.6 million, which were partially offset by decreases in assigned fund balance of $1.5 million. The increase in restricted and capital projects balances was due primarily to use of funds for their restricted purposes and there was an influx of bonds proceeds in 2024. The decrease in the assigned balance reflects that the 2025 adopted budget is a balanced budget where revenues are expected to exceed expenditures and no use of fund balance is anticipated. Page 596 of 899 (7) GOVERNMENTAL FUNDS REVENUE AND EXPENDITURES The following table presents the per capita revenue of the City’s governmental funds for the past three years, along with state-wide averages. We have included the most recent comparative state-wide averages available from the Office of the State Auditor to provide a benchmark for interpreting the City’s data. The amounts received from the typical major sources of governmental fund revenue will naturally vary between cities based on factors such as the City’s stage of development, location, size and density of its population, property values, services it provides, and other attributes. It will also differ from year-to-year due to the effect of inflation and changes in the City’s operation. Also, certain data on these tables may be classified differently than how they appear on the City’s financial statements in order to be more comparable to the state-wide information, particularly in separating capital expenditures from current expenditures. We have designed this section of our management report using per capita data in order to better identify unique or unusual trends and activities of your city. We intend for this type of comparative and trend information to complement, rather than duplicate, information in the Management’s Discussion and Analysis. An inherent difficulty in presenting per capita information is the accuracy of the population count, which for most years is based on estimates. State-Wide Year December 31, 2022 2022 2023 2024 Population 20,000 - 100,000 73,828 75,217 76,746 Property taxes 584$ 485$ 527$ 568$ Tax increments 46 14 7 10 Franchise and other taxes 58 - - 7 Special assessments 50 47 105 38 Licenses and permits 55 61 54 40 Intergovernmental revenues 223 234 203 52 Charges for services 137 238 148 188 Other (21) (65) 94 92 Total Revenue 1,132 1,014 1,138 995 City of Lakeville Governmental Funds Revenue per Capita With State-Wide Averages by Population Class The City’s governmental funds have typically generated less revenue per capita in total than other Minnesota cities in its population class, this is primarily due to less property tax revenue and the City does not receive local government aid (intergovernmental revenue), these are partially offset by significantly more licenses and charges for services when compared to other cities. Total governmental funds revenues were $76.3 million in 2024, about $9.4 million (10.9 percent) less than the prior year. The decrease was primarily the result of one-time Public Safety Aid in the amount of $3.156 million received in 2023 that did not recur in 2024, along with a lower level of state-aid funding for street maintenance projects compared to the prior year. On a per capita basis, governmental fund revenue for 2024 was $143 less than the prior year. Property tax revenue was $41 per capita higher than the previous year due to a levy increase. Intergovernmental revenues were $151 per capita less than last year due to receiving public safety aid in the previous year. Licenses and permits were $14 per capita less than last year due to a slight decrease in these revenues from 2023 and the increase in the City’s population, but there continues to be significant economic development and community growth in the City. Charges for Services shown above increased $188 per capita, due primarily to economic development and community growth. Page 597 of 899 (8) Below is a chart of the City of Lakeville’s 2024, 2023 and 2022 governmental funds revenue per capita as compared to the average per capita revenues for the governmental funds of several comparable cities for the year 2022. The comparable cities included in the average below (and in any other instances of a comparable city average included in this report) are Apple Valley, Blaine, Bloomington, Chanhassen, Eagan, Eden Prairie, Inver Grove Heights, Maple Grove, Plymouth, Prior Lake, Savage, Shakopee, and Woodbury. $(100) $- $100 $200 $300 $400 $500 $600 $700 Revenues Per Capita Lakeville '22 Lakeville '23 Lakeville '24 Comparable Average The expenditures of governmental funds will also vary from state-wide averages and from year-to-year, based on the City’s circumstances. Expenditures are classified into three types as follows: Current – These are typically the general operating type expenditures occurring on an annual basis, and are primarily funded by general sources such as taxes and intergovernmental revenues. Capital Outlay – These expenditures do not occur on a consistent basis, more typically fluctuating significantly from year-to-year. Many of these expenditures are project-oriented, and are often funded by specific sources that have benefited from the expenditure, such as special assessment improvement projects. Debt Service – Although the expenditures for debt service may be relatively consistent over the term of the respective debt, the funding source is the important factor. Some debt may be repaid through specific sources such as special assessments or redevelopment funding, while other debt may be repaid with general property taxes. Page 598 of 899 (9) The City’s expenditures per capita of its governmental funds for the past three years, together with state-wide averages, are presented in the following table: State-Wide Year December 31, 2022 2022 2023 2024 Population 20,000 - 100,000 73,828 75,217 76,746 Current General Government 115$ 113$ 110$ 112$ Public Safety 324 215 232 255 Public Works 113 70 78 73 Parks and recreation 102 66 72 78 654 464 492 518 Capital Outlay And construction 159 577 719 453 Debt Service Principal 109 103 175 224 Interest and fiscal 34 64 67 66 143 167 242 289 Total Expenditures 956 1,208 1,453 1,261 City of Lakeville Governmental Fund Expenditures per Capita With State-Wide Averages by Population Class Total expenditures in the City’s governmental funds for 2024 were $96.8 million, a decrease of $12.4 million (11.4 percent) from the previous year, or $192 per capita. The decrease was primarily due to capital outlay, which was $266 per capita less than the previous year, primarily due to several large street and utility improvement projects during 2023, and an increase in debt service expenditures of $47 per capita. The increase in debt service reflects the voter-approved referendum to issue $42 million in debt for park-related infrastructure improvements. Page 599 of 899 (10) Below is a chart of the City of Lakeville’s 2024 governmental funds expenditures per capita as compared to the average per capita expenditures for the governmental funds of several comparable cities for the year 2022. $- $100 $200 $300 $400 $500 $600 $700 $800 Expenditures Per Capita Lakeville '22 Lakeville '23 Lakeville '24 Comparables Average GENERAL FUND The City’s General Fund accounts for the financial activity of the basic services provided to the community. The primary services included within this fund are the administration of the municipal operation, police and fire protection, building inspection, streets and highway maintenance, and parks and recreation. Page 600 of 899 (11) The graph below illustrates the change in the General Fund financial position over the last five years. We have also included a line representing annual expenditures to reflect the change in the size of the General Fund operation over the same period. $- $5 $10 $15 $20 $25 $30 $35 $40 $45 2020 2021 2022 2023 2024MillionsGeneral Fund Financial Position Year Ended December 31, Unassigned Fund Balance Cash Balance (net)Expenditures The City’s General Fund cash and investments balance at December 31, 2024 was $31,074.728, decreased $550,601. Total fund balance at December 31, 2024 was $23,186,629, an increase of $749,496 from the prior year, as compared to the final budget that projected a $1,515,824 decrease in fund balance. As the graph illustrates, the City has generally been able to maintain healthy cash and fund balance levels as the volume of financial activity has grown. This is an important factor because a government, like any organization, requires a certain amount of equity to operate. A healthy financial position allows the City to avoid volatility in tax rates; helps minimize the impact of state funding changes; allows for the adequate and consistent funding of services, repairs, and unexpected costs; and is a factor in determining the City’s bond rating and resulting interest costs. Maintaining an adequate fund balance has become increasingly important given the fluctuations in state funding for cities in recent years. A trend that is typical to Minnesota local governments, especially the General Fund of cities, is the unusual cash flow experienced throughout the year. The City’s General Fund cash disbursements are made fairly evenly during the year other than the impact of seasonal services such as snowplowing, street maintenance, and park activities. Cash receipts of the General Fund are quite a different story. Taxes comprise about 74 percent of the fund’s total annual revenue. Approximately half of these revenues are received by the City in July and the rest in December. Consequently, the City needs to have adequate cash reserves to finance its everyday operations between these payments. The City’s General Fund’s unassigned fund balance at the end of the 2024 fiscal year represents approximately 53.6 percent of annual expenditures based on 2024 levels, compared to 51.5 percent at the end of the previous year. Page 601 of 899 (12) The following graph reflects the City’s General Fund revenue sources for 2024 compared to budget: $- $2 $4 $6 $8 $10 $12 $14 $16 $18 $20 $22 $24 $26 $28 $30 $32 All Other Licenses and Permits Charges for Services Intergovernmental Taxes Millions General Fund Revenue Budget and Actual Budget Actual General Fund revenue for 2024 was $39,867,287, which was $997,225 (2.57 percent) more than budget. Property taxes were lower than anticipated by $308,012 due in part to slightly lower than anticipated current tax collection rates and moderately lower than expected delinquent tax collections. Licenses and permits revenue exceeded estimates by $90,144, primarily due to change in the mix of building permits from single family to multi-family homes. The number of residential building permits budgeted were 300 compared to 285 actual. Permits for townhomes were budgeted at 140 units compared to 149 actual units. Charges for services revenue was under budget $646,277, primarily due to engineering-related services with developer construction administration. Page 602 of 899 (13) Intergovernmental revenues exceeded estimates by $268,447 mainly due to the City's receipt of $131,962 in state aid contributions to PERA, federal grants of $53,869 and state grants of $91,699. The total of all remaining other revenues was greater than the total of the budget of all remaining other revenues primarily due to improved investment market conditions. The City's management employs prudent investment practices and cash management techniques to maximize investment income while protecting the City's treasury. Investments are typically held to maturity. The following graph presents the City’s General Fund revenues by source for the last five years. The graph reflects the City’s reliance on property taxes and other local sources of revenue. $(2) $- $2 $4 $6 $8 $10 $12 $14 $16 $18 $20 $22 $24 $26 $28 $30 Taxes Licenses and Permits Intergovernmental Charges for Services All OtherMillionsGeneral Fund Revenue by Source Year Ended December 31, 2020 2021 2022 2023 2024 Overall, General Fund revenues increased by $1,334,265 (3.5 percent) from the previous year. Property tax revenue was $2,811,833 more than last year due to a 10.1 percent increase in the property tax levy. Intergovernmental revenue decreased $1,567,030 because of the City’s receipt of $3.156 million in one-time Public Safety Aid in 2023, of which $1.8 million was recorded in the General Fund and the remainder in the Capital Projects Fund, which was not replicated in 2024. Revenue from charges for services increased $451,985 due primarily to an increase in public works fees for engineering-related services. Licenses and permits decreased $436,861 due primarily to a decrease in building permits during 2024. Finally, revenue in the “all other” category as shown above was $74,338 greater than last year, primarily due to an increase in investment returns, related to the improvements in fair market value. Page 603 of 899 (14) The following graph illustrates the components of General Fund spending for 2024 compared to budget: $- $2 $4 $6 $8 $10 $12 $14 $16 $18 $20 $22 Parks and Recreation Public Works Public Safety General Government Millions General Fund Expenditures Budget and Actual Budget Actual Total General Fund expenditures for 2024 were $39,129,789, which was $1,268,095 (3.1 percent) under the final budget. General Fund expenditures were under budget in every functional area, as shown in the graph above, except Public Safety and Parks and Recreation. General government expenditures were $568,851 under budget, with the largest savings in inspections and community and economic development. Parks and recreation expenditures were $55,457 over budget, mainly in the Arts Center. Public works costs were under budget by $930,465, primarily due personnel services savings in both street maintenance and construction services. These savings are due to less street maintenance and construction services being needed than planned. Public safety expenditures were $175,764 over budget, primarily in police personnel services due to the City’s support of local agencies during a high-profile incident. Page 604 of 899 (15) The following graph presents the City’s General Fund expenditures by function for the last five years: $- $2 $4 $6 $8 $10 $12 $14 $16 $18 $20 General Government Public Safety Public Works Parks and RecreationMillionsGeneral Fund Expenditures by Function Year Ended December 31, 2020 2021 2022 2023 2024 Total General Fund expenditures for 2024 were $2,764,413 (7.6 percent) higher than the previous year, with the increases primarily occurring in public safety and public works. The majority of the increase was in personnel costs, adding 16 new positions - 15 full-time firefighters (funded by a new SAFER grant) and one police officer, contractual wage increases and inflationary benefit cost increases. Page 605 of 899 (16) ENTERPRISE FUNDS OVERVIEW The City maintains two enterprise funds to account for services the City provides that are financed primarily through fees charged to those utilizing the service. This section of the report provides you with an overview of the financial trends and activities of the City’s enterprise funds, which include the (water, sewer, street light, and environmental resources) Utility Fund and Liquor Fund. ENTERPRISE FUNDS FINANCIAL POSITION The following table summarizes the changes in the financial position of the City’s enterprise funds during the years ended December 31, 2024 and 2023, presented both by classification and by fund: Increase 2024 2023 (Decrease) Net Position of enterprise funds Total by classification Net Investment in capital assets 199,011,990$ 188,259,693$ 10,752,297$ Unrestricted 37,198,950 32,808,653 4,390,297 Total Enterprise Funds 236,210,940$ 221,068,346$ 15,142,594$ Total by Fund Liquor 12,984,719$ 12,869,552$ 115,167$ Utility 223,226,221 208,198,794 15,027,427 Total Enterprise Funds 236,210,940$ 221,068,346$ 15,142,594$ Net Position As of December 31, Enterprise Funds Change in Financial Position In total, the net position of the City’s enterprise funds increased by $15,027,427 during the year ended December 31, 2024. The Liquor Fund net position increased by $115,167. Liquor fund net transfers out were $1.34 million. The increases in both the net investment in capital assets and the net position of the Utility Enterprise Fund were primarily due to capital infrastructure contributions of $11.1 million received from developers, other government agencies, and the City’s governmental funds. Page 606 of 899 (17) LIQUOR FUND The following graphs present five years of operating results for the Liquor Fund: $- $5 $10 $15 $20 $25 2020 2021 2022 2023 2024MillionsLiquor Fund - Revenues, Expenses, and Income Year Ended December 31, Sales Cost of Sales Operating Expenses Operating Income The Liquor Fund ended 2024 with a net position of $12,984,719, an increase of $115,167 from prior year operations. Of liquor store fund net position, $9,744,496 represents net investment in capital assets leaving an unrestricted net position of $3,240,223. Gross liquor sales for 2024 were $22,647,127 a decrease of $45,428 (0.2 percent) from 2023. The Liquor Fund generated a gross profit of $6,315,782 in 2024, or about 27.8 percent, of gross sales. Operating expenses for 2024 were $4,954,945, an increase of $200,884 (3.90 percent) from the prior year. Net operating income for 2024 was $1,360,837, or about 6.0 percent, of gross sales. The increase in gross sales, along with the resulting improvement in the gross profit ratio shown below, was driven primarily by higher sales volumes and expansion into new product categories. The Liquor Fund also made net transfers out of $1,339,950 to support the General Fund, for debt service, and for various capital needs. Page 607 of 899 (18) 24.9%26.1%26.6%26.9%27.4% 27.9% 6.2%8.3%8.0%6.2%4.7%6.0% 26.7%27.6%27.8% 25.3% 0.0% 5.0% 10.0% 15.0% 20.0% 25.0% 30.0% 0.0% 5.0% 10.0% 15.0% 20.0% 25.0% 30.0% 2019 2020 2021 2022 2023 2024 Liquor Fund - Operating Ratios Year Ended December 31, Gross Profit as a percentage of Sales Operating Income as a Percentage of Sales 7 County Metro (Offsale) Page 608 of 899 (19) UTILITY FUND The following graph presents five years of comparative operating results for the City’s (water, sewer, street light, and environmental resources) Utility Fund: $0$1$2$3$4$5$6$7$8$9$10$11$12$13$14$15$16$17$18$19$20$21$22$23$24$25$26$27$28$29$30$31$32$33$34$35$36$37$38$39$40$41$42$43$44$45$46$47$48 2020 2021 2022 2023 2024MillionsUtility Fund Year Ended December 31, Operating Expense Depreciation Operating Revenue Income Before Depreciation The Utility Fund ended 2024 with net position of $223,226,221, an increase of $15,027,427 from the previous year. Of the net position balance, $199,011,990 represents the City’s net investment in utility capital assets, leaving $37,198,950 of unrestricted net position. Utility Fund operating revenue was $21,287,682 for 2024, a decrease of $1,428,022 (6.29 percent), mainly due to customer consumption because of changes in weather patterns, rate increases, and change in in the number of customers. Operating expenses (including depreciation and amortization of $6,703,894) were $22,202,242, which represents a decrease of $391,749 (1.73 percent). The decrease was mainly due to lower stormwater maintenance costs (largely grant-funded), reduced electric costs from drought conditions in 2023, meter replacements expensed in 2023 but capitalized in 2024, and higher streetlight replacement costs in 2023. The Utility Fund also received capital contributions of $11,095,961 in 2024 from developers, other governmental agencies, and the City’s governmental funds. Page 609 of 899 (20) GOVERNMENT-WIDE FINANCIAL STATEMENTS In addition to fund-based information, the current reporting model for governmental entities also requires the inclusion of two government-wide financial statements designed to present a clear picture of the City as a single, unified entity. These government-wide financial statements provide information on the total cost of delivering services, including capital assets and long-term liabilities. STATEMENT OF NET POSITION The Statement of Net Position essentially tells you what your city owns and owes at a given point in time, the last day of the fiscal year. Theoretically, net position represents the resources the City has leftover to use for providing services after its debts are settled. However, those resources are not always in spendable form, or there may be restrictions on how some of those resources can be used. Therefore, net position is divided into three components: net investment in capital assets, restricted, and unrestricted. The following table presents the components of City’s net position as of December 31, 2024 and 2023, for governmental activities and business-type activities: Increase 2024 2023 (Decrease) Net Position Governmental Activities Net Investment in capital assets 259,538,899$ 240,978,608$ 18,560,291$ Restricted 72,430,099 73,224,358 (794,259) Unrestricted 18,284,630 17,814,210 470,420 Total governmental activities 350,253,628$ 332,017,176$ 18,236,452$ Business-type activities Net Investment in capital assets 199,011,990$ 192,611,852$ 6,400,138$ Unrestricted 37,450,763 32,950,342 4,500,421 Total business-type activities 236,462,753 225,562,194 10,900,559 Total net position 586,716,381$ 557,579,370$ 29,137,011$ As of December 31, The total net position of the City increased $29.1 million during the 2024 fiscal year. Of the increase, $18.2 million came from governmental activities and $10.9 million from business-type activities. One of the primary reasons for the increases in both the governmental and business-type activities was the amount of infrastructure contributed by developers and governmental activities during 2024, which totaled about $11.1 million, and large increases in property taxes of $4 million and capital grants of 6.2 million. Page 610 of 899 (21) STATEMENT OF ACTIVITIES The Statement of Activities tracks the City’s yearly revenues and expenses, as well as any other transactions that increase or reduce total net position. These amounts represent the full cost of providing services. The Statement of Activities provides a more comprehensive measure than just the amount of cash that changed hands, as reflected in the fund-based financial statements. This statement includes the cost of supplies used, depreciation of long-lived capital assets, and other accrual-based expenses. The following table presents the change in the net position of the City for the years ended December 31, 2024 and 2023: 2023 Program Expenses Revenues Net Change Net Change Net (expense) revenue Governmental activities General government 9,524,931$ 8,008,922$ (1,516,009)$ (2,930,389)$ Public safety 21,818,556 2,643,057 (19,175,499) (14,648,058) Public works 27,274,347 24,826,969 (2,447,378) (1,914,533) Parks and recreation 11,644,154 5,210,779 (6,433,375) (6,427,863) Interest on long-term debt 3,535,602 - (3,535,602) (2,903,304) Business-type activities Liquor 21,357,518 22,686,009 1,328,491 966,524 Utility 22,236,710 31,333,144 9,096,434 6,628,980 Total net (expense) revenue 117,391,818$ 94,708,880$ (22,682,938) (21,228,643) General Revenues Property taxes and tax increments 44,289,880 40,247,761 Franchise Taxes 531,252 Investment earnings 6,998,817 7,156,913 Total general revenues 51,819,949 47,404,674 Change in net position 29,137,011 26,176,031 Net position , as restated 553,227,211 527,051,180 Restatement 4,352,159 - Net position - ending 586,716,381$ 553,227,211$ 2024 One of the goals of this statement is to provide a side-by-side comparison to illustrate the difference in the way the City’s governmental and business-type operations are financed. The table clearly illustrates the dependence of the City’s governmental operations on general revenues such as property taxes and unrestricted grants, while its business-type activities are financed predominately through program revenues. Page 611 of 899 (22) LEGISLATIVE UPDATES With the 2025 legislative session done and with one party in control of the House, Senate, and the Governor’s office, there was a lot of movement in St. Paul and several significant things were completed this year. The following is a summary of recent legislation affecting Minnesota cities in 2024/2025 and into the future: Bonding – The Legislature approved $700 million in general obligation bonds. This includes $176 million allocated for water and sewer infrastructure through the Public Facilities Authority, $78 million for local roads and bridges, wetland replacement, and major bridges, and $26 million for public housing rehabilitation. Additionally, $15 million was designated for metro area inflow and infiltration work required by the Metropolitan Council, $9 million for projects on the state flood hazard mitigation list, and $6 million for infrastructure to mitigate drinking water contamination. Economic development infrastructure grant programs received $3 million, and $1 million was allocated for tree planting grants through the Metropolitan Council. Cannabis – Cities with a municipal cannabis retailer license are not allowed to also hold a lower- potency edible hemp retailer license. Previously no entity could hold more than one license. The law was clarified to say that cities may issue a retail registration to a cannabis business that has preliminary license approval Taxes – Due to budget targets requiring spending reductions or increased revenue, it was a challenging year for new expenditures. Although there were discussions about cutting local government aid (LGA), the appropriation remained intact. Proposals to exempt local government construction material purchases from sales tax were not included in the final bill. The cannabis gross receipts tax rate increased from 10% to 15%, and local government cannabis aid was eliminated. The House and Senate proposed different local sales tax policies, but no new general policy language was adopted. The local sales tax moratorium ended on May 31, 2025. Emergency Medical Services – A total of $27.5 million was appropriated for the 2026–2027 biennium to support EMS programs. This funding will support training and education for ambulance staff, a rural uncompensated care pool payment program, an ambulance service training and staffing grant program, and an ambulance operating deficit grant program. These funds will be managed by the Minnesota Office of Emergency Medical Services. Employment – The maximum premium rate for Minnesota Paid Leave was reduced to 1.1% of taxable wages. Modifications to Earned Sick and Safe Time (ESST) now allow employers to require reasonable notice and documentation for absences of two or more consecutive days, permit employees to find replacement workers, and allow employers to prorate frontloaded ESST hours. Mandatory break policies now require a 15-minute rest break for every four hours worked and a 30- minute meal break for every six hours worked. The notice of termination statute was also updated to define “fraud,” “misuse,” and “personal gain.” Page 612 of 899 (23) ACCOUNTING AND AUDITING UPDATES GASB Statement No. 102 “Certain Risk Disclosures” – the primary objective of this Statement is to provide users of government financial statements with essential information about risks related to a government’s vulnerabilities due to certain concentrations or constraints. This Statement defines a concentration as a lack of diversity related to an aspect of a significant inflow of resources or outflow of resources. A constraint is a limitation imposed on a government by an external party or by formal action of the government’s highest level of decision-making authority. Concentrations and constraints may limit a government’s ability to acquire resources or control spending. This Statement is effective for periods beginning after June 15, 2024. GASB Statement No. 103 “Financial Reporting Model Improvements” – the primary objective of this Statements is to improve key components of the financial reporting model to enhance its effectiveness in providing information that is essential for decision making and assessing a government’s accountability. Areas impacted include the MD&A, Proprietary fund Statement of Revenues, Expenses, and Changes in Fund net Position, and Budgetary Comparison Information. This Statement is effective for fiscal periods beginning after June 15, 2025. GASB Statement No. 104 “Disclosure of Certain Capital Assets” – t he primary objective of this Statement is to improve key components of the financial reporting model to enhance its effectiveness in providing information that is essential for decision making and assessing a government’s accountability. This Statement will clarify how capital assets are disclosed for capital assets help for sale and related pledged debt, leased assets, subscription assets, right to use PPP assets and other intangible assets. This Statement is effective for fiscal periods beginning after June 15, 2025. Page 613 of 899 CLA (CliftonLarsonAllen LLP) is an independent network member of CLA Global. See CLAglobal.com/disclaimer. CliftonLarsonAllen LLP CLAconnect.com Honorable Mayor and the City Council City of Lakeville Lakeville, Minnesota We have audited the financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of City of Lakeville as of and for the year ended December 31, 2024, and have issued our report thereon dated September 30, 2025.We have previously communicated to you information about our responsibilities under auditing standards generally accepted in the United States of America and Government Auditing Standards, as well as certain information related to the planned scope and timing of our audit in our engagement letter dated October 25, 2024.Professional standards also require that we communicate to you the following information related to our audit. Significant audit findings or issues Qualitative aspects of accounting practices Accounting policies Management is responsible for the selection and use of appropriate accounting policies. The significant accounting policies used by City of Lakeville are described in Note 1 to the financial statements. As described in Note 22, the City changed accounting policies related to the treatment of group asset purchases. This change was prompted by the amendment of Question 7.9.8 in GASB Implementation Guide 2015-1, replaced by Question 5.1 in Implementation Guide 2021-1. The change is applied retroactively in accordance with GASB Statement No. 100, which resulted in a restatement to beginning balances as of the beginning of the year. As described in Note 1, the City changed accounting policies related to compensated absences by adopting Statement of Governmental Accounting Standards Board (GASB) Statement No.101, Compensated Absences, in 2024. Accordingly, there is no cumulative effect of the accounting change as of the beginning of the year. We noted no transactions entered into by the entity during the year for which there is a lack of authoritative guidance or consensus.All significant transactions have been recognized in the financial statements in the proper period. Page 614 of 899 Honorable Mayor and the City Council City of Lakeville Page 2 Accounting estimates Accounting estimates are an integral part of the financial statements prepared by management and are based on management’s knowledge and experience about past and current events and assumptions about future events. Certain accounting estimates are particularly sensitive because of their significance to the financial statements and because of the possibility that future events affecting them may differ significantly from those expected. The most sensitive estimates affecting the financial statements were: Management’s estimate of the other postemployment benefits liability and the related deferred inflows and outflows of resources are based on actuarial calculations. We evaluated the methods, assumptions, and data used to develop the other postemployment benefits liability and the related deferred inflows and outflows of resources in determining that it is reasonable in relation to the financial statements taken as a whole. Management’s estimate of the Lakeville Firefighter Relief Association’s net pension asset and the related deferred inflows and outflows of resources are based on actuarial calculations. We evaluated the methods, assumptions, and data used to develop the net pension asset and the related deferred inflows and outflows of resources in determining that it is reasonable in relation to the financial statements taken as a whole. Financial statement disclosures Certain financial statement disclosures are particularly sensitive because of their significance to financial statement users. There were no particularly sensitive financial statement disclosures. The financial statement disclosures are neutral, consistent, and clear. Significant unusual transactions We identified no significant unusual transactions. Difficulties encountered in performing the audit We encountered no significant difficulties in dealing with management in performing and completing our audit. Uncorrected misstatements Professional standards require us to accumulate all misstatements identified during the audit, other than those that are clearly trivial, and communicate them to the appropriate level of management. The following summarizes uncorrected misstatements of the financial statements: The liquor fund and business-type activities, inventory and net position is overstated based on the projected error for differences in inventory observation counts by $51,446. Corrected misstatements None of the misstatements detected as a result of audit procedures and corrected by management were material, either individually or in the aggregate, to the financial statements taken as a whole. Page 615 of 899 Honorable Mayor and the City Council City of Lakeville Page 3 Disagreements with management For purposes of this communication, a disagreement with management is a disagreement on a financial accounting, reporting, or auditing matter, whether or not resolved to our satisfaction, that could be significant to the financial statements or the auditors’ report. No such disagreements arose during our audit. Circumstances that affect the form and content of the auditors’ report During 2024, the City changed accounting policies related to the treatment of group asset purchases. This change was prompted by the amendment of Question 7.9.8 in GASB Implementation Guide 2015- 1, replaced by Question 5.1 in Implementation Guide 2021-1. The change is applied retroactively in accordance with GASB Statement No. 100, which resulted in a restatement to beginning balances in the amount of $4,352,159 with a corresponding increase in Utility Fund capital assets. Management representations We have requested certain representations from management that are included in the management representation letter dated September 30, 2025. Management consultations with other independent accountants In some cases, management may decide to consult with other accountants about auditing and accounting matters, similar to obtaining a “second opinion” on certain situations. If a consultation involves application of an accounting principle to the entity’s financial statements or a determination of the type of auditors’ opinion that may be expressed on those statements, our professional standards require the consulting accountant to check with us to determine that the consultant has all the relevant facts. To our knowledge, there were no such consultations with other accountants. Significant issues discussed with management prior to engagement We generally discuss a variety of matters, including the application of accounting principles and auditing standards, with management each year prior to engagement as the entity’s auditors. However, these discussions occurred in the normal course of our professional relationship and our responses were not a condition to our engagement. Required supplementary information With respect to the required supplementary information (RSI) accompanying the financial statements, we made certain inquiries of management about the methods of preparing the RSI, including whether the RSI has been measured and presented in accordance with prescribed guidelines, whether the methods of measurement and preparation have been changed from the prior period and the reasons for any such changes, and whether there were any significant assumptions or interpretations underlying the measurement or presentation of the RSI. We compared the RSI for consistency with management’s responses to the foregoing inquiries, the basic financial statements, and other knowledge obtained during the audit of the basic financial statements. Because these limited procedures do not provide sufficient evidence, we did not express an opinion or provide any assurance on the RSI. Page 616 of 899 Honorable Mayor and the City Council City of Lakeville Page 4 Supplementary information in relation to the financial statements as a whole With respect to the combining and individual fund financials (collectively, the supplementary information) accompanying the financial statements, on which we were engaged to report in relation to the financial statements as a whole, we made certain inquiries of management and evaluated the form, content, and methods of preparing the information to determine that the information complies with accounting principles generally accepted in the United States of America, the method of preparing it has not changed from the prior period or the reasons for such changes, and the information is appropriate and complete in relation to our audit of the financial statements. We compared and reconciled the supplementary information to the underlying accounting records used to prepare the financial statements or to the financial statements themselves. We have issued our report thereon dated September 30, 2025. Other information included in annual reports Other information (financial or nonfinancial information other than the financial statements and our auditors’ report thereon) is being included in your annual report and is comprised of the introductory and statistical sections. Our responsibility for other information included in your annual report does not extend beyond the financial information identified in our opinion on the financial statements. We have no responsibility for determining whether such other information is properly stated and do not have an obligation to perform any procedures to corroborate other information contained in your annual report. We are required by professional standards to read the other information included in your annual report and consider whether a material inconsistency exists between the other information and the financial statements because the credibility of the financial statements and our auditors’ report thereon may be undermined by material inconsistencies between the audited financial statements and other information. If, based on the work performed, we conclude that an uncorrected material misstatement of the other information exists, we are required to describe it in our report.Our auditors’ report on the financial statements includes a separate section, “Other Information,” which states we do not express an opinion or any form of assurance on the other information included in the annual report.We did not identify any material inconsistencies between the other information and the audited financial statements. * * * This communication is intended solely for the information and use of the honorable mayor, members of the city council,and management of City of Lakeville and is not intended to be,and should not be,used by anyone other than these specified parties. CliftonLarsonAllen LLP Minneapolis, Minnesota September 30, 2025 Page 617 of 899 CLA (CliftonLarsonAllen LLP) is an independent network member of CLA Global. See CLAglobal.com/disclaimer. CliftonLarsonAllen LLP CLAconnect.com INDEPENDENT AUDITORS’ REPORT ON INTERNAL CONTROL OVER FINANCIAL REPORTING AND ON COMPLIANCE AND OTHER MATTERS BASED ON AN AUDIT OF FINANCIAL STATEMENTS PERFORMED IN ACCORDANCE WITH GOVERNMENT AUDITING STANDARDS Honorable Mayor and the City Council City of Lakeville Lakeville, Minnesota We have audited, in accordance with the auditing standards generally accepted in the United States of America and the standards applicable to financial audits contained in Government Auditing Standards issued by the Comptroller General of the United States,the financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of City of Lakeville, as of and for the year ended December 31, 2024, and the related notes to the financial statements, which collectively comprise the City of Lakeville’s basic financial statements, and have issued our report thereon dated September 30, 2025. Report on Internal Control Over Financial Reporting In planning and performing our audit of the financial statements, we considered City of Lakeville’s internal control over financial reporting (internal control) as a basis for designing audit procedures that are appropriate in the circumstances for the purpose of expressing our opinions on the financial statements, but not for the purpose of expressing an opinion on the effectiveness of City of Lakeville’s internal control. Accordingly, we do not express an opinion on the effectiveness of City of Lakeville’s internal control. A deficiency in internal control exists when the design or operation of a control does not allow management or employees, in the normal course of performing their assigned functions, to prevent, or detect and correct, misstatements on a timely basis. A material weakness is a deficiency, or a combination of deficiencies, in internal control,such that there is a reasonable possibility that a material misstatement of the entity’s financial statements will not be prevented, or detected and corrected, on a timely basis. A significant deficiency is a deficiency, or a combination of deficiencies, in internal control that is less severe than a material weakness, yet important enough to merit attention by those charged with governance. Our consideration of internal control was for the limited purpose described in the first paragraph of this section and was not designed to identify all deficiencies in internal control that might be material weaknesses or significant deficiencies. Given these limitations, during our audit we did not identify any deficiencies in internal control that we consider to be material weaknesses. However, material weaknesses or significant deficiencies may exist that were not identified. Page 618 of 899 Honorable Mayor and the City Council City of Lakeville Report on Compliance and Other Matters As part of obtaining reasonable assurance about whether City of Lakeville’s financial statements are free from material misstatement, we performed tests of its compliance with certain provisions of laws, regulations, contracts, and grant agreements, noncompliance with which could have a direct and material effect on the financial statements. However, providing an opinion on compliance with those provisions was not an objective of our audit, and accordingly, we do not express such an opinion. The results of our tests disclosed no instances of noncompliance or other matters that are required to be reported under Government Auditing Standards. Purpose of This Report The purpose of this report is solely to describe the scope of our testing of internal control and compliance and the results of that testing, and not to provide an opinion on the effectiveness of the entity’s internal control or on compliance. This report is an integral part of an audit performed in accordance with Government Auditing Standards in considering the entity’s internal control and compliance. Accordingly, this communication is not suitable for any other purpose. CliftonLarsonAllen LLP Minneapolis, Minnesota September 30, 2025 Page 619 of 899 CLA (CliftonLarsonAllen LLP) is an independent network member of CLA Global. See CLAglobal.com/disclaimer. CliftonLarsonAllen LLP CLAconnect.com INDEPENDENT AUDITORS’ REPORT ON MINNESOTA LEGAL COMPLIANCE Members of the City Council City of Lakeville Lakeville, Minnesota We have audited, in accordance with auditing standards generally accepted in the United States of America and the standards applicable to financial audits contained in Government Auditing Standards, issued by the Comptroller General of the United States,the financial statements of the governmental activities, the business-type activities, each major fund, and the aggregate remaining fund information of the City of Lakeville as of and for the year ended December 31, 2024, and the related notes to the financial statements, which collectively comprise the City’s basic financial statements, and have issued our report thereon dated September 30, 2025. In connection with our audit, nothing came to our attention that caused us to believe that the City of Lakeville failed to comply with the provisions of the contracting –bid laws, depositories of public funds and public investments, conflicts of interest, public indebtedness, claims and disbursements, miscellaneous provisions, and tax increment financing sections of the Minnesota Legal Compliance Audit Guide for Cities, promulgated by the State Auditor pursuant to Minn. Stat. § 6.65, insofar as they relate to accounting matters.However, our audit was not directed primarily toward obtaining knowledge of such noncompliance. Accordingly, had we performed additional procedures, other matters may have come to our attention regarding the City’s noncompliance with the above referenced provisions, insofar as they relate to accounting matters. The purpose of this report is solely to describe the scope of our testing of compliance and the results of that testing, and not to provide an opinion on compliance. Accordingly, this communication is not suitable for any other purpose. CliftonLarsonAllen LLP Minneapolis, Minnesota September 30, 2025 Page 620 of 899 Date: 10/6/2025 Public Hearing on the application for LFT Club Operations Company, Inc. dba "Life Time" for an On-Sale Intoxicating Liquor License Proposed Action Staff recommends adoption of the following motion: Move to grant an On-Sale Intoxicating Liquor License for LFT Club Operations Company, Inc. at 18425 Dodd Boulevard. Overview Life Time, located at 18425 Dodd Boulevard, has applied for an On-Sale Intoxicating Liquor License to serve alcoholic beverages at their Outdoor Bistro and on their pool deck. The club currently holds a beer & wine license but is looking to upgrade to a full liquor license. The Police Department conducted a background investigation on the corporate offices and found no reason to deny the license requested. Supporting Information None Financial Impact: Budgeted: No Source: Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Ann Orlofsky, City Clerk Page 621 of 899 Date: 10/6/2025 Public Hearing for the Proposed 2026-2030 Capital Improvement Plan and Street Reconstruction Plan and the Intent to Issue General Obligation Street Reconstruction Bonds and General Obligation Capital Improvement Bonds Proposed Action Staff recommends adoption of the following motions: 1. Move to approve the Resolution Adopting the 5-Year Capital Improvement Plan (2026- 2030) and Approving the Issuance of General Obligation Capital Improvement Bonds; 2. Move to approve the Resolution Adopting the 5-Year Street Reconstruction Plan (2026- 2030) and Approving the Issuance of General Obligation Street Reconstruction Bonds; 3. Move to approve the Resolution Declaring the Official Intent of the City of Lakeville to Reimburse Certain Expenditures from the Proceeds of Bonds to be Issued by the City. Overview Conduct a public hearing for the proposed 2026-2030 Capital Improvement Plan (CIP) and Street Reconstruction Plan and the intent to issue general obligation street reconstruction bonds and general obligation capital improvement bonds. Approval of these motions will result in adoption of the 2026-2030 CIP and Street Reconstruction Plan and provide the City the flexibility to issue bonds for the projects listed in the resolution. Approval of the Street Reconstruction Plan requires a 2/3 vote of the council members present. The Capital Improvement Plan (CIP) for 2026-2030 provides the financial framework for our community’s infrastructure improvements for the next five years. The CIP was discussed at the August 25, 2025 work session. Changes have been made to the CIP document since August 25 following collaboration with the County and additional staff reviews. The changes include the following: 1) Addition of project 27-11 (CSAH 9 and Glacier Way Traffic Signal), which is planned for 2027 construction. 2) Delay project 24-05 (Future CSAH 9 and Bridge at North Creek) from 2030 to 2031. Updated costs to match latest County CIP. 3) Removed County advance funding on project 26-04 (CSAH 9 Extension) because County denied City’s advance funding request. 4) Addition of storm sewer and sanitary sewer costs on CP22-16, CP26-09 and CP25-11. 5) Additional equipment costs for Police and Fire in 2026, and Liquor in 2027. 6) Removal of Heritage Liquor store door replacement project. Page 622 of 899 7) Advance construction of project 28-05 (CSAH 60 and Orchard Trail Traffic Signal) from 2028 to 2027. Now County-led, so only the City’s cost share is included in CIP. 8) Delay project 25-05 (Holyoke/Highview Ave Reconstruction) by two years (now planned for 2029 construction). 9) Trail Improvement Fund and Park Improvement Fund were combined into one Park and Trail Improvement Fund, with funding sources updated accordingly. 10) Move project 31-05 (CSAH 50 and Iberia Ave Traffic Safety Management) construction from 2029 to 2031. 11) Minor changes in timing and costs for the following joint City/County projects to match the latest County CIP: a. 27-05 CSAH 5 and Kenyon Ave Traffic Signal b. 29-07 (formerly 27-07) CSAH 23 Alignment Study (Griffon Tr- 135th St) c. 27-08 CSAH 70 Intersection Improvements W. of Keokuk Ave d. 28-06 CSAH 46 and Foliage Ave Traffic Signal replacement e. 28-07 CSAH 46 and Galaxie Ave Traffic Signal replacement f. 29-04 CSAH 9 Improvements at 194th St and 190th St g. 30-05 CSAH 46 at Lac Lavon/Interlachen Traffic Signal h. 31-09 (formerly 30-06) CSAH 60 and Judicial Road Traffic Signal The Planning Commission reviewed the CIP at their September 18, 2025 meeting. A motion was passed recommending adoption of the CIP by the City Council and finding that the capital improvements identified in the 2026-2030 CIP were consistent with the Comprehensive Plan. A copy of the Planning Commission meeting minutes is attached to this report. The Internal Revenue Service has issued Treasury Reg. 1.150-2 which provides that proceeds of tax-exempt bonds used to reimburse prior expenditures will not be deemed spent unless certain requirements are met. To meet these requirements, the City should annually declare its intent to bond for certain projects. The resolution includes projects that may use bonds as a funding source. An estimate for bonding for water facility and infrastructure improvements and equipment acquisition is included in the resolution. Approval of the declaration of intent to bond resolution does not approve the sale of bonds or the projects. This declaration does not obligate the City to issue bonds for the projects either. As staff proceeds with the 2026 projects, the actual numbers may vary from what was included in the CIP document. The CIP document reflects the best estimate of the project costs at the time of preparation. In addition, some changes in scope may occur. For purposes of transparency, these changes will be communicated with the City Council prior to feasibility reports being accepted and contracts awarded. Supporting Information 1. Resolution CIP Attachment 1-Capital Improvement Plan 2026-2030 2. Resolution CIP Attachment 2-Street Reconstruction Plan 2026-2030 3. Resolution CIP Attachment 3-Declaration of Intent to Bond Page 623 of 899 4. Capital Improvement Plan 2026-2030 5. CIP- Draft Planning Commission meeting minutes Financial Impact: $ 325 million Budgeted: Yes Source: Various Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Julie Stahl, Finance Director Page 624 of 899 CITY OF LAKEVILLE RESOLUTION NO. ____ Resolution Adopting the 5-Year Capital Improvement Plan (2026-2030) and Approving the Issuance of General Obligation Capital Improvement Bonds WHEREAS, The purpose of the Capital Improvement Plan (CIP) is to protect the infrastructure and capital assets of the City of Lakeville by establishing a replacement plan for existing infrastructure and capital assets and by identifying those improvements necessary to accommodate the growth of the community; and WHEREAS, The CIP is a flexible planning document that attempts to balance the financial resources of the City with its needs; and WHEREAS, The CIP covers a five-year period of 2026-2030; sets forth the estimated schedule, timing, and details of specific capital improvements by year, together with the estimated costs, the need for the improvements, and sources of revenue to pay for the improvements; and WHEREAS, On September 18, 2025, the Lakeville Planning Commission reviewed the CIP and passed a motion recommending adoption of the CIP by the City Council and finding that the capital improvements identified in the 2026-2030 CIP were consistent with the Comprehensive Plan; and WHEREAS, During the course of the preparation and review of the Capital Improvement Plan, the Council has considered, for each capital improvement: the condition of the City’s existing infrastructure, including the projected need for repair or replacement; the likely demand for the improvements; the estimated cost of the improvements; the available public resources; the relative benefits and costs of alternative uses of the funds; operating costs of the proposed improvements; and WHEREAS, On October 6, 2025, the Lakeville City Council conducted a Public Hearing on the 2026-2030 CIP and offered opportunity for public testimony on the capital spending priorities of the City Council. NOW THEREFORE, BE IT RESOLVED by the City Council of the City of Lakeville Minnesota as follows: 1. The recitals set forth above are incorporated herein. 2. The 2026-2030 Capital Improvement Plan is hereby adopted. 3. AUTHORIZATION OF BONDS. The City hereby gives preliminary approval to the issuance of bonds in the approximate principal amount of $108.92 million, the proceeds of which will be used, together with additional funds of the City to finance costs of various Capital Improvement Plan Projects and to pay costs of issuance of the Bonds. The City staff is hereby authorized, in consultation with the City's financial advisor and legal counsel, to take all necessary action to call for the sale of the Bonds and to present proposals to this Council for approval at a subsequent meeting. 4. VOTER REFERENDUM CONTINGENCY. Pursuant to State Statute 475.521, if a petition requesting a vote on the question of issuing the Capital Improvement Bonds, Page 625 of 899 signed by voters equal to five percent of the votes cast in the last municipal general election, is filed within thirty days of the public hearing, the City may issue the Capital Improvement Bonds only after obtaining the approval of a majority of the voters voting on the question of the issuance of the Capital Improvement Bonds. The authorizations and approvals contained herein are subject to and contingent upon not receiving such a petition, or, in the event such a petition is filed, the approving vote of a majority of the voters voting on the question of the issuance of the Capital Improvement Bonds. ADOPTED by the Lakeville City Council this 6th day of October 2025. ______________________________ Luke M. Hellier, Mayor _________________________________ Ann Orlofsky, City Clerk VOTE Hellier Bermel Lee Volk Wolter Aye ☐ ☐ ☐ ☐ ☐ Nay ☐ ☐ ☐ ☐ ☐ Abstain ☐ ☐ ☐ ☐ ☐ Absent ☐ ☐ ☐ ☐ ☐ Page 626 of 899 CITY OF LAKEVILLE RESOLUTION NO. ____ Resolution Adopting a 5-Year Street Reconstruction Plan (2026-2030) and Approving the Issuance of General Obligation Street Reconstruction Bonds WHEREAS, pursuant to Minnesota Statutes, Section 475.58, subd. 3b (the "Street Reconstruction Act"), the City has prepared a 2026-2030 street reconstruction plan dated October 6, 2025 (the "Street Reconstruction Plan") which sets forth various street reconstruction plan projects to be undertaken in the City within the next five years (the "Street Reconstruction Plan Projects"). The Street Reconstruction Plan recommends the issuance of general obligation street reconstruction bonds under the Street Reconstruction Act in the approximate principal amount of $29.463 million (the "Street Reconstruction Bonds") to finance a portion of the costs of the Street Reconstruction Plan Projects; and WHEREAS, pursuant to the Street Reconstruction Act, the City is authorized to issue and sell obligations for street reconstruction under the circumstances and within the limitations set forth in the Street Reconstruction Act. The Street Reconstruction Act provides that a street reconstruction plan may be financed with bonds issued by the City, following a public hearing and the adoption of such plan, and other proceedings conducted in accordance with the requirements of the Street Reconstruction Act; and WHEREAS, on October 6, 2025 the City Council held a public hearing on the adoption of the Street Reconstruction Plan and the issuance of the Bonds after publication of the notice of public hearing for the Street Reconstruction Plan not less than 10 days nor more than 28 days prior to the date thereof in the City's official newspaper; and WHEREAS, all parties who appeared at the hearing were given an opportunity to express their views with respect to the proposal to adopt the Street Reconstruction Plan and to undertake and finance a portion of the Street Reconstruction Plan Projects with Street Reconstruction Bonds and any written comments submitted prior to the hearing were considered. NOW THEREFORE, BE IT RESOLVED by the City Council of the City of Lakeville Minnesota as follows: 1. CITY POLICIES AND GOALS. The financing of the Street Reconstruction Plan Projects and the issuance of the Street Reconstruction Bonds will further the policies and goals of the City as set forth in the Street Reconstruction Plan. 2. ADOPTION OF STREET RECONSTRUCTION PLAN. Based on information received at the public hearing, such written comments (if any) and such other facts and circumstances as the City Council deems relevant, it is hereby found, determined and declared that: (a) the Street Reconstruction Plan Projects proposed in the Street Reconstruction Plan will allow the City to construct and finance various street reconstruction projects; Page 627 of 899 (b) the Street Reconstruction Plan is hereby approved and adopted in the forms presently on file with the City. 3. AUTHORIZATION OF BONDS. The City hereby gives preliminary approval to the issuance of the Bonds, the proceeds of which will be used, together with additional funds of the City to finance costs of various Street Reconstruction Plan Projects and to pay costs of issuance of the Bonds. The City staff is hereby authorized, in consultation with the City's financial advisor and legal counsel, to take all necessary action to call for the sale of the Bonds and to present proposals to this Council for approval at a subsequent meeting. 4. VOTER REFERENDUM CONTINGENCY. Pursuant to the Street Reconstruction Act, if a petition requesting a vote on the question of issuing the Street Reconstruction Bonds, signed by voters equal to five percent of the votes cast in the last municipal general election, is filed within thirty days of the public hearing, the City may issue the Street Reconstruction Bonds only after obtaining the approval of a majority of the voters voting on the question of the issuance of the Street Reconstruction Bonds. The authorizations and approvals contained herein are subject to and contingent upon not receiving such a petition, or, in the event such a petition is filed, the approving vote of a majority of the voters voting on the question of the issuance of the Street Reconstruction Bonds. ADOPTED by the Lakeville City Council this 6th day of October 2025. CITY OF LAKEVILLE ______________________________ Luke M. Hellier, Mayor _________________________________ Ann Orlofsky, City Clerk VOTE Hellier Bermel Lee Volk Wolter Aye ☐ ☐ ☐ ☐ ☐ Nay ☐ ☐ ☐ ☐ ☐ Abstain ☐ ☐ ☐ ☐ ☐ Absent ☐ ☐ ☐ ☐ ☐ Page 628 of 899 CITY OF LAKEVILLE RESOLUTION NO. ____ Resolution Declaring the Official Intent of the City of Lakeville to Reimburse Certain Expenditures from Bond Proceeds WHEREAS, the Internal Revenue Service has issued Treasury Reg. 1.150-2 (the “Reimbursement Regulations”) providing that proceeds of tax-exempt bonds used to reimburse prior expenditures will not be deemed spent unless certain requirements are met; and WHEREAS, the City expects to incur certain expenditures that may be financed temporarily from sources other than bonds, and later reimbursed from the proceeds of tax-exempt bonds; and WHEREAS, the City has determined to make this declaration of official intent (“Declaration”) to reimburse certain costs from proceeds of bonds in accordance with the Reimbursement regulations; and WHEREAS, the total estimated general obligation bonds for 2026 is $36.31 Million. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Lakeville, Minnesota as follows: 1. The recitals set forth above are incorporated herein. 2. The City proposes to undertake the projects (the “Projects”) in the table below, and the City reasonably expects to reimburse the expenditures made for certain costs of the Projects from the proceeds of bonds in an estimated maximum principal amount of the following: The projects listed above include only the projects where some bond funding is anticipated in 2026. The amount in the ‘Total estimated bonds in the 2026 column is the anticipated reimbursement amount from 2026 bonds. The total project cost may be higher and may include both project costs funded from sources other than bonds, and/or costs funded by bonds in a year earlier or later than the year shown above. The City may declare other separate statements of reimbursement intent in connection with specific public improvements projects as they are initiated under Minnesota Statutes, Chapters 429 and 444, or for other capital projects, with the understanding that such additional Pr oj ect D escr i pti on Total esti mated bonds i n 2026 26-02: 2026 Str eet Reconstr uction 3,580,000$ 26-03: Collector Roadway Rehabilit iation 485,576 25-11 N ew Fir e Station Constr uct ion 25,000,000 26-09: 215th St Public impr ovements 5,240,000 Land acquisition for fir e station expansion 2,000,000 TOTAL 36,305,576$ Page 629 of 899 declarations of reimbursement intent will supplement this resolution. All reimbursed expenditures will be capital expenditures, costs of issuance of the bonds, or other expenditures eligible for reimbursement under Section 1.150-2(d)(3) of the Reimbursement Regulations. 3. This Declaration has been made no later than 60 days after payment of any original expenditure to be subject to a reimbursement allocation with respect to the proceeds of bonds, except for the following expenditures: a) costs of issuance of bonds; b) costs in an amount not in excess of the lesser of $100,000 or five percent of the proceeds of an issue; or c) “preliminary expenditures” up to an amount not in excess of 20 percent of the aggregate issue price of the issue or issues that are reasonably expected by the City to finance the project for which the preliminary expenditures were incurred. The term “preliminary expenditures” includes architectural, engineering, surveying, bond issuance, and similar costs that are incurred prior to commencement of acquisition, construction or rehabilitation of a project, other than land acquisition, site preparation, and similar costs incident to commencement of construction. 4. This Declaration is an expression of the reasonable expectations of the City based on the facts and circumstances known to the City as the date hereof. The anticipated original expenditures for the Projects and the principal amount of the bonds described in paragraph 3 are consistent with the City’s budgetary and financial circumstances. No sources other than proceeds of bonds to be issued by the City are, or are reasonably expected to be, reserved, allocated on a long-term basis, or otherwise set aside pursuant to the City’s budget or financial policies to pay such Project expenditures. 5. This Declaration is intended to constitute a declaration of the official intent for the purposes of the Reimbursement Regulations. APPROVED this 6th day of October 2025 CITY OF LAKEVILLE By:______________________________ Luke M. Hellier, Mayor ATTEST: _________________________________ Ann Orlofsky, City Clerk VOTE Hellier Bermel Lee Volk Wolter Aye ☐ ☐ ☐ ☐ ☐ Nay ☐ ☐ ☐ ☐ ☐ Abstain ☐ ☐ ☐ ☐ ☐ Absent ☐ ☐ ☐ ☐ ☐ Page 630 of 899 Page 631 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 2 Table of Contents 2026-2030 Capital Improvement Plan Page Introduction/Summary Debt Analysis & Tax Levy Impact 3 5 Cost Type Summary 12 Funding Source Summary 13 Projects & Funding Sources by Cost Type 15 Project Details 20 Street Reconstruction Plan (2026-2030) 119 City Planning/Studies/Project chart 120 Map of Major Projects 121 Page 632 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 3 Introduction The Capital Improvement Plan provides a long-range framework to meet the infrastructure needs and development objectives of our community. It provides policy makers and the community with a strategic (documented) approach to implementation and administration of improvement projects and equipment acquisitions. The Plan identifies the allocation of the City’s financial resources and maximizes the use of non- tax revenues to finance the improvements. Municipal State Aid Street Funds (MSA), connection charges, special assessments and other revenue sources are vital elements to financing City improvements. The use of these revenue sources reduces the reliance on property taxes to finance these improvements. The City should pursue the financing strategy as presented, but future events may require changes in both costs and revenues. The Capital Improvement Plan represents a significant financial, engineering and development undertaking for the City in the years ahead. The Capital Improvement Plan is consistent with the City’s Comprehensive Plan and takes into consideration projects identified in the Dakota County Capital Improvement Plan. Categories Transportation includes all roads, streets, street lights, bridges and traffic signals within the City with the exception of Interstate I-35 and routine maintenance of County roads. Major funding sources include Municipal State Aid Street funds, special assessments and property taxes. Utility infrastructure includes the construction and major maintenance of all water systems such as wells, towers and the water treatment facility. Utilities also include sanitary sewer and storm sewer systems. The primary source of financing for developing new systems is connection charges when property develops or with the issuance of a building permit. Maintenance projects are financed with user fees. The Water Treatment Plant project in 2027 is planned to include a combination of bond funding (principal and interest payments to be repaid with user fees), and fund balance/net assets in the Water Trunk Fund and Water Operating Fund, respectively. Environmental Resources system includes lakes, wetlands, streams, prairies and woodlands. Maintenance project are financed with user fees. Parks system includes regional, community and neighborhood parks as well as trails and recreation facilities such as the Arts Center and Heritage Center. Major resources include park dedication fees collected when property develops, and grants. Maintenance projects are financed with property taxes and other revenue sources. A parks bond referendum was approved in the fall of 2021 and related projects are being constructed between 2022-2026. Page 633 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 4 Facilities include the city hall, police station, fire stations, central maintenance facility and other municipal buildings including the FiRST Center. Primary revenue sources include, but not limited to, property taxes, General Fund, Water Fund, and planned bond proceeds in several years (for the FiRST Center, Fire station renovations, CMF expansion, and Water Treatment plant expansion). Bonds on the CMF expansion are planned to be repaid by property tax levies, and bonds for fire station construction/renovation are planned to be repaid by franchise fees. Equipment includes all major equipment acquisitions and replacement. Primary revenue sources include, but not limited to, Liquor Fund contributions, General Fund, Utility Funds, sale of assets and property taxes. Technology includes all major technology-related equipment acquisitions and replacement. Primary revenue sources include, but not limited to, Liquor Fund, General Fund, Utility Funds, and property taxes. Program Summary The majority of capital investments are in Facilities and Transportation for the next five years.  The total budgeted capital expenditures by category are shown on the Cost Type Summary report.  The projects are financed from diverse revenues sources, as shown on the Funding Source Summary.  The Sources and Uses of Funds Details report includes the estimated revenues and expenditures for tax-levy funded Capital Project Funds for the next 10 years.  Project Details are shown on subsequent pages. Page 634 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 5 Debt Analysis and Tax Impact In reviewing the 2026-2030 Capital Improvement Plan, the City Council should consider the level of debt, the commitment of funds to repay that debt, as well as the annual tax impact associated with the scheduled projects. As of 12/31/2025, the City of Lakeville will have $163,395,000 in debt. The following chart reflects the type of debt that comprises the $163.4M. The 2026-2030 CIP includes projects that are funded by bond proceeds. Bonds are issued for the project costs that the City is funding through tax levies as well as the costs that are specially assessed to property owners. The City anticipates $154,163,000 in bonding for projects in the CIP plan for 2026-2030, including the following-  $29,463,000 for street reconstruction/collector road rehabilitation projects in 2026- 2030  $5,240,000 for public utility improvements in 2026  $17,960,000 for the CMF facility expansion in 2027  $40,000,000 for the bonded portion of a Water Treatment Facility satellite facility in 2027  $61,500,000 in 2026-2028 for fire station construction/remodel projects. Amount 66,155,000$ 11,805,000 55,505,000 3,045,000 4,635,000 550,000 15,245,000 6,405,000 - 50,000 Total remaining principal: 163,395,000 Bond Type Purpose Various capital projects (Central Maintenance Facility, Police Station) Street reconstruction projects GO Capital Improvement GO Street Reconstruction Various capital improvement projects; Includes special assessment-supported debt. Various street improvement projects Holyoke Water Tower, Water Treatment Facility Improvements, Wells 21 and 22 Construction of liquor store (2007) Watermain replacement (in conjunction with street reconstruction projects) Lift station #6 replacement Holyoke Ave Street Lights Arenas projects 2021-2022, Keokuk Liquor Store construction GO Improvement GO State-aid Street Revenue GO Water Revenue HRA Lease Revenue-Liquor Water revenue Sewer revenue Street light revenue Tax Abatement Page 635 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 6 The anticipated bonding amount for 2026 is $36,305,576, which assumes no bonding is needed in 2026 for planned equipment expenditures. The current CIP projections assume no bond funding will be needed for the Municipal State Aid (MSA) projects, which will be dependent on project costs and timing, as well as the ability of Dakota County to provide advance funding on certain MSA projects. Major projects scheduled for 2026, which are planned to be funded with bonds are listed below (note that these amounts also include any bonds which will be repaid by special assessments): Major projects which involve a property tax levy component in 2026 are listed below: Project costs in the CIP may be higher or lower than the tax levy amounts above, due to additional funding sources beyond tax levy, such as fund balance, or other sources (as reflected in the CIP). There are sometimes transfers from General Fund balance reserve into Capital Project Funds to reduce the impact on the tax levy, and such transfers are not reflected in the table above. Project Description Total estimated bonds in 2026 26-02: 2026 Street Reconstruction 3,580,000$ 26-03: Collector Roadway Rehabilitiation 485,576 25-11 New Fire Station Construction 25,000,000 26-09: 215th St Public improvements 5,240,000 Land acquisition for fire station expansion 2,000,000 TOTAL 36,305,576$ Project Description Tax Levy Pavement maintenance project 26-01 (Pavement Management Fund) 2,150,000$ Park & Trail improvements (Park & Trail Improvement Fund) 1,550,000 Equipment purchases (Equipment Fund) 400,000 Facilities maintenance/improvements (Building Fund) 1,000,000 Technology needs (Technology Fund) 250,000 TOTAL 5,350,000$ Page 636 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 7 The following chart reflects the cumulative effect of new debt issued as indicated in the CIP and the retirement of existing debt. The top line is the resulting debt balance at the end of each year. Page 637 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 8 The following charts reflect the cumulative effect of new debt issued as indicated in the proposed CIP and the retirement of existing debt on a per capita basis, and on a per household basis, respectively. Page 638 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 9 6,067 9,034 5,894 5,019 25,000 25,500 26,000 26,500 27,000 27,500 28,000 28,500 29,000 29,500 30,000 30,500$0$1,000$2,000$3,000$4,000$5,000$6,000$7,000$8,000$9,000$10,0002025 2026 2027 2028 2029 2030 2031 2032 2033 2034 2035HouseholdsDebt/HouseholdDebt Per HouseholdDebt/HouseholdHouseholdsPage 639 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 10 The impact of the 2026-2030 CIP and other anticipated bond payment adjustments on the debt service property tax levy are reflected in the following table: Each year, certain bond issues mature and the corresponding debt service payments are eliminated. As noted in the CIP, the City initiated a Pavement Management Program starting in 2009, which increased the scope of the annual street reconstruction projects, which in turn has increased the amount of debt related to such street reconstruction projects. The amount of debt service dropping off each year as payments are made is less than the amount that we are adding for new CIP projects. This results in an increase in the debt service property tax levy. The proposed CIP projects will impact the debt service beginning in 2027. The anticipated bond payments on debt issued in conjunction with these new projects will result in an increased debt service levy of approximately $527,000 for 2027, $2,883,000 for 2028, $3,638,000 for 2029, and $4,413,000 for 2030. The $154.2M of bonding for projects in the 2026-2030 CIP will require significant bond payments beginning in 2027 from the following sources: tax levy, special assessments, franchise fee revenues, and Water Trunk Fund and Water Operating Fund. The estimated annual payments by source are shown in the table and chart below. Projected Change in Debt Levy 2026 2027 2028 2029 2030 Total 2026- 2030 12,897,737 12,312,400 11,342,037 9,907,379 58,605,343 Change from: Existing Debt - 751,948 (585,337) (970,363) (1,434,658) (2,238,410) One-time Adjustments - - - - - - New CIP: Street projects - 527,000 1,442,000 2,197,000 2,972,000 7,138,000 Equipment - - - - - - Facilities - - 1,441,157 1,441,157 1,441,157 4,323,471 Parks - - - - - - Change from New CIP: - 527,000 2,883,157 3,638,157 4,413,157 11,461,471 Total Change - 1,278,948 2,297,820 2,667,794 2,978,499 9,223,061 Revised Debt Levy 12,145,789 13,424,737 15,195,557 14,980,194 14,320,536 67,828,404 % Change in Debt Levy 11% 13% -1% -4% Page 640 of 899 City of Lakeville 2026-2030 Capital Improvement Plan- Page 11 *Each year reflects a cumulative total of the funding that would be needed from each of the sources for that year (for example, the obligations shown in 2028 include the change from new CIP debt in 2026 as well as 2027). Impact of the Capital Improvement Plan on the Operating Budget The City’s Operating Budget is affected by the Capital Improvement Plan. Capital improvements typically result in ongoing expenses for routine operation, repair and maintenance upon completion or acquisition. Existing City facilities and equipment will eventually require rehabilitation, renovation or upgrades to accommodate new uses or address needed improvements. Older facilities usually involve higher maintenance and repair costs as well. Capital improvements make a positive contribution to the economic vitality, quality of life and fiscal well-being of our community in spite of potential recurring operating costs. Capital projects such as the redevelopment of under-performing or under-used areas of the City, and the infrastructure expansion needed to support new development, help promote the economic development and growth that generates additional operating revenues. These new revenue sources provide the funding needed to maintain, improve and expand the City’s infrastructure. Additional considerations Dakota County staff continue to prepare the Dakota County’s draft 2026-2030 Transportation, Transportation Sales & Use Tax, and Regional Rail Authority Capital Improvement Program. City and County staff continue to coordinate efforts to create CIPs that align with both local and regional transportation needs. Funding of New Debt from CIP (Cumulative Payments by Year) 2027 2028 2029 2030 2031 Tax Levy 527,000 2,883,157 3,638,157 4,413,157 5,037,157 Special Assessments 678,604 721,340 837,895 898,074 898,074 Franchise Fees 2,166,550 3,771,402 4,934,919 4,934,919 4,934,919 Water Funds - 3,209,703 3,209,703 3,209,703 3,209,703 3,372,154 10,585,602 12,620,674 13,455,853 14,079,853 * Page 641 of 899 2026 through 2030 Capital Improvement Plan Lakeville, MNCost Type Summary Cost Type 2026 2027 2028 2029 2030 Total Environmental Resources 1,602,500 1,601,500 1,601,500 1,601,500 1,501,500 7,908,500 Equipment 3,955,358 3,702,407 5,033,350 4,515,312 4,789,749 21,996,176 Facilities 40,871,256 80,100,000 23,667,800 4,374,400 660,199 149,673,655 Parks 7,160,050 4,561,500 2,898,500 3,692,000 3,109,000 21,421,050 Technology 364,663 602,525 743,368 244,994 305,319 2,260,869 Transportation 25,431,073 23,600,104 21,742,591 19,502,988 12,242,475 102,519,231 Utility 9,732,000 1,882,000 3,535,000 2,005,000 1,725,000 18,879,000 GRAND TOTAL 89,116,900 116,050,036 59,222,109 35,936,194 24,333,242 324,658,481 Produced Using Plan-It CIP Software Page 12 Page 642 of 899 2026 through 2030 Capital Improvement Plan Lakeville, MNFunding Source Summary Source 2026 2027 2028 2029 2030 TotalProduced Using Plan-It CIP Software Page 13 Page 643 of 899 Source 2026 2027 2028 2029 2030 Total Arenas 3,142 3,303 1,739 1,457 2,075 11,716 Building Fund 2,581,000 540,000 3,432,800 4,194,440 289,000 11,037,240 Communications Fund 48,908 68,513 50,000 52,000 77,502 296,923 Dakota County 5,424,313 9,120,800 5,228,161 354,250 2,458,000 22,585,524 Dakota County- Advance funding of city share -2,247,485 -438,190 431,867 -840,263 -3,094,071 Donations 60,000 60,000 Environmental Resources Fund 1,441,070 1,349,010 1,352,383 1,340,000 1,343,848 6,826,311 Equipment Fund 3,138,092 3,411,922 4,868,298 4,015,469 4,269,507 19,703,288 Escrows 362,029 196,000 657,600 1,215,629 FiRST Center Operating Fund 25,000 100,000 125,000 General Fund 209,960 250,925 151,500 209,834 265,005 1,087,224 G.O. Improvement Bonds- Franchise Fees (Facilities)27,000,000 20,000,000 20,000,000 67,000,000 G.O. Improvement Bonds - Sp. Assess.5,240,000 330,000 900,000 464,689 6,934,689 G.O. Improvement Bonds- Taxes (Facilities)6,457,256 17,960,000 24,417,256 G.O. Improvement Bonds - Taxes (Streets)4,065,576 7,063,209 5,833,578 5,985,799 4,820,600 27,768,762 Lakeville Baseball Association 150,000 150,000 Liquor Fund 176,340 203,561 194,206 0 414,305 988,412 MSA/MSA Bonds - Sp. Assess.350,000 350,000 Municipal State Aid 3,631,593 2,784,756 5,007,985 5,955,163 601,875 17,981,372 Other cost share arrangement- Credit River (Judicial Rd)485,576 485,576 Other funding- Federal 750,000 750,000 Other funding- State 9,047,000 9,047,000 Park Bonds Fund 556,220 556,220 Park Dedication Fund 4,405,080 1,397,500 1,553,000 3,675,750 2,257,000 13,288,330 Park & Trail Improvement Fund 2,208,750 3,211,500 1,535,500 1,477,000 1,284,000 9,716,750 Pavement Management Fund 2,609,500 2,672,500 2,650,000 2,720,000 2,790,000 13,442,000 Sanitary Sewer Operating Fund 1,589,577 1,321,712 1,219,293 1,495,705 1,240,670 6,866,957 Sanitary Sewer Trunk Fund 1,730,000 125,000 85,000 75,000 75,000 2,090,000 Stormwater Infrastructure Fund 755,000 455,000 340,000 1,240,000 105,000 2,895,000 Streetlight Operating Fund 30,000 10,000 50,000 90,000 Technology Fund 273,204 375,774 536,506 241,637 234,185 1,661,306 Vermillion River Watershed JPO 10,000 10,000 10,000 10,000 10,000 50,000 Water Operating Fund 2,897,228 6,846,212 1,419,293 1,945,664 1,380,670 14,489,067 Water Revenue Bonds 40,000,000 40,000,000 Water Trunk Fund 4,515,000 -3,635,000 2,225,000 265,000 415,000 3,785,000 GRAND TOTAL 89,116,900 116,050,036 59,222,109 35,936,194 24,333,242 324,658,481 Produced Using Plan-It CIP Software Page 14 Page 644 of 899 2026 through 2030 Projects & Funding Sources by Cost type Lakeville, MNProjects & Funding Sources By Cost Type Cost Type Project #2026 2027 2028 2029 2030 Total Environmental Resources East Lake Rough Fish Barrier 23-58 35,000 35,000 35,000 35,000 35,000 175,000 Water Quality and Water Conservation ER-01 85,000 85,000 85,000 85,000 85,000 425,000 Lake Management ER-02 110,000 110,000 110,000 110,000 110,000 550,000 Stormwater Infrastructure Maintenance ER-03 960,000 960,000 960,000 960,000 960,000 4,800,000 Storm Water Conveyance System Expansion ER-04 100,000 100,000 100,000 100,000 400,000 Forestry (Ash tree injection/removal, reforestatio ER-05 142,500 141,500 141,500 141,500 141,500 708,500 Vegetation Management - City Outlots/Public land ER-06 170,000 170,000 170,000 170,000 170,000 850,000 Environmental Resources Total 1,602,500 1,601,500 1,601,500 1,601,500 1,501,500 7,908,500 Dakota County 10,000 10,000 10,000 10,000 10,000 50,000 Environmental Resources Fund 1,340,000 1,340,000 1,340,000 1,340,000 1,340,000 6,700,000 General Fund 142,500 141,500 141,500 141,500 141,500 708,500 Stormwater Infrastructure Fund 100,000 100,000 100,000 100,000 400,000 Vermillion River Watershed JPO 10,000 10,000 10,000 10,000 10,000 50,000 Source Grand Total 1,602,500 1,601,500 1,601,500 1,601,500 1,501,500 7,908,500 Equipment Police-Equipment E-01 709,000 1,299,733 1,349,714 1,840,807 458,098 5,657,352 Fire - Equipment E-02 562,944 212,524 1,079,564 172,500 1,537,900 3,565,432 Streets-Equipment E-03 1,284,473 1,152,130 1,663,200 1,593,122 1,649,899 7,342,824 Park Maintenance-Equipment E-04 572,405 702,514 775,820 409,040 623,610 3,083,389 Facilities - Equipment E-05 9,270 45,021 54,291 Inspections-Equipment E-06 37,000 48,186 85,186 Construction Services-Equipment E-07 67,460 69,425 31,334 75,319 243,538 Liquor-Equipment E-08 34,880 34,880 Communications PEG-Equipment E-10 45,000 60,000 40,000 52,000 72,654 269,654 Environmental Resources - Equipment E-11 100,000 100,000 Utilities-Equipment E-12 604,806 126,180 125,052 379,509 324,083 1,559,630 Equipment Total 3,955,358 3,702,407 5,033,350 4,515,312 4,789,749 21,996,176 Communications Fund 45,000 60,000 40,000 52,000 72,654 269,654 Environmental Resources Fund 100,000 100,000 Equipment Fund 3,138,092 3,411,922 4,868,298 4,015,469 4,269,507 19,703,288 General Fund 67,460 69,425 68,334 123,505 328,724 Liquor Fund 34,880 34,880 Sanitary Sewer Operating Fund 477,078 63,090 62,526 189,755 162,041 954,490 Water Operating Fund 127,728 63,090 62,526 189,754 162,042 605,140 Source Grand Total 3,955,358 3,702,407 5,033,350 4,515,312 4,789,749 21,996,176 Facilities Fire Station #5 Construction 25-11 25,250,000 25,250,000 First Center- Construction 25-12 6,457,256 6,457,256 City Hall Building Maintenance/Improvements B-01 135,000 207,051 70,000 412,051 Produced Using Plan-It CIP Software Page 15 Page 645 of 899 CMF Building Maintenance/Improvements B-02 1,601,000 17,160,000 300,000 3,147,704 22,208,704 Police Station- Building Maintenance/Improvements B-03 325,000 2,600,000 60,885 25,000 3,010,885 Heritage Center- Maintenance/Improvements B-04 470,000 108,000 96,160 40,000 714,160 Arts Center-Maintenance/Improvements B-05 185,000 545,000 150,000 125,000 1,005,000 Fine Arts Building- Maintenance/Improvements B-06 570,000 570,000 Fire Station #1-Building Maintenance/Improvements B-07 60,000 20,424,800 285,140 22,000 20,791,940 Fire Station #2 Building Maintenance/Improvements B-08 0 0 Fire Station #3-Building Maintenance/Improvements B-09 2,000,000 20,000,000 122,800 7,000 22,129,800 Fire Station #4-Building Maintenance/Improvements B-10 30,000 124,700 154,700 Keokuk Liquor Store- Maintenance/Improv B-12 23,000 23,000 Heritage Liquor Store- Maintenance/Improv B-13 0 65,000 8,000 73,000 Kenrick Liquor Store- Maintenance/Improv B-14 40,000 31,629 71,629 Galaxie Liquor Store- Maintenance/Improv B-15 45,000 331,570 376,570 Water Treatment Facilty- Maintenance/Improvements B-16 4,450,000 41,500,000 170,000 179,960 46,299,960 FiRST Center Facility Maintenance/Improvements B-17 25,000 100,000 125,000 Facilities Total 40,871,256 80,100,000 23,667,800 4,374,400 660,199 149,673,655 Building Fund 2,581,000 540,000 3,432,800 4,194,440 289,000 11,037,240 FiRST Center Operating Fund 25,000 100,000 125,000 G.O. Improvement Bonds- Franchise Fees (Facilities)27,000,000 20,000,000 20,000,000 67,000,000 G.O. Improvement Bonds- Taxes (Facilities)6,457,256 17,960,000 24,417,256 Liquor Fund 108,000 65,000 371,199 544,199 Sanitary Sewer Trunk Fund 100,000 100,000 Stormwater Infrastructure Fund 150,000 150,000 Water Operating Fund 450,000 5,500,000 170,000 179,960 6,299,960 Water Revenue Bonds 40,000,000 40,000,000 Water Trunk Fund 4,000,000 -4,000,000 0 Source Grand Total 40,871,256 80,100,000 23,667,800 4,374,400 660,199 149,673,655 Parks Klamath Trail Retaining Wall 23-13 10,000 1,500,000 1,510,000 Grand Prairie Park 24-20 950,000 950,000 East Community Park Phase II 25-20 2,775,000 2,775,000 Parks Major Maintenance - General P-01 18,250 18,500 19,500 19,500 19,750 95,500 Park Development - Adminstrative Projects P-02 35,000 20,000 20,000 20,000 20,000 115,000 Park Development - Developer Credits P-03 435,000 435,000 435,000 435,000 435,000 2,175,000 Future Park Land Acquisition P-04 100,000 100,000 100,000 300,000 Trail Improvements (Various Trails)P-05 890,000 530,000 708,000 710,000 710,000 3,548,000 Park Improvements (Various Parks)P-06 277,000 694,000 164,000 142,000 112,000 1,389,000 Playground Replacement P-08 513,000 315,000 543,000 372,000 381,000 2,124,000 Park parking lot improvements P-09 75,000 210,000 113,000 55,000 45,000 498,000 Keokuk Avenue/172nd St. Park P-11 65,000 770,000 835,000 Grand Prairie Skatepark P-12 50,000 600,000 650,000 Cost Type Project #2026 2027 2028 2029 2030 Total Produced Using Plan-It CIP Software Page 16 Page 646 of 899 Ritter Meadows Park P-13 58,000 770,000 828,000 Voyageur Park P-14 35,000 720,000 755,000 Parks Major Maintenance - Open Space P-15 27,000 27,000 27,000 27,000 28,000 136,000 Parks Major Maintenance - Fields P-16 31,500 37,000 39,000 39,000 12,000 158,500 Parks Major Maintenance - Bldgs/Shelters/Grounds P-17 60,000 0 0 500 24,850 85,350 Other Projects P-19 300,000 25,000 600,000 325,000 325,000 1,575,000 Parks Major Maintenance - Courts P-20 7,000 30,000 22,000 12,000 51,400 122,400 Kenrick Trail Sheet Pile, Wall, & Trail Repairs P-21 275,000 275,000 192nd St Retaining Wall & Trail Reconstruction P-22 55,000 55,000 Parks System Master Plan P-23 91,300 91,300 Parks - New Parking Lots & Expansions P-24 300,000 300,000 S.W. Corner of 210th Street & I-35 P-25 75,000 75,000 Parks Total 7,160,050 4,561,500 2,898,500 3,692,000 3,109,000 21,421,050 Dakota County 570,000 570,000 Donations 60,000 60,000 Lakeville Baseball Association 150,000 150,000 Park Bonds Fund 556,220 556,220 Park Dedication Fund 3,765,080 1,200,000 1,363,000 2,415,000 1,825,000 10,568,080 Park & Trail Improvement Fund 2,208,750 3,211,500 1,535,500 1,277,000 1,284,000 9,516,750 Source Grand Total 7,160,050 4,561,500 2,898,500 3,692,000 3,109,000 21,421,050 Technology Technology - General Government T-01 18,109 42,709 8,592 11,613 36,783 117,806 Technology-Public Safety T-02 167,489 71,335 123,022 199,705 41,561 603,112 Technology-Public Works T-03 24,044 8,451 6,084 20,109 13,579 72,267 Technology-Arenas T-04 3,142 3,303 1,739 1,457 2,075 11,716 Technology-Communications T-05 2,597 2,513 0 0 848 5,958 Technology-Liquor T-06 58,545 121,681 55,206 17,106 252,538 Technology-Environmental Resources T-07 4,010 4,383 848 9,241 Technology-Utilities T-08 8,912 8,244 7,534 1,900 1,257 27,847 Technology- Parks & recreation T-09 12,915 7,169 19,558 10,210 5,120 54,972 Technology-Network infrastructure T-10 63,760 217,067 511,786 0 186,142 978,755 Technology-Miscellaneous T-11 5,150 116,043 5,464 126,657 Technology Total 364,663 602,525 743,368 244,994 305,319 2,260,869 Arenas 3,142 3,303 1,739 1,457 2,075 11,716 Communications Fund 3,908 8,513 10,000 0 4,848 27,269 Environmental Resources Fund 1,070 9,010 12,383 0 3,848 26,311 Liquor Fund 68,340 168,681 129,206 0 43,106 409,333 Sanitary Sewer Operating Fund 7,499 18,622 26,767 950 8,629 62,467 Technology Fund 273,204 375,774 536,506 241,637 234,185 1,661,306 Water Operating Fund 7,500 18,622 26,767 950 8,628 62,467 Source Grand Total 364,663 602,525 743,368 244,994 305,319 2,260,869 Transportation Freight Rail Car Storage Facility 22-16 8,200,000 8,200,000 Future CSAH 9/CSAH 31 Traffic Signal System 23-08 0 0 0 185th St/Future CSAH 60 (Dodd Blvd - Highview Ave)24-04 0 0 CSAH 60/185th Street (Kenwood Tr- Ipava Ave)25-04 0 0 0 0 Cost Type Project #2026 2027 2028 2029 2030 Total Produced Using Plan-It CIP Software Page 17 Page 647 of 899 Holyoke/Highview Avenue Reconstruction 25-05 1,955,000 6,905,000 8,860,000 CSAH 9 Extension (to CSAH Standards)25-19 500,000 500,000 CSAH 9 Modernization (210th St - CSAH 50)26-04 1,991,250 9,604,300 11,595,550 Interstate 35/CSAH 50 Interchange Reconstruction 26-05 840,263 4,017,763 0 4,858,026 CSAH 50 and Hamburg Avenue RAB 26-06 30,000 30,000 CSAH 60 Alignment Study (CSAH 23 - Flagstaff Ave)26-07 94,500 94,500 CSAH 50/CSAH 60 RAB Modifications 26-08 1 1 Lake Marion Greenway 26-15 4,580,000 67,500 150,000 405,000 2,880,000 8,082,500 CSAH 5 and Kenyon Avenue Traffic Signal 27-05 405,000 405,000 CSAH 31 and CSAH 46 Traffic Signal 27-06 1 1 CSAH 60 and Orchard Trail Traffic Signal 27-07 80,156 396,000 476,156 CSAH 23 M&O (CSAH 9 to CSAH 42)27-09 1 1 CSAH 9 and Glacier Way Traffic Signal 27-11 213,751 880,000 1,093,751 CSAH 9/Dodd Blvd Modernization (215th St-210th St)28-04 650,000 750,000 4,400,000 5,800,000 CSAH 46 and Foliage Avenue Traffic Signal 28-06 7,031 253,125 260,156 CSAH 46 and Galaxie Avenue Traffic Signal 28-07 14,062 253,125 267,187 CSAH 9 Improvements at 194th St & 190th St 29-04 168,000 75,938 1,701,000 1,944,938 CSAH 23 Alignment Study (Griffon Tr - 135th St)29-05 31,500 31,500 CSAH 46 and Lac Lavon/Interlachen Traffic Signal 30-05 104,062 534,375 638,437 CSAH 50 and Iberia Avenue Traffic Safety Mgmt 31-05 140,000 67,500 207,500 CSAH 60 and Judicial Road Traffic Signal 31-09 50,000 50,000 Pavement Management - Maintenance XX-01 2,865,000 2,780,000 2,850,000 2,920,000 2,990,000 14,405,000 Street Reconstruction XX-02 4,405,000 4,507,500 5,515,000 5,145,000 4,835,000 24,407,500 Collector Roadway Rehabilitation XX-03 971,152 3,985,709 2,168,578 2,205,488 935,600 10,266,527 County Pavement Preservation/City Utility Repairs XX-10 10,000 35,000 45,000 Transportation Total 25,431,073 23,600,104 21,742,591 19,502,988 12,242,475 102,519,231 Dakota County 4,844,313 9,110,800 5,218,161 344,250 2,448,000 21,965,524 Dakota County- Advance funding of city share -2,247,485 -438,190 431,867 -840,263 -3,094,071 Escrows 362,029 196,000 657,600 1,215,629 General Fund 40,000 10,000 50,000 G.O. Improvement Bonds - Sp. Assess.330,000 900,000 464,689 1,694,689 G.O. Improvement Bonds - Taxes (Streets)4,065,576 7,063,209 5,833,578 5,985,799 4,820,600 27,768,762 MSA/MSA Bonds - Sp. Assess.350,000 350,000 Municipal State Aid 3,631,593 2,784,756 5,007,985 5,955,163 601,875 17,981,372 Other cost share arrangement- Credit River (Judicial Rd)485,576 485,576 Other funding- Federal 750,000 750,000 Other funding- State 9,047,000 9,047,000 Park Dedication Fund 640,000 197,500 190,000 1,260,750 432,000 2,720,250 Park & Trail Improvement Fund 200,000 200,000 Pavement Management Fund 2,609,500 2,672,500 2,650,000 2,720,000 2,790,000 13,442,000 Sanitary Sewer Operating Fund 355,000 385,000 375,000 520,000 375,000 2,010,000 Sanitary Sewer Trunk Fund 340,000 50,000 10,000 400,000 Stormwater Infrastructure Fund 305,000 355,000 240,000 1,140,000 105,000 2,145,000 Cost Type Project #2026 2027 2028 2029 2030 Total Produced Using Plan-It CIP Software Page 18 Page 648 of 899 Streetlight Operating Fund 30,000 10,000 50,000 90,000 Water Operating Fund 575,000 677,500 670,000 695,000 670,000 3,287,500 Water Trunk Fund 10,000 10,000 Source Grand Total 25,431,073 23,600,104 21,742,591 19,502,988 12,242,475 102,519,231 Utility 215th Street Public Improvements (CSAH 5-CSAH 70)26-09 6,755,000 6,755,000 Sanitary Sewer Trunk Improvements U-01 75,000 75,000 75,000 75,000 75,000 375,000 Sanitary Sewer Lift Station Rehabilitation U-02 150,000 255,000 150,000 180,000 80,000 815,000 Sanitary Sewer Inflow/Infiltration Maintenance U-03 575,000 575,000 575,000 575,000 575,000 2,875,000 Well Construction U-04 100,000 1,800,000 1,900,000 Watermain Trunk Extensions U-05 265,000 265,000 265,000 265,000 265,000 1,325,000 Water Distribution Features U-06 150,000 150,000 150,000 450,000 Well and Pump Rehabilitation U-07 200,000 200,000 100,000 300,000 100,000 900,000 Tower and Reservoir Maintenance U-08 1,150,000 150,000 1,300,000 Water meter replacement U-09 350,000 350,000 350,000 400,000 400,000 1,850,000 Fiber Optic Cable Connection U-10 62,000 62,000 70,000 60,000 80,000 334,000 Utility Total 9,732,000 1,882,000 3,535,000 2,005,000 1,725,000 18,879,000 G.O. Improvement Bonds - Sp. Assess.5,240,000 5,240,000 Sanitary Sewer Operating Fund 750,000 855,000 755,000 785,000 695,000 3,840,000 Sanitary Sewer Trunk Fund 1,290,000 75,000 75,000 75,000 75,000 1,590,000 Stormwater Infrastructure Fund 200,000 200,000 Water Operating Fund 1,737,000 587,000 490,000 880,000 540,000 4,234,000 Water Trunk Fund 515,000 365,000 2,215,000 265,000 415,000 3,775,000 Source Grand Total 9,732,000 1,882,000 3,535,000 2,005,000 1,725,000 18,879,000 GRAND TOTAL 89,116,900 116,050,036 59,222,109 35,936,194 24,333,242 324,658,481 Cost Type Project #2026 2027 2028 2029 2030 Total Produced Using Plan-It CIP Software Page 19 Page 649 of 899 East Lake Rough Fish Barrier 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #23-58 Project Name East Lake Rough Fish Barrier Total Project Cost $175,000 Contact Zach Johnson, City Engineer Cost Type Environmental Resources Department Environmental Resources Funding Description Environmental Resources Fund Expenditures 2026 2027 2028 2029 2030 Total Engineering/Design/Other costs 35,000 35,000 35,000 35,000 35,000 175,000 Total 35,000 35,000 35,000 35,000 35,000 175,000 Funding Sources 2026 2027 2028 2029 2030 Total Environmental Resources Fund 35,000 35,000 35,000 35,000 35,000 175,000 Total 35,000 35,000 35,000 35,000 35,000 175,000 Produced Using Plan-It CIP Software Page 20Page 650 of 899 Water Quality and Water Conservation 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #ER-01 Project Name Water Quality and Water Conservation Total Project Cost $425,000 Contact Zach Johnson, City Engineer Cost Type Environmental Resources Type Other Department Environmental Resources Funding Description Environmental Resources Fund County Project #N/A SA/SAP #N/A JPA #N/A Description Water Quality Best Management Practices Partnership projects aligning with Black Dog Watershed Water Management Organization, Dakota County Soil and Water Conservation District and Vermillion River Watershed Joint Powers Organization restoration and protection strategies. Funding intended as City’s cost-share to meet partnership or grant matching requirements. Emphasis on Federal Clean Water Act, Minnesota Pollution Control Agency MS4 permit and Total Maximum Daily Load compliance. Urban Restoration - Public System Initiatives and Improvements Program designed to restore and manage landscaping at public facilities and public open spaces by replacing hardscape and lawns with native plants/low- maintenance vegetation. Best management practices include native grasses/plants, prairies, rain gardens and woodlands to provide stormwater rate control/volume reduction or water quality improvements. Water Conservation Program designed to implement water conservation strategies to reduce water use. Best management practices include water reuse and smart irrigation systems. Expenditures 2026 2027 2028 2029 2030 Total Water Quality BMPs 75,000 75,000 75,000 75,000 75,000 375,000 Urban Restoration- Public System Initiatives 10,000 10,000 10,000 10,000 10,000 50,000 Total 85,000 85,000 85,000 85,000 85,000 425,000 Funding Sources 2026 2027 2028 2029 2030 Total Environmental Resources Fund 85,000 85,000 85,000 85,000 85,000 425,000 Total 85,000 85,000 85,000 85,000 85,000 425,000 Produced Using Plan-It CIP Software Page 21Page 651 of 899 Lake Management 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #ER-02 Project Name Lake Management Total Project Cost $550,000 Contact Zach Johnson, City Engineer Cost Type Environmental Resources Type Other Department Environmental Resources Funding Description Environmental Resources Fund County Project #N/A SA/SAP #N/A JPA #N/A Description Annual management program designed to promote and protect public water resources. Annual assessments, including aquatic plant surveys, aquatic invasive species monitoring, fish surveys and water monitoring/sampling, guide best management practices and strategies, and prioritize and schedule treatments. Best management practices and strategies include chemical treatments, education and outreach, and fish management. Expenditures 2026 2027 2028 2029 2030 Total Water Quality Assessment 60,000 60,000 60,000 60,000 60,000 300,000 Water Quality Treatment 50,000 50,000 50,000 50,000 50,000 250,000 Total 110,000 110,000 110,000 110,000 110,000 550,000 Funding Sources 2026 2027 2028 2029 2030 Total Environmental Resources Fund 100,000 100,000 100,000 100,000 100,000 500,000 Dakota County 10,000 10,000 10,000 10,000 10,000 50,000 Total 110,000 110,000 110,000 110,000 110,000 550,000 Produced Using Plan-It CIP Software Page 22Page 652 of 899 Stormwater Infrastructure Maintenance 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #ER-03 Project Name Stormwater Infrastructure Maintenance Total Project Cost $4,800,000 Contact Zach Johnson, City Engineer Cost Type Environmental Resources Type Maintenance Department Engineering Funding Description Environmental Resources Fund Description Stormwater Basin Rehabilitation Annual maintenance program designed to extend service life/minimize life-cycle costs of public stormwater management basins. Stormwater management basins improve water quality of stormwater runoff and reduce peak stormwater discharge rates. Public stormwater management basins are inspected regularly to prioritize and schedule maintenance and rehabilitation projects. Best management practices include maintenance at emergency overflow/easement areas, sediment/vegetation removal and slope restoration. Emphasis on Minnesota Pollution Control Agency Municipal Separate Storm Sewer System (MS4) permit compliance. Stormwater Infrastructure Maintenance/Rehabilitation Annual preventive maintenance program designed to protect the City’s investment in public stormwater infrastructure. Best management practices include flared-end section repairs, sediment removal, storm sewer pipe and manhole repairs, and stormwater conveyance systems improvements. Emphasis on Minnesota Pollution Control Agency Municipal Separate Storm Sewer System (MS4) permit compliance. Flared-End Section (FES) Maintenance Annual maintenance program designed to improve the overall performance and effectiveness of the City’s stormwater management system. Best management practices include removal of accumulated sediment that is restricting stormwater flow through flared-end sections, stormwater infrastructure designed to convey water to/from stormwater management basins. Stormwater Structure Sump Filling Annual program designed to improve the overall efficiency and effectiveness in maintaining the performance of the City's stromwater management. Expenditures 2026 2027 2028 2029 2030 Total Stormwater Basin Rehabilitation 450,000 450,000 450,000 450,000 450,000 2,250,000 Stormwater Infrastructure maintenance/rehabilitation 290,000 290,000 290,000 290,000 290,000 1,450,000 Creeks- proactive/preventative maintenance 100,000 100,000 100,000 100,000 100,000 500,000 FES Maintenance- MS4 Pond/Outfall Insp.85,000 85,000 85,000 85,000 85,000 425,000 Stormwater structure sump filling 35,000 35,000 35,000 35,000 35,000 175,000 Total 960,000 960,000 960,000 960,000 960,000 4,800,000 Funding Sources 2026 2027 2028 2029 2030 Total Environmental Resources Fund 950,000 950,000 950,000 950,000 950,000 4,750,000 Vermillion River Watershed JPO 10,000 10,000 10,000 10,000 10,000 50,000 Total 960,000 960,000 960,000 960,000 960,000 4,800,000 Produced Using Plan-It CIP Software Page 23Page 653 of 899 Storm Water Conveyance System Expansion 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #ER-04 Project Name Storm Water Conveyance System Expansion Total Project Cost $500,000 Contact Zach Johnson, City Engineer Cost Type Environmental Resources Prior Expenditures 2026 2027 2028 2029 2030 Total 100,000 Construction 100,000 100,000 100,000 100,000 0 400,000 Total 100,000 100,000 100,000 100,000 0 400,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 100,000 Stormwater Infrastructure Fund 100,000 100,000 100,000 100,000 0 400,000 Total 100,000 100,000 100,000 100,000 0 400,000 Forestry (Ash tree injection/removal, reforestatio 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #ER-05 Project Name Forestry (Ash tree injection/removal, reforestatio Total Project Cost $708,500 Contact Zach Jorgensen, City Forester Cost Type Environmental Resources Type Maintenance Department Environmental Resources Description Annual maintenance program designed to manage, preserve, and protect public woodland assets. Best management practices include Emerald Ash Borer program (tree injections, tree removal/stump grinding of infected trees and reforestation of public parks/open spaces). Expenditures 2026 2027 2028 2029 2030 Total Ash tree injection 62,000 60,000 55,000 55,000 55,000 287,000 Ash tree removal 53,000 53,000 56,000 56,000 56,000 274,000 Reforestation 27,500 28,500 30,500 30,500 30,500 147,500 Total 142,500 141,500 141,500 141,500 141,500 708,500 Funding Sources 2026 2027 2028 2029 2030 Total General Fund 142,500 141,500 141,500 141,500 141,500 708,500 Total 142,500 141,500 141,500 141,500 141,500 708,500 Produced Using Plan-It CIP Software Page 24Page 654 of 899 Vegetation Management - City Outlots/Public land 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #ER-06 Project Name Vegetation Management - City Outlots/Public land Total Project Cost $850,000 Contact Zach Jorgensen, City Forester Cost Type Environmental Resources Type Maintenance Department Environmental Resources Description Annual maintenance program designed to help establish deep-rooted native vegetation that will help prevent erosion and filter out chemicals, and nutrients, like phosphorous, that degrades water quality. Managing invasive and noxious weeds also helps to establish the native vegetation, increase biodiversity, and improve habitat for local wildlife. Expenditures 2026 2027 2028 2029 2030 Total Vegetation maintenance-City outlots/public land 170,000 170,000 170,000 170,000 170,000 850,000 Total 170,000 170,000 170,000 170,000 170,000 850,000 Funding Sources 2026 2027 2028 2029 2030 Total Environmental Resources Fund 170,000 170,000 170,000 170,000 170,000 850,000 Total 170,000 170,000 170,000 170,000 170,000 850,000 Produced Using Plan-It CIP Software Page 25Page 655 of 899 Police- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-01 Project Name Police-Equipment Total Project Cost $12,119,305 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Police Department Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Police division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase - squad vehicles 395,000 1,013,700 991,200 1,759,500 70,800 4,230,200 6,461,953 Equipment purchase - radios 195,000 212,550 313,040 74,407 65,844 860,841 Equipment purchase - command center 0 0 0 0 250,000 250,000 Equipment purchase - firearms 59,000 56,026 6,384 6,900 6,726 135,036 Equipment purchase - supplemental equipment 35,000 0 24,629 0 32,077 91,706 Equipment purchase - safety equipment 0 17,457 14,461 0 32,651 64,569 Equipment purchase - drones 25,000 0 0 0 0 25,000 Total 709,000 1,299,733 1,349,714 1,840,807 458,098 5,657,352 Funding Sources 2026 2027 2028 2029 2030 Total Future Equipment Fund 709,000 1,299,733 1,349,714 1,840,807 458,098 5,657,352 6,461,953 Total 709,000 1,299,733 1,349,714 1,840,807 458,098 5,657,352 Produced Using Plan-It CIP Software Page 26Page 656 of 899 Fire - Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-02 Project Name Fire - Equipment Total Project Cost $5,486,930 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Fire Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Fire division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase - multi-year fire equipment 0 0 800,000 0 1,532,000 2,332,000 1,921,498 Equipment purchase - radios 177,644 177,644 177,644 0 0 532,932 Equipment Purchase - vehicle 250,000 0 72,800 172,500 0 495,300 Equipment purchase - supplemental equipment 130,000 34,880 29,120 0 0 194,000 Equipment Purchase - Trailer 5,300 0 0 0 5,900 11,200 Total 562,944 212,524 1,079,564 172,500 1,537,900 3,565,432 Funding Sources 2026 2027 2028 2029 2030 Total Future Equipment Fund 562,944 212,524 1,079,564 172,500 1,537,900 3,565,432 1,921,498 Total 562,944 212,524 1,079,564 172,500 1,537,900 3,565,432 Produced Using Plan-It CIP Software Page 27Page 657 of 899 Streets- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-03 Project Name Streets-Equipment Total Project Cost $14,874,144 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Streets Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Streets division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment Purchase - plow truck 922,200 675,800 1,187,200 713,000 731,600 4,229,800 7,531,320 Equipment purchase - heavy equipment 0 394,580 459,200 723,797 79,392 1,656,969 Equipment Purchase - vehicle 296,800 81,750 0 69,000 141,600 589,150 Equipment purchase - supplemental equipment 46,287 0 16,800 87,325 362,424 512,836 Equipment purchase - sweepers 0 0 0 0 324,558 324,558 Equipment Purchase - Trailer 19,186 0 0 0 10,325 29,511 Total 1,284,473 1,152,130 1,663,200 1,593,122 1,649,899 7,342,824 Funding Sources 2026 2027 2028 2029 2030 Total Future Equipment Fund 1,284,473 1,152,130 1,663,200 1,593,122 1,649,899 7,342,824 7,531,320 Total 1,284,473 1,152,130 1,663,200 1,593,122 1,649,899 7,342,824 Produced Using Plan-It CIP Software Page 28Page 658 of 899 Park Maintenance- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-04 Project Name Park Maintenance-Equipment Total Project Cost $5,990,900 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Park Maintenance Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Park Maintenance division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase - mowers 172,906 177,799 182,692 240,540 163,006 936,943 2,907,511 Equipment Purchase - vehicle 96,106 126,355 129,530 37,950 310,006 699,947 Equipment purchase - heavy equipment 0 95,375 371,280 92,000 0 558,655 Equipment purchase - supplemental equipment 75,416 30,485 50,072 38,550 132,898 327,421 Equipment purchase - load & pack refuse 0 272,500 0 0 0 272,500 Equipment purchase - seasonal staff equipment 227,977 0 27,741 0 0 255,718 Equipment Purchase - Trailer 0 0 14,505 0 17,700 32,205 Total 572,405 702,514 775,820 409,040 623,610 3,083,389 Funding Sources 2026 2027 2028 2029 2030 Total Future Equipment Fund 572,405 702,514 775,820 409,040 623,610 3,083,389 2,907,511 Total 572,405 702,514 775,820 409,040 623,610 3,083,389 Produced Using Plan-It CIP Software Page 29Page 659 of 899 Facilities - Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-05 Project Name Facilities - Equipment Total Project Cost $109,506 Contact Tom Breeggemann, Facilities Supervisor Cost Type Equipment Type Equipment Department General Government Facilities Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Facilities division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase 9,270 45,021 0 0 0 54,291 55,215 Total 9,270 45,021 0 0 0 54,291 Funding Sources 2026 2027 2028 2029 2030 Total Future Equipment Fund 9,270 45,021 0 0 0 54,291 55,215 Total 9,270 45,021 0 0 0 54,291 Inspections- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-06 Project Name Inspections-Equipment Total Project Cost $349,186 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Inspections Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Inspections division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase 0 0 0 37,000 48,186 85,186 264,000 Total 0 0 0 37,000 48,186 85,186 Funding Sources 2026 2027 2028 2029 2030 Total Future General Fund 0 0 0 37,000 48,186 85,186 264,000 Total 0 0 0 37,000 48,186 85,186 Produced Using Plan-It CIP Software Page 30Page 660 of 899 Construction Services- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-07 Project Name Construction Services-Equipment Total Project Cost $279,908 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Construction Services Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Construction Services division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase 67,460 69,425 0 31,334 75,319 243,538 36,370 Total 67,460 69,425 0 31,334 75,319 243,538 Funding Sources 2026 2027 2028 2029 2030 Total Future General Fund 67,460 69,425 0 31,334 75,319 243,538 36,370 Total 67,460 69,425 0 31,334 75,319 243,538 Liquor- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-08 Project Name Liquor-Equipment Total Project Cost $60,022 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Keokuk Liquor Store Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Liquor stores. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase 0 34,880 0 0 0 34,880 25,142 Total 0 34,880 0 0 0 34,880 Funding Sources 2026 2027 2028 2029 2030 Total Future Liquor Fund 0 34,880 0 0 0 34,880 25,142 Total 0 34,880 0 0 0 34,880 Produced Using Plan-It CIP Software Page 31Page 661 of 899 Communications PEG- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-10 Project Name Communications PEG-Equipment Total Project Cost $454,654 Contact Tierney Helmers, Communications Manager Cost Type Equipment Type Equipment Department Communications Funding Description Equipment Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Communications division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase 45,000 60,000 40,000 52,000 72,654 269,654 185,000 Total 45,000 60,000 40,000 52,000 72,654 269,654 Funding Sources 2026 2027 2028 2029 2030 Total Future Communications Fund 45,000 60,000 40,000 52,000 72,654 269,654 185,000 Total 45,000 60,000 40,000 52,000 72,654 269,654 Environmental Resources - Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-11 Project Name Environmental Resources - Equipment Total Project Cost $136,596 Contact Bob Mach, Fleet Supervisor Cost Type Equipment Type Equipment Department Environmental Resources Funding Description Environmental Resources Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Environmental Resources division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment purchase - mowers 65,000 0 0 0 0 65,000 36,596 Equipment purchase 35,000 0 0 0 0 35,000 Total 100,000 0 0 0 0 100,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Environmental Resources Fund 100,000 0 0 0 0 100,000 36,596 Total 100,000 0 0 0 0 100,000 Produced Using Plan-It CIP Software Page 32Page 662 of 899 Utilities- Equipment 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #E-12 Project Name Utilities-Equipment Total Project Cost $2,632,122 Contact Shane Quade, Utilities Superintendent Cost Type Equipment Type Equipment Department Utilities Funding Description Water Operating Fund Description The CIP includes anticipated replacement/addition of various equipment costs for the Utilities division. Expenditures 2026 2027 2028 2029 2030 Total Future Equipment Purchase - vehicle 212,836 64,104 125,052 379,509 324,083 1,105,584 1,072,492 Equipment purchase - heavy equipment 370,660 53,000 0 0 0 423,660 Equipment purchase - supplemental equipment 21,310 0 0 0 0 21,310 Equipment Purchase - Trailer 0 6,956 0 0 0 6,956 Equipment Purchase - attachments 0 2,120 0 0 0 2,120 Total 604,806 126,180 125,052 379,509 324,083 1,559,630 Funding Sources 2026 2027 2028 2029 2030 Total Future Sanitary Sewer Operating Fund 477,078 63,090 62,526 189,755 162,041 954,490 1,072,492 Water Operating Fund 127,728 63,090 62,526 189,754 162,042 605,140 Total 604,806 126,180 125,052 379,509 324,083 1,559,630 Produced Using Plan-It CIP Software Page 33Page 663 of 899 Fire Station #5 Construction 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #25-11 Project Name Fire Station #5 Construction Total Project Cost $25,250,000 Contact Allyn Kuennen, Assistant City Administrator Cost Type Facilities Type New construction Department Fire Station #5 Funding Description Building Fund Description The City has purchased 12 acres adjacent to the water tower along 179th Street West for a fire station and a possible future satellite water treatment facility. This is directly across from the Central Maintenance Facility, 7570 179th Street West. Site planning has started and construction on the fire station could begin as early as 2026. Expenditures 2026 2027 2028 2029 2030 Total Construction 25,250,000 0 0 0 0 25,250,000 Total 25,250,000 0 0 0 0 25,250,000 Funding Sources 2026 2027 2028 2029 2030 Total G.O. Improvement Bonds- Franchise Fees (Facilities)25,000,000 0 0 0 0 25,000,000 Stormwater Infrastructure Fund 150,000 0 0 0 0 150,000 Sanitary Sewer Trunk Fund 100,000 0 0 0 0 100,000 Total 25,250,000 0 0 0 0 25,250,000 Produced Using Plan-It CIP Software Page 34Page 664 of 899 First Center- Construction 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #25-12 Project Name First Center- Construction Total Project Cost $25,829,024 Contact Allyn Kuennen, Assistant City Administrator Cost Type Facilities Type Maintenance/Improvement Department FiRST Center Funding Description Building Fund Description A regional public safety training facility does not currently exist for use by public safety personnel in the south metro area and adjacent cities and counties. A regional training facility will help ensure our safety personnel have the highest degree of training possible to serve the public. The Minnesota Legislature has clearly stated that public safety personnel need to be better trained and equipped to respond to the growing demands placed on them. Public safety personnel often use local businesses, schools and vacant facilities as temporary training sites since there is not a permanent site that fits all the training and classroom needs. A permanent, dedicated site within Dakota County, available to all jurisdictions within the south metro and Greater Minnesota area, will improve the ability to consistently and routinely train public safety employees, as well as maintain certifications. Construction of the FiRST (First Responders Skills Training) Center began in early 2025 and will be located at the former public works site within the Airlake Industrial Park at 7777 214th Street West. This 40,000-square-foot facility will include the following features: Physical training area for fire, police and EMS Virtual training area Firing range training area with vehicle access Equipment cleaning and armory area Tactical training room with movable partitions for fire, police and EMS Classroom/meeting space for fire, police and EMS Office space Restrooms/lockers Exterior training spaces The overall cost of the project is 25.8 million. $7.1 million of funding was awarded to this project through the 2023 Minnesota Legislature capital investment (cash funding) bill and an additional $800,000 was awarded in 2024 through Federal Congressionally-Directed Funding. The remaining cost of construction will be funded through general obligation bonds. Construction of the facility is expected to be completed by mid-2026. Operational costs to maintain and operate the facility will be provided through membership fees paid by the various agencies that will be using the facility. Prior Expenditures 2026 2027 2028 2029 2030 Total 19,371,768 Construction 6,457,256 0 0 0 0 6,457,256 Total 6,457,256 0 0 0 0 6,457,256 Prior Funding Sources 2026 2027 2028 2029 2030 Total 19,371,768 G.O. Improvement Bonds- Taxes (Facilities)6,457,256 0 0 0 0 6,457,256 Total 6,457,256 0 0 0 0 6,457,256 Produced Using Plan-It CIP Software Page 35Page 665 of 899 City Hall Building Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-01 Project Name City Hall Building Maintenance/Improvements Total Project Cost $1,572,051 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance Department City Hall Description The CIP includes anticipated maintenance/repair/improvement costs at Lakeville's City Hall building at 20195 Holyoke Ave. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 105,000 Roof replacement 0 0 0 190,000 0 190,000 1,055,000 Carpet 0 135,000 0 0 0 135,000 RTU S3 Replacement 0 0 0 0 70,000 70,000 Window film 0 0 0 17,051 0 17,051 Total 0 135,000 0 207,051 70,000 412,051 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 105,000 Building Fund 0 135,000 0 207,051 70,000 412,051 1,055,000 Total 0 135,000 0 207,051 70,000 412,051 Produced Using Plan-It CIP Software Page 36Page 666 of 899 CMF Building Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-02 Project Name CMF Building Maintenance/Improvements Total Project Cost $22,917,704 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Central Maintenance Facility Funding Description Building Fund Description The CIP includes anticipated maintenance/repair/improvement costs at Lakeville's Central Maintenance Facility building at 7570 179th St. W. It also includes costs to expand the facility in 2027, which will be funded by bonds, to be repaid by tax levy in future years. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 248,000 CMF Expansion 1,000,000 16,250,000 0 0 0 17,250,000 461,000 Roof replacement 0 0 0 3,000,000 0 3,000,000 Parks shop addition 0 500,000 0 0 0 500,000 Cooling Unit Replacement 420,000 0 0 0 0 420,000 Boiler replacement 0 0 300,000 0 0 300,000 Construction Services Office/Lunchroom remodel 0 210,000 0 0 0 210,000 MAU Replacements 100,000 0 0 0 0 100,000 Building wall system 0 0 0 100,000 0 100,000 Truck Garage paint (interior)0 80,000 0 0 0 80,000 Fuel island upgrades 75,000 0 0 0 0 75,000 Fleet shop and back office floor coating 0 60,000 0 0 0 60,000 Building envelope improvements 0 0 0 47,704 0 47,704 Monument sign 0 40,000 0 0 0 40,000 Fire panel 0 20,000 0 0 0 20,000 Conference room heating coil 6,000 0 0 0 0 6,000 Total 1,601,000 17,160,000 300,000 3,147,704 0 22,208,704 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 248,000 G.O. Improvement Bonds- Taxes (Facilities)0 17,960,000 0 0 0 17,960,000 461,000 Building Fund 1,601,000 -800,000 300,000 3,147,704 0 4,248,704 Total 1,601,000 17,160,000 300,000 3,147,704 0 22,208,704 Produced Using Plan-It CIP Software Page 37Page 667 of 899 Police Station- Building Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-03 Project Name Police Station- Building Maintenance/Improvements Total Project Cost $4,170,585 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Police Department Funding Description Building Fund Description Anticipated maintenance/repairs/improvements needed on the Police Station building. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 79,700 Workout room expansion 0 0 2,500,000 0 0 2,500,000 1,080,000 Boiler replacement 250,000 0 0 0 0 250,000 High speed garage door replacement 60,000 0 100,000 0 0 160,000 Radiant panels for offices 0 0 0 60,885 0 60,885 Paint-interior 0 0 0 0 25,000 25,000 Mini split unit 15,000 0 0 0 0 15,000 Total 325,000 0 2,600,000 60,885 25,000 3,010,885 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 79,700 Building Fund 325,000 0 2,600,000 60,885 25,000 3,010,885 1,080,000 Total 325,000 0 2,600,000 60,885 25,000 3,010,885 Produced Using Plan-It CIP Software Page 38Page 668 of 899 Heritage Center- Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-04 Project Name Heritage Center-Maintenance/Improvements Total Project Cost $1,563,460 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Heritage Center Funding Description Building Fund Description The Lakeville Heritage Center is located at 20110 Holyoke Ave and is home to Lakeville Area Active Adults, Lakeville Area Historical Society and Lakeville Yellow Ribbon. The CIP includes estimated costs for maintenance/repairs/improvements at the Heritage Center building. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 734,300 Interior Renovation 450,000 0 0 0 0 450,000 115,000 RTU 7,8,9,11 Replacement 0 0 100,000 0 0 100,000 RTU 2,3,4,6 Replacement 0 0 0 80,000 0 80,000 RTU 1,5 Replacement 0 0 0 0 40,000 40,000 RTU 10 replacement 20,000 0 0 0 0 20,000 Building envelope improvements 0 0 0 16,160 0 16,160 Mini Split Replacement 0 0 8,000 0 0 8,000 Total 470,000 0 108,000 96,160 40,000 714,160 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 734,300 Building Fund 470,000 0 108,000 96,160 40,000 714,160 115,000 Total 470,000 0 108,000 96,160 40,000 714,160 Produced Using Plan-It CIP Software Page 39Page 669 of 899 Arts Center- Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-05 Project Name Arts Center-Maintenance/Improvements Total Project Cost $1,218,942 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department LAAC - Performing Arts Building Funding Description Building Fund Description The Lakeville Area Arts Center is located at 20965 Holyoke Ave, in historic downtown Lakeville. The Arts Center hosts theater and other events, community classes, and provides rental opportunities. The CIP includes estimated costs for maintenance/repairs/improvements at the Arts Center building. Prior Expenditures 2026 2027 2028 2029 2030 Total 213,942 Condenser Unit #1 replacement 0 520,000 0 0 0 520,000 Theater Seating Refurbishment 0 0 0 150,000 0 150,000 AHU Replacements 0 0 0 0 125,000 125,000 Arts Center Playground- drainage/sidewalks 80,000 0 0 0 0 80,000 Sound system replacement 65,000 0 0 0 0 65,000 Snow melt boiler/pump replacement 25,000 0 0 0 0 25,000 Green room sink and counter 15,000 0 0 0 0 15,000 Stage drape replacement 0 15,000 0 0 0 15,000 Light board replacement 0 10,000 0 0 0 10,000 Total 185,000 545,000 0 150,000 125,000 1,005,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 213,942 Building Fund 185,000 545,000 0 150,000 125,000 1,005,000 Total 185,000 545,000 0 150,000 125,000 1,005,000 Produced Using Plan-It CIP Software Page 40Page 670 of 899 Fine Arts Building- Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-06 Project Name Fine Arts Building-Maintenance/Improvements Total Project Cost $684,808 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department LAAC - Fine Arts Building Funding Description Building Fund Description The Fine Arts Center is located at 20950 Howland Ave and is a division of the Lakeville Area Arts Center, focused on providing expanded classroom and studio space for fine arts programming. The CIP includes estimated costs for maintenance/repairs/improvements at the Fine Arts Center building. Prior Expenditures 2026 2027 2028 2029 2030 Total 114,808 Roof replacement 0 570,000 0 0 0 570,000 Total 0 570,000 0 0 0 570,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 114,808 Building Fund 0 570,000 0 0 0 570,000 Total 0 570,000 0 0 0 570,000 Produced Using Plan-It CIP Software Page 41Page 671 of 899 Fire Station #1- Building Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-07 Project Name Fire Station #1-Building Maintenance/Improvements Total Project Cost $21,066,940 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Fire Station #1 Description Station 1 protects the region south of 195th Street to 220th Street, west to Judicial Road (Scott County), and east to the Farmington border. The CIP includes anticipated maintenance/repairs and improvements to the Fire Station #1 building. Prior Expenditures 2026 2027 2028 2029 2030 Total 275,000 Remodel for full time 0 0 20,000,000 0 0 20,000,000 Roof replacement 0 0 0 175,000 0 175,000 Parking lot mill and overlay 0 0 156,000 0 0 156,000 Building envelope improvements 0 0 0 110,140 0 110,140 Rear Concrete Apron 0 0 95,000 0 0 95,000 Fire sprinkler system installation 0 0 70,000 0 0 70,000 MAU Replacements 0 60,000 0 0 0 60,000 Generator Replacement 0 0 50,000 0 0 50,000 Cooling unit 1, 2 & 3 replacement 0 0 35,000 0 0 35,000 Truck bay floor recoating 0 0 0 0 22,000 22,000 Office and Training Room carpet 0 0 11,000 0 0 11,000 Washer replacement 0 0 7,800 0 0 7,800 Total 0 60,000 20,424,800 285,140 22,000 20,791,940 Prior Funding Sources 2026 2027 2028 2029 2030 Total 275,000 G.O. Improvement Bonds- Franchise Fees (Facilities)0 0 20,000,000 0 0 20,000,000 Building Fund 0 60,000 424,800 285,140 22,000 791,940 Total 0 60,000 20,424,800 285,140 22,000 20,791,940 Produced Using Plan-It CIP Software Page 42Page 672 of 899 Fire Station #3- Building Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-09 Project Name Fire Station #3-Building Maintenance/Improvements Total Project Cost $22,210,800 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Fire Station #3 Funding Description Building Fund Description Anticipated maintenance/repairs/improvements needed on the Fire Station #3 building. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 69,000 Remodel for full time 0 20,000,000 0 0 0 20,000,000 12,000 Land acquisition 2,000,000 0 0 0 0 2,000,000 Roof replacement 0 0 0 115,000 0 115,000 Washer replacement 0 0 0 7,800 0 7,800 Carpet 0 0 0 0 7,000 7,000 Total 2,000,000 20,000,000 0 122,800 7,000 22,129,800 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 69,000 G.O. Improvement Bonds- Franchise Fees (Facilities)2,000,000 20,000,000 0 0 0 22,000,000 12,000 Building Fund 0 0 0 122,800 7,000 129,800 Total 2,000,000 20,000,000 0 122,800 7,000 22,129,800 Produced Using Plan-It CIP Software Page 43Page 673 of 899 Fire Station #4- Building Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-10 Project Name Fire Station #4-Building Maintenance/Improvements Total Project Cost $322,700 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Fire Station #4 Funding Description Building Fund Description Built in 2002, Station 4 is currently Lakeville's newest and most centrally located station. The CIP includes anticipated maintenance/repairs/improvements needed on the Fire Station #4 building. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 48,000 RTU 1,2,4 replacement 0 0 0 95,000 0 95,000 120,000 Carpet 0 30,000 0 0 0 30,000 Building envelope improvements 0 0 0 29,700 0 29,700 Total 0 30,000 0 124,700 0 154,700 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 48,000 Building Fund 0 30,000 0 124,700 0 154,700 120,000 Total 0 30,000 0 124,700 0 154,700 Keokuk Liquor Store- Maintenance/Improv 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-12 Project Name Keokuk Liquor Store- Maintenance/Improv Total Project Cost $143,000 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Keokuk Liquor Store Funding Description Liquor Fund Description The CIP includes anticipated maintenance/repairs/improvement costs at the Keokuk Liquor Store building, which is located at 20880 Keokuk Ave. This facility also includes the Emporium Room, which is a multi-purpose, 3,000 square feet room that can be rented for meetings, celebrations or classes. Expenditures 2026 2027 2028 2029 2030 Total Future Strip and wax floor 23,000 0 0 0 0 23,000 120,000 Total 23,000 0 0 0 0 23,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Liquor Fund 23,000 0 0 0 0 23,000 120,000 Total 23,000 0 0 0 0 23,000 Produced Using Plan-It CIP Software Page 44Page 674 of 899 Heritage Liquor Store- Maintenance/Improv 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-13 Project Name Heritage Liquor Store- Maintenance/Improv Total Project Cost $163,000 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Heritage Liquor Store Funding Description Liquor Fund Description The CIP includes anticipated maintenance/repairs/improvement costs at the Heritage Liquor Store building, which is located at 20164 Heritage Dr. Expenditures 2026 2027 2028 2029 2030 Total Future Flooring Replacement 0 0 65,000 0 0 65,000 90,000 Paint sales floor & office walls 0 0 0 0 8,000 8,000 Entrance door replacement 0 0 0 0 0 0 Total 0 0 65,000 0 8,000 73,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Liquor Fund 0 0 65,000 0 8,000 73,000 90,000 Total 0 0 65,000 0 8,000 73,000 Produced Using Plan-It CIP Software Page 45Page 675 of 899 Kenrick Liquor Store- Maintenance/Improv 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-14 Project Name Kenrick Liquor Store- Maintenance/Improv Total Project Cost $217,629 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Kenrick Store Funding Description Liquor Fund Description The CIP includes anticipated maintenance/repairs/improvement costs at the Kenrick Liquor Store building, which is located at 16179 Kenrick Ave. Expenditures 2026 2027 2028 2029 2030 Total Future Cooler mechanicals 40,000 0 0 0 0 40,000 146,000 Building envelope improvements 0 0 0 0 30,290 30,290 Water savings 0 0 0 0 1,339 1,339 Total 40,000 0 0 0 31,629 71,629 Funding Sources 2026 2027 2028 2029 2030 Total Future Liquor Fund 40,000 0 0 0 31,629 71,629 146,000 Total 40,000 0 0 0 31,629 71,629 Produced Using Plan-It CIP Software Page 46Page 676 of 899 Galaxie Liquor Store- Maintenance/Improv 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-15 Project Name Galaxie Liquor Store- Maintenance/Improv Total Project Cost $491,570 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department Galaxie Store Funding Description Liquor Fund Description The CIP includes anticipated maintenance/repairs/improvement costs at the Galaxie Liquor Store building, which is located at 16000 Galaxie Ave. Expenditures 2026 2027 2028 2029 2030 Total Future Roof replacement 0 0 0 0 275,000 275,000 115,000 Building envelope improvements 0 0 0 0 56,570 56,570 Flooring Replacement 45,000 0 0 0 0 45,000 Total 45,000 0 0 0 331,570 376,570 Funding Sources 2026 2027 2028 2029 2030 Total Future Liquor Fund 45,000 0 0 0 331,570 376,570 115,000 Total 45,000 0 0 0 331,570 376,570 Produced Using Plan-It CIP Software Page 47Page 677 of 899 Water Treatment Facilty- Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-16 Project Name Water Treatment Facilty-Maintenance/Improvements Total Project Cost $46,359,960 Contact Paul Oehme, Public Works Director Cost Type Facilities Type Maintenance/Improvement Department Utilities Funding Description Water Operating Fund Description Anticipated maintenance/repairs/improvements needed on the existing Water Treatment Facility building. The City of Lakeville’s Water Treatment Plant was originally constructed in 1997 with a capacity of 10 million gallons per day (MGD). It was expanded in 2001 to 20 MGD, and in 2013, following a successful filter pilot study, the plant was re-rated to a capacity of 26 MGD. The City's water need continues to grow and a study is underway to update the 2022 WTP Expansion Study, in order to determine the best way to reach the capacity for full City build out. It will compare the advantages and disadvantages of two key alternatives: Expanding the existing water treatment facility. Constructing a satellite facility on a parcel located north of the Central Maintenance Facility water tower Costs to build a satellite water treatment facility are estimated in 2027, and will be adjusted if needed upon Council direction after the results of the study are determined. Expenditures 2026 2027 2028 2029 2030 Total Future Water Treatment Plant Expansion 4,000,000 40,000,000 0 0 0 44,000,000 60,000 Roof replacement 0 1,500,000 0 0 0 1,500,000 Boiler plant replacement 350,000 0 0 0 0 350,000 AHU Replacements 0 0 0 115,000 0 115,000 Parking lot mill and overlay 0 0 110,000 0 0 110,000 Auto Shutoff for chlorine tanks 75,000 0 0 0 0 75,000 Building envelope improvements 0 0 0 64,960 0 64,960 Filter rooms exhaust fan replacement 0 0 60,000 0 0 60,000 Well #7 roof replacement 25,000 0 0 0 0 25,000 Total 4,450,000 41,500,000 170,000 179,960 0 46,299,960 Funding Sources 2026 2027 2028 2029 2030 Total Future Water Revenue Bonds 0 40,000,000 0 0 0 40,000,000 60,000 Water Operating Fund 450,000 5,500,000 170,000 179,960 0 6,299,960 Water Trunk Fund 4,000,000 -4,000,000 0 0 0 0 Total 4,450,000 41,500,000 170,000 179,960 0 46,299,960 Produced Using Plan-It CIP Software Page 48Page 678 of 899 FiRST Center Facility Maintenance/Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #B-17 Project Name FiRST Center Facility Maintenance/Improvements Total Project Cost $125,000 Contact Tom Breeggemann, Facilities Supervisor Cost Type Facilities Type Maintenance/Improvement Department FiRST Center Funding Description FiRST Center Operating Fund Description Construction of the FiRST Center began in early 2025 and will be located at the former Public Works site within the Airlake Industrial Park at 7777 214th Street West. It is expected to be completed in 2026. Operational costs to maintain and operate the facility will be provided through membership fees paid by the various agencies that will be using the facility. The CIP estimates maintenance/repair/improvements costs at this facility. Expenditures 2026 2027 2028 2029 2030 Total Facility improvements/maintenance 25,000 100,000 0 0 0 125,000 Total 25,000 100,000 0 0 0 125,000 Funding Sources 2026 2027 2028 2029 2030 Total FiRST Center Operating Fund 25,000 100,000 0 0 0 125,000 Total 25,000 100,000 0 0 0 125,000 Produced Using Plan-It CIP Software Page 49Page 679 of 899 Klamath Trail Retaining Wall 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #23-13 Project Name Klamath Trail Retaining Wall Total Project Cost $1,510,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance Department Park Maintenance Funding Description Park & Trail Improvement Fund Description There are two existing modular block retaining walls (totaling over 1,200 feet in length) along the south side of Klamath Trail, west of County State Aid Highway 5, which were constructed in 1999. A Condition Assessment Report was completed by a third party after it was noticed that the modular block walls are showing signs of deterioration. Based on the anticipated life span of these walls and the condition assessment that indicates visible staining, cracking along the face of individual blocks along with other types of deterioration, the replacement of these walls is scheduled to be completed in 2027 with prefabricated modular block walls (PMBW). This is currently planned to be funded by the Trail Improvement fund. Expenditures 2026 2027 2028 2029 2030 Total Retaining Wall Reconstruction 0 1,500,000 0 0 0 1,500,000 Engineering/Design/Other costs 10,000 0 0 0 0 10,000 Total 10,000 1,500,000 0 0 0 1,510,000 Funding Sources 2026 2027 2028 2029 2030 Total Park & Trail Improvement Fund 10,000 1,500,000 0 0 0 1,510,000 Total 10,000 1,500,000 0 0 0 1,510,000 Location Produced Using Plan-It CIP Software Page 50Page 680 of 899 Grand Prairie Park 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #24-20 Project Name Grand Prairie Park Total Project Cost $22,494,255 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type New construction Department Park Bonds Funding Description Park Bonds Fund Description Construction of this park is underway in 2025, with completion anticipated in 2026. This project was approved as part of the 2021 Park Bond Referendum. Lakeville Lions has committed $500,000 toward the Grand Paririe Park splash pad over five years ($100,000/year). Lakeville Baseball Association has committed $1.375 Million toward the project over 10 years ($137,500/year). 2026 funding has been added to construct a freestanding shower building at an estimated $650,000.00 Prior Expenditures 2026 2027 2028 2029 2030 Total 21,544,255 Construction 950,000 0 0 0 0 950,000 Total 950,000 0 0 0 0 950,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 21,544,255 Park Dedication Fund 950,000 0 0 0 0 950,000 Total 950,000 0 0 0 0 950,000 Location Produced Using Plan-It CIP Software Page 51Page 681 of 899 Produced Using Plan-It CIP Software Page 52Page 682 of 899 East Community Park Phase II 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #25-20 Project Name East Community Park Phase II Total Project Cost $3,125,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type New construction Department Park Bonds Funding Description Park Bonds Fund Description The 2018 Master Plan for the park identified specific amenities. The park is proposed to be constructed in 2026, which was approved as part of the 2021 Park Bond Referendum. This project also includes the trails/trailhead in East Community Park, which is part of a multi-phased County greenway project designed to provide connectivity City and County trail system. Prior Expenditures 2026 2027 2028 2029 2030 Total 350,000 East Community Park 2,575,000 0 0 0 0 2,575,000 Construction-North Creek Greenway Trails 170,000 0 0 0 0 170,000 Construction-North Creek Greenway Trails (P26-15B- North Creek Trl East Park to 160th)30,000 0 0 0 0 30,000 Total 2,775,000 0 0 0 0 2,775,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 350,000 Park Dedication Fund 1,618,780 0 0 0 0 1,618,780 Dakota County 570,000 0 0 0 0 570,000 Park Bonds Fund 556,220 0 0 0 0 556,220 Park & Trail Improvement Fund 30,000 0 0 0 0 30,000 Total 2,775,000 0 0 0 0 2,775,000 Location Produced Using Plan-It CIP Software Page 53Page 683 of 899 Parks Major Maintenance - General 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-01 Project Name Parks Major Maintenance - General Total Project Cost $214,956 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance Department Park Maintenance Funding Description Park Improvement Fund Description Includes general park amenities like benches, grills, tables and improvements completed through our Eagle Scout Program. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 18,206 Park Amenities – Benches, Grills, Tables, etc.10,000 10,000 11,000 11,000 11,000 53,000 101,250 Eagle Scout Project Materials 8,250 8,500 8,500 8,500 8,750 42,500 Total 18,250 18,500 19,500 19,500 19,750 95,500 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 18,206 Park & Trail Improvement Fund 18,250 18,500 19,500 19,500 19,750 95,500 101,250 Total 18,250 18,500 19,500 19,500 19,750 95,500 Produced Using Plan-It CIP Software Page 54Page 684 of 899 Park Development - Adminstrative Projects 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-02 Project Name Park Development - Adminstrative Projects Total Project Cost $270,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type New construction Department Park Dedication Funding Description Park Dedication Fund Description The Park Dedication Fund budget provides appropriations for many activities including planning, design and feasibility reports for park projects. On an annual basis those project include engineering and design work for a wide variety of park projects, including rinks, playgrounds and future parks. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 55,000 Engineering/Design/Other costs 20,000 20,000 20,000 20,000 20,000 100,000 100,000 Buildings/Shelters/Grounds 15,000 0 0 0 0 15,000 Total 35,000 20,000 20,000 20,000 20,000 115,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 55,000 Park Dedication Fund 35,000 20,000 20,000 20,000 20,000 115,000 100,000 Total 35,000 20,000 20,000 20,000 20,000 115,000 Produced Using Plan-It CIP Software Page 55Page 685 of 899 Park Development - Developer Credits 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-03 Project Name Park Development - Developer Credits Total Project Cost $4,785,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type Other Department Park Dedication Funding Description Park Dedication Fund Description Represents credits associated with new development when the park dedication requirement is fulfilled through a land dedication. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 435,000 Developer-Credits 435,000 435,000 435,000 435,000 435,000 2,175,000 2,175,000 Total 435,000 435,000 435,000 435,000 435,000 2,175,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 435,000 Park Dedication Fund 435,000 435,000 435,000 435,000 435,000 2,175,000 2,175,000 Total 435,000 435,000 435,000 435,000 435,000 2,175,000 Future Park Land Acquisition 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-04 Project Name Future Park Land Acquisition Total Project Cost $2,200,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type Other Department Park Dedication Funding Description Park Dedication Fund Description Represents potential costs of land acquisition where needed to fulfill future plans for parks in the City based on the 2026-2036 Parks System Master Plan. Expenditures 2026 2027 2028 2029 2030 Total Future Land acquisition for parks/trails use 0 0 100,000 100,000 100,000 300,000 1,900,000 Total 0 0 100,000 100,000 100,000 300,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Park Dedication Fund 0 0 100,000 100,000 100,000 300,000 1,900,000 Total 0 0 100,000 100,000 100,000 300,000 Produced Using Plan-It CIP Software Page 56Page 686 of 899 Trail Improvements (Various Trails) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-05 Project Name Trail Improvements (Various Trails) Total Project Cost $7,900,500 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Reconstruction/Maintenance Department Park Maintenance Funding Description Trail Improvement Fund Description The City retained a third party in 2022 to evaluate the condition of all trail segments in our community and plans are to do this again in 2025. Based on the evaluation results staff will refine the current plan for either overlaying or reclaiming City trail segments, along with crack filling and fog sealing of trails. Maintenance of sidewalks and trails along Dakota County roadways is provided in accordance with the current County and City Maintenance Agreement for County Bikeway Trails. In 2021, the Dakota County Board of Commissioners approved the following regarding trails and sidewalks along Dakota County roadways: Multi-Use Trails and Sidewalk Maintenance Dakota County will participate in pavement preservation, overlay, or reconstruction of trails and sidewalks along the County highway system up to 100 percent. The City is responsible for snow and ice removal. To be eligible for County participation in trails and sidewalks, a system-wide maintenance agreement between the County and local agency will be required to identify system-wide trail and sidewalk roles and cost responsibilities. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 602,500 Construction- Trail Rehabilitation/Reconstruction 810,000 450,000 500,000 525,000 525,000 2,810,000 3,750,000 Crack Seal 80,000 80,000 85,000 85,000 85,000 415,000 Construction- New trails 0 0 100,000 100,000 100,000 300,000 Trail inspection and rating 0 0 23,000 0 0 23,000 Total 890,000 530,000 708,000 710,000 710,000 3,548,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 602,500 Park & Trail Improvement Fund 890,000 530,000 608,000 610,000 610,000 3,248,000 3,750,000 Park Dedication Fund 0 0 100,000 100,000 100,000 300,000 Total 890,000 530,000 708,000 710,000 710,000 3,548,000 Produced Using Plan-It CIP Software Page 57Page 687 of 899 Park Improvements (Various Parks) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-06 Project Name Park Improvements (Various Parks) Total Project Cost $2,379,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance Department Park Maintenance Funding Description Park Improvement Fund Description The Park Improvement Fund provides funding for replacement and upgrades to shelters and buildings, improvements to hockey rinks, basketball, pickleball, tennis courts and other park amenities. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 130,000 Miracle Field surface replacement/repairs 0 300,000 0 0 0 300,000 860,000 Dodd Trail Pickleball reconstruction 0 225,000 0 0 0 225,000 Highview rink reconstruction 155,000 0 0 0 0 155,000 Meadows Rink reconstruction 0 0 0 135,000 0 135,000 McGuire-Rink reconstruction 0 110,000 0 0 0 110,000 Rolling Oaks rink reconstruction 0 0 105,000 0 0 105,000 Parkview Rink reconstruction 0 0 0 0 105,000 105,000 Prairie Lake BB reconstruction-concrete 0 0 52,000 0 0 52,000 Dodd Trail BB Reconstruction-concrete 0 52,000 0 0 0 52,000 Meadows BB court reconstruction-concrete 50,000 0 0 0 0 50,000 Cherryview BB Reconstruction- concrete 50,000 0 0 0 0 50,000 Ballfield dugout roof support 7,000 7,000 7,000 7,000 7,000 35,000 Pioneer Plaza water fountain repairs/upgrade 15,000 0 0 0 0 15,000 Total 277,000 694,000 164,000 142,000 112,000 1,389,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 130,000 Park & Trail Improvement Fund 277,000 544,000 164,000 142,000 112,000 1,239,000 860,000 Lakeville Baseball Association 0 150,000 0 0 0 150,000 Total 277,000 694,000 164,000 142,000 112,000 1,389,000 Produced Using Plan-It CIP Software Page 58Page 688 of 899 Playground Replacement 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-08 Project Name Playground Replacement Total Project Cost $3,523,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Reconstruction/Maintenance Department Park Maintenance Funding Description Park Improvement Fund Description The Park Improvement Fund provides funding for replacement and upgrades to playgrounds. The Arts Center playground funding includes a $60,000 donation from QA-1. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 226,000 Aronson Park 0 0 300,000 0 0 300,000 1,173,000 Arts Center playground 145,000 0 0 0 0 145,000 Valley Lake Park 130,000 0 0 0 0 130,000 Kenreel Park 0 0 0 0 127,000 127,000 Bassett Park 0 0 0 0 127,000 127,000 Spyglass Park 0 0 0 0 127,000 127,000 Lakeridge Park 0 0 0 124,000 0 124,000 Jaycee Park 0 0 0 124,000 0 124,000 Rolling Oaks Park 0 0 0 124,000 0 124,000 Lynwood Heights Park 0 0 121,500 0 0 121,500 Fairfield Park 0 0 121,500 0 0 121,500 Village Creek Park 0 120,000 0 0 0 120,000 Prairie Lake Park 0 120,000 0 0 0 120,000 Dakota Heights 120,000 0 0 0 0 120,000 Brackett's Crossing Park 118,000 0 0 0 0 118,000 Orchard Lake Beach 0 75,000 0 0 0 75,000 Total 513,000 315,000 543,000 372,000 381,000 2,124,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 226,000 Park & Trail Improvement Fund 453,000 315,000 543,000 372,000 381,000 2,064,000 1,173,000 Donations 60,000 0 0 0 0 60,000 Total 513,000 315,000 543,000 372,000 381,000 2,124,000 Produced Using Plan-It CIP Software Page 59Page 689 of 899 Park parking lot improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-09 Project Name Park parking lot improvements Total Project Cost $898,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Reconstruction/Maintenance Department Park Maintenance Funding Description Park Improvement Fund Description The Park Improvement Fund provides funding for replacement and rehabilitation of parking lots used to access City parks. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 90,000 Orchard Lake Park 0 210,000 0 0 0 210,000 310,000 Bunker Hill 75,000 0 0 0 0 75,000 Greenridge Park 0 0 68,000 0 0 68,000 Prairie Lake Park 0 0 0 55,000 0 55,000 Cedar Highlands 0 0 0 0 45,000 45,000 Highview Heights 0 0 45,000 0 0 45,000 Total 75,000 210,000 113,000 55,000 45,000 498,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 90,000 Park & Trail Improvement Fund 75,000 210,000 113,000 55,000 45,000 498,000 310,000 Total 75,000 210,000 113,000 55,000 45,000 498,000 Produced Using Plan-It CIP Software Page 60Page 690 of 899 Keokuk Avenue/172nd St. Park 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-11 Project Name Keokuk Avenue/172nd St. Park Total Project Cost $835,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type New construction Department Park Dedication Funding Description Park Dedication Fund Description The Parks, Trails and Open Space Plan calls for a neighborhood park in the area which is proposed to be constructed in 2030. Planning/design costs are included in 2029. Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 0 0 750,000 750,000 Planning/Design 0 0 0 65,000 20,000 85,000 Total 0 0 0 65,000 770,000 835,000 Funding Sources 2026 2027 2028 2029 2030 Total Park Dedication Fund 0 0 0 65,000 770,000 835,000 Total 0 0 0 65,000 770,000 835,000 Location Produced Using Plan-It CIP Software Page 61Page 691 of 899 Grand Prairie Skatepark 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-12 Project Name Grand Prairie Skatepark Total Project Cost $650,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type New construction Department Park Dedication Description Planning/design costs are included in 2028 with construction planned for 2029. Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 0 600,000 0 600,000 Planning/Design 0 0 50,000 0 0 50,000 Total 0 0 50,000 600,000 0 650,000 Funding Sources 2026 2027 2028 2029 2030 Total Park Dedication Fund 0 0 50,000 600,000 0 650,000 Total 0 0 50,000 600,000 0 650,000 Location Produced Using Plan-It CIP Software Page 62Page 692 of 899 Ritter Meadows Park 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-13 Project Name Ritter Meadows Park Total Project Cost $828,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type New construction Department Park Dedication Funding Description Park Dedication Fund Description The Parks, Trails and Open Space Plan calls for a neighborhood park in the area which is proposed to be constructed in 2029. Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 0 750,000 0 750,000 Planning/Design 0 0 58,000 20,000 0 78,000 Total 0 0 58,000 770,000 0 828,000 Funding Sources 2026 2027 2028 2029 2030 Total Park Dedication Fund 0 0 58,000 770,000 0 828,000 Total 0 0 58,000 770,000 0 828,000 Location Produced Using Plan-It CIP Software Page 63Page 693 of 899 Voyageur Park 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-14 Project Name Voyageur Park Total Project Cost $755,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type New construction Department Park Dedication Funding Description Park Dedication Fund Description The Parks, Trails, and Open Space Plan calls for a neighborhood park East of Cedar Avenue and south of 181st Street serving the future development in this area. The park will be approximately 2 acres in size and is proposed to be constructed in 2027. Expenditures 2026 2027 2028 2029 2030 Total Construction 0 700,000 0 0 0 700,000 Planning/Design 35,000 20,000 0 0 0 55,000 Total 35,000 720,000 0 0 0 755,000 Funding Sources 2026 2027 2028 2029 2030 Total Park Dedication Fund 35,000 720,000 0 0 0 755,000 Total 35,000 720,000 0 0 0 755,000 Location Produced Using Plan-It CIP Software Page 64Page 694 of 899 Parks Major Maintenance - Open Space 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-15 Project Name Parks Major Maintenance - Open Space Total Project Cost $316,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance Department Park Maintenance Funding Description Park Improvement Fund Description Includes parking lot and trail maintenance work such as crack sealing and paint striping. Funds also include ongoing maintenance and improvements at the West Lake Marion Bike Course. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 40,000 Pavement Maintenance Parking Lots & Trails 18,000 18,000 18,000 18,000 19,000 91,000 140,000 West Lake Marion Mountain Bike Contract Maintenance 9,000 9,000 9,000 9,000 9,000 45,000 Total 27,000 27,000 27,000 27,000 28,000 136,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 40,000 Park & Trail Improvement Fund 27,000 27,000 27,000 27,000 28,000 136,000 140,000 Total 27,000 27,000 27,000 27,000 28,000 136,000 Produced Using Plan-It CIP Software Page 65Page 695 of 899 Parks Major Maintenance - Fields 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-16 Project Name Parks Major Maintenance - Fields Total Project Cost $314,546 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance Department Park Maintenance Funding Description Park Improvement Fund Description Includes field maintenance and improvements throughout the parks system. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 86,046 Field improvements/Maintenance 6,500 12,000 12,000 12,000 12,000 54,500 70,000 Aronson – replace backstop field 3 0 0 0 27,000 0 27,000 Aronson – replace backstop field 4 0 0 27,000 0 0 27,000 Aronson – replace backstop field 2 0 25,000 0 0 0 25,000 Aronson – replace backstop field 1 25,000 0 0 0 0 25,000 Total 31,500 37,000 39,000 39,000 12,000 158,500 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 86,046 Park & Trail Improvement Fund 31,500 37,000 39,000 39,000 12,000 158,500 70,000 Total 31,500 37,000 39,000 39,000 12,000 158,500 Produced Using Plan-It CIP Software Page 66Page 696 of 899 Parks Major Maintenance - Bldgs/Shelters/Grounds 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-17 Project Name Parks Major Maintenance - Bldgs/Shelters/Grounds Total Project Cost $435,003 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance/Improvement Department Park Maintenance Funding Description Park Improvement Fund Description Includes general maintenance projects, maintenance of buildings, park shelters and grounds (examples- re-shingle park shelters, replace signs, repair fencing, replace rubber floors, etc.). Prior Expenditures 2026 2027 2028 2029 2030 Total Future 14,353 Projects TBD - Major Maintenance Bldgs/Shelters/Grounds 0 0 0 500 24,850 25,350 335,300 Fence Repairs 20,000 0 0 0 0 20,000 LED Light Installation 18,000 0 0 0 0 18,000 Wayside Park Fence Replacement 15,000 0 0 0 0 15,000 Georgetown Court Fence Replacement 7,000 0 0 0 0 7,000 Total 60,000 0 0 500 24,850 85,350 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 14,353 Park & Trail Improvement Fund 60,000 0 0 500 24,850 85,350 335,300 Total 60,000 0 0 500 24,850 85,350 Produced Using Plan-It CIP Software Page 67Page 697 of 899 Other Projects 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-19 Project Name Other Projects Total Project Cost $3,245,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Department Park Dedication Funding Description Park Dedication Fund Description This category is intended to include smaller park projects such as adding artwork in the parks, tree planting, security cameras at park facilities, Pickleball courts in the south side of the City based on the 2026-2036 Parks System Master Plan, and the completion of an ADA Transition Plan. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 70,000 Other amenities to be determined 0 0 300,000 300,000 300,000 900,000 1,600,000 ADA Transition Plan 0 0 275,000 0 0 275,000 Aronson Park – Field 9 improvements 125,000 0 0 0 0 125,000 King Park spectator protection and safety fencing 120,000 0 0 0 0 120,000 Tree Planting 15,000 15,000 15,000 15,000 15,000 75,000 Art in the Park 10,000 10,000 10,000 10,000 10,000 50,000 Security cameras- various park facilities 30,000 0 0 0 0 30,000 Total 300,000 25,000 600,000 325,000 325,000 1,575,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 70,000 Park Dedication Fund 300,000 25,000 600,000 325,000 325,000 1,575,000 1,600,000 Total 300,000 25,000 600,000 325,000 325,000 1,575,000 Produced Using Plan-It CIP Software Page 68Page 698 of 899 Parks Major Maintenance - Courts 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-20 Project Name Parks Major Maintenance - Courts Total Project Cost $368,345 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance Department Park Maintenance Funding Description Park Improvement Fund Description Includes funding to resurface and restripe basketball, pickleball, and tennis courts. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 13,845 Bunker Hill 0 30,000 0 0 0 30,000 232,100 Pinnacle Reserve Park 0 0 0 0 22,200 22,200 Cedar Crossing Park 0 0 12,000 0 0 12,000 Jaycee Park 0 0 10,000 0 0 10,000 Fieldstone Park 0 0 0 0 9,000 9,000 Chadwick Park 0 0 0 0 9,000 9,000 Kensington Park 0 0 0 0 9,000 9,000 Village Creek Park 7,000 0 0 0 0 7,000 North Creek Park 0 0 0 0 2,200 2,200 Foxborough Park 0 0 0 2,000 0 2,000 Greenridge Park 0 0 0 2,000 0 2,000 Bassett Park 0 0 0 2,000 0 2,000 Rolling Oaks Park 0 0 0 2,000 0 2,000 Hypointe Crossing Park 0 0 0 2,000 0 2,000 Highview Heights 0 0 0 2,000 0 2,000 Total 7,000 30,000 22,000 12,000 51,400 122,400 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 13,845 Park & Trail Improvement Fund 7,000 30,000 22,000 12,000 51,400 122,400 232,100 Total 7,000 30,000 22,000 12,000 51,400 122,400 Produced Using Plan-It CIP Software Page 69Page 699 of 899 Kenrick Trail Sheet Pile, Wall, & Trail Repairs 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-21 Project Name Kenrick Trail Sheet Pile, Wall, & Trail Repairs Total Project Cost $275,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Maintenance Department Park Maintenance Funding Description Park & Trail Improvement Fund Description The I-35 fishing bridge access sidewalk is failing from water levels behind the current retaining wall. Staff have worked with WSB consulting to complete testing of the area and have determined a new sheet pile retaining wall will be required to support the concrete sidewalk. The project will result in a safe, ADA compliant access to the fishing pier. Expenditures 2026 2027 2028 2029 2030 Total Trail repairs 275,000 0 0 0 0 275,000 Total 275,000 0 0 0 0 275,000 Funding Sources 2026 2027 2028 2029 2030 Total Park & Trail Improvement Fund 275,000 0 0 0 0 275,000 Total 275,000 0 0 0 0 275,000 Location Produced Using Plan-It CIP Software Page 70Page 700 of 899 192nd St Retaining Wall & Trail Reconstruction 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-22 Project Name 192nd St Retaining Wall & Trail Reconstruction Total Project Cost $55,000 Contact Mark Kruse, Parks Superintendent Cost Type Parks Type Reconstruction/Maintenance Department Park Maintenance Funding Description Park & Trail Improvement Fund Description The small block retaining wall located on 192nd Street is failing. The retaining wall maintains the elevation difference between the trail and roadway and a private residence backyard. The project includes replacement of the retaining wall to ensure the private property is not impacted and related trail replacement along the retaining wall. Expenditures 2026 2027 2028 2029 2030 Total Trail costs (rehabilitation/reconstruction)55,000 0 0 0 0 55,000 Total 55,000 0 0 0 0 55,000 Funding Sources 2026 2027 2028 2029 2030 Total Park & Trail Improvement Fund 55,000 0 0 0 0 55,000 Total 55,000 0 0 0 0 55,000 Location Produced Using Plan-It CIP Software Page 71Page 701 of 899 Parks System Master Plan 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-23 Project Name Parks System Master Plan Total Project Cost $156,800 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type Other Department Park Dedication Funding Description Park Dedication Fund Description The 2026-2036 Parks System Master Plan will serve as a long-term strategic document that guides the growth, development and enhancement of the parks and recreation system within the City of Lakeville. The goal of the plan is to ensure that the parks system is efficient, sustainable, inclusive and responsive to the needs of the community, with a focus on improving the quality of life, recreational opportunities and environmental stewardship. Prior Expenditures 2026 2027 2028 2029 2030 Total 65,500 Planning/Design 91,300 0 0 0 0 91,300 Total 91,300 0 0 0 0 91,300 Prior Funding Sources 2026 2027 2028 2029 2030 Total 65,500 Park Dedication Fund 91,300 0 0 0 0 91,300 Total 91,300 0 0 0 0 91,300 Produced Using Plan-It CIP Software Page 72Page 702 of 899 Parks - New Parking Lots & Expansions 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-24 Project Name Parks - New Parking Lots & Expansions Total Project Cost $300,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type New construction Department Park Dedication Funding Description Park Dedication Fund Description Parking lot projects at Capserson park includes paving the existing gravel lot used for soccer decks, the mountain bike course and overflow parking for the performance stage. By paving this lot, we anticipate increasing capacity by at least 20%. Expenditures 2026 2027 2028 2029 2030 Total Casperson Park 300,000 0 0 0 0 300,000 Total 300,000 0 0 0 0 300,000 Funding Sources 2026 2027 2028 2029 2030 Total Park Dedication Fund 300,000 0 0 0 0 300,000 Total 300,000 0 0 0 0 300,000 Location Produced Using Plan-It CIP Software Page 73Page 703 of 899 S.W. Corner of 210th Street & I- 35 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #P-25 Project Name S.W. Corner of 210th Street & I-35 Total Project Cost $1,000,000 Contact Joseph Masiarchin, Parks Director Cost Type Parks Type New construction Department Park Dedication Description The existing Parks, Trails and Open Spaces plan calls for a future neighborhood park in the area of 210th street and I-35. Expenditures 2026 2027 2028 2029 2030 Total Future Planning/Design 0 0 0 0 75,000 75,000 925,000 Total 0 0 0 0 75,000 75,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Park Dedication Fund 0 0 0 0 75,000 75,000 925,000 Total 0 0 0 0 75,000 75,000 Location Produced Using Plan-It CIP Software Page 74Page 704 of 899 Technology - General Government 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-01 Project Name Technology - General Government Total Project Cost $238,586 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for the City. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 18,109 42,709 8,592 11,613 36,783 117,806 120,780 Total 18,109 42,709 8,592 11,613 36,783 117,806 Funding Sources 2026 2027 2028 2029 2030 Total Future Technology Fund 18,109 42,709 8,592 11,613 36,783 117,806 120,780 Total 18,109 42,709 8,592 11,613 36,783 117,806 Technology- Public Safety 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-02 Project Name Technology-Public Safety Total Project Cost $1,188,724 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for the City. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 167,489 71,335 123,022 199,705 41,561 603,112 585,612 Total 167,489 71,335 123,022 199,705 41,561 603,112 Funding Sources 2026 2027 2028 2029 2030 Total Future Technology Fund 167,489 71,335 123,022 199,705 41,561 603,112 585,612 Total 167,489 71,335 123,022 199,705 41,561 603,112 Produced Using Plan-It CIP Software Page 75Page 705 of 899 Technology- Public Works 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-03 Project Name Technology-Public Works Total Project Cost $143,709 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for the City. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 24,044 8,451 6,084 20,109 13,579 72,267 71,442 Total 24,044 8,451 6,084 20,109 13,579 72,267 Funding Sources 2026 2027 2028 2029 2030 Total Future Technology Fund 24,044 8,451 6,084 20,109 13,579 72,267 71,442 Total 24,044 8,451 6,084 20,109 13,579 72,267 Technology- Arenas 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-04 Project Name Technology-Arenas Total Project Cost $22,829 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for Lakeville Arenas. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 3,142 3,303 1,739 1,457 2,075 11,716 11,113 Total 3,142 3,303 1,739 1,457 2,075 11,716 Funding Sources 2026 2027 2028 2029 2030 Total Future Arenas 3,142 3,303 1,739 1,457 2,075 11,716 11,113 Total 3,142 3,303 1,739 1,457 2,075 11,716 Produced Using Plan-It CIP Software Page 76Page 706 of 899 Technology- Communications 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-05 Project Name Technology-Communications Total Project Cost $19,420 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for the City. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 2,597 2,513 0 0 848 5,958 13,462 Total 2,597 2,513 0 0 848 5,958 Funding Sources 2026 2027 2028 2029 2030 Total Future Communications Fund 2,597 2,513 0 0 848 5,958 13,462 Total 2,597 2,513 0 0 848 5,958 Technology- Liquor 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-06 Project Name Technology-Liquor Total Project Cost $376,211 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for the City. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - IT infrastructure 51,500 53,045 54,636 0 0 159,181 123,673 Technology - computers/hardware acquisitions 7,045 68,636 570 0 17,106 93,357 Total 58,545 121,681 55,206 0 17,106 252,538 Funding Sources 2026 2027 2028 2029 2030 Total Future Liquor Fund 58,545 121,681 55,206 0 17,106 252,538 123,673 Total 58,545 121,681 55,206 0 17,106 252,538 Produced Using Plan-It CIP Software Page 77Page 707 of 899 Technology- Environmental Resources 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-07 Project Name Technology-Environmental Resources Total Project Cost $19,973 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for the City. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 0 4,010 4,383 0 848 9,241 10,732 Total 0 4,010 4,383 0 848 9,241 Funding Sources 2026 2027 2028 2029 2030 Total Future Environmental Resources Fund 0 4,010 4,383 0 848 9,241 10,732 Total 0 4,010 4,383 0 848 9,241 Technology- Utilities 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-08 Project Name Technology-Utilities Total Project Cost $66,116 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Description The Technology Fund accounts for the accumulation and disbursement of funds for the purchase of technology equipment for the City. Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 1,449 8,244 7,534 1,900 1,257 20,384 38,269 Technology - IT infrastructure 7,463 0 0 0 0 7,463 Total 8,912 8,244 7,534 1,900 1,257 27,847 Funding Sources 2026 2027 2028 2029 2030 Total Future Sanitary Sewer Operating Fund 4,456 4,122 3,767 950 629 13,924 38,269 Water Operating Fund 4,456 4,122 3,767 950 628 13,923 Total 8,912 8,244 7,534 1,900 1,257 27,847 Produced Using Plan-It CIP Software Page 78Page 708 of 899 Technology- Parks & recreation 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-09 Project Name Technology- Parks & recreation Total Project Cost $113,064 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Expenditures 2026 2027 2028 2029 2030 Total Future Technology - computers/hardware acquisitions 12,915 7,169 19,558 10,210 5,120 54,972 58,092 Total 12,915 7,169 19,558 10,210 5,120 54,972 Funding Sources 2026 2027 2028 2029 2030 Total Future Technology Fund 12,915 7,169 19,558 10,210 5,120 54,972 58,092 Total 12,915 7,169 19,558 10,210 5,120 54,972 Technology- Network infrastructure 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-10 Project Name Technology-Network infrastructure Total Project Cost $2,648,110 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Expenditures 2026 2027 2028 2029 2030 Total Future Technology - IT infrastructure 63,760 217,067 511,786 0 186,142 978,755 1,669,355 Total 63,760 217,067 511,786 0 186,142 978,755 Funding Sources 2026 2027 2028 2029 2030 Total Future Technology Fund 45,497 130,067 373,786 0 137,142 686,492 1,669,355 Liquor Fund 9,795 47,000 74,000 0 26,000 156,795 Water Operating Fund 3,044 14,500 23,000 0 8,000 48,544 Sanitary Sewer Operating Fund 3,043 14,500 23,000 0 8,000 48,543 Communications Fund 1,311 6,000 10,000 0 4,000 21,311 Environmental Resources Fund 1,070 5,000 8,000 0 3,000 17,070 Total 63,760 217,067 511,786 0 186,142 978,755 Produced Using Plan-It CIP Software Page 79Page 709 of 899 Technology- Miscellaneous 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #T-11 Project Name Technology-Miscellaneous Total Project Cost $126,657 Contact Trevor Stewart, IT Manager Cost Type Technology Type Technology Expenditures 2026 2027 2028 2029 2030 Total Technology - IT other 5,150 116,043 5,464 0 0 126,657 Total 5,150 116,043 5,464 0 0 126,657 Funding Sources 2026 2027 2028 2029 2030 Total Technology Fund 5,150 116,043 5,464 0 0 126,657 Total 5,150 116,043 5,464 0 0 126,657 Produced Using Plan-It CIP Software Page 80Page 710 of 899 Freight Rail Car Storage Facility 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #22-16 Project Name Freight Rail Car Storage Facility Total Project Cost $8,350,000 Contact Zach Johnson, City Engineer Cost Type Transportation Type Other Department Engineering Funding Description Improvement Construction Description Programmed for 2026 construction. The City was awarded $750,000 in Federal Funding (Fiscal Year 2023) for engineering design and $7,000,000 in State Funding for construction. Project includes construction of a 90-car storage yard, and a 30-car transload facility within the City’s industrial parks, south of CSAH 70. Prior Expenditures 2026 2027 2028 2029 2030 Total 150,000 Construction 8,200,000 0 0 0 0 8,200,000 Total 8,200,000 0 0 0 0 8,200,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 150,000 Other funding- State 7,000,000 0 0 0 0 7,000,000 Other funding- Federal 750,000 0 0 0 0 750,000 Sanitary Sewer Trunk Fund 250,000 0 0 0 0 250,000 Stormwater Infrastructure Fund 200,000 0 0 0 0 200,000 Total 8,200,000 0 0 0 0 8,200,000 Location Produced Using Plan-It CIP Software Page 81Page 711 of 899 Holyoke/Highview Avenue Reconstruction 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #25-05 Project Name Holyoke/Highview Avenue Reconstruction Total Project Cost $10,115,000 Contact Zach Johnson, City Engineer Cost Type Transportation Type Rehabilitation Department Engineering Funding Description Municipal State Aid Description Phase I: Heritage Drive to South of 190th Street Phase II: South of 190th Street to Dodd Boulevard/CSAH 9 Phase I programmed for 2029 construction. Project includes road rehabilitation and modernization, intersection improvements and a pedestrian underpass. Phase II programmed for 2032 construction. Project includes road rehabilitation and modernization and intersection improvements and a pedestrian underpass. Expenditures 2026 2027 2028 2029 2030 Total Future Construction 0 0 1,955,000 4,200,000 0 6,155,000 1,255,000 Construction- New trails 0 0 0 1,200,000 0 1,200,000 Construction- Stormwater infrastructure (new)0 0 0 1,035,000 0 1,035,000 Trail costs (rehabilitation/reconstruction)0 0 0 200,000 0 200,000 Construction- Sanitary Sewer infrastructure (repair/replace)0 0 0 145,000 0 145,000 Construction- Water infrastructure (repair/replace)0 0 0 75,000 0 75,000 Streetlight costs 0 0 0 50,000 0 50,000 Total 0 0 1,955,000 6,905,000 0 8,860,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Municipal State Aid 0 0 1,955,000 3,192,400 0 5,147,400 1,255,000 Park Dedication Fund 0 0 0 1,200,000 0 1,200,000 Stormwater Infrastructure Fund 0 0 0 1,035,000 0 1,035,000 Escrows 0 0 0 657,600 0 657,600 MSA/MSA Bonds - Sp. Assess.0 0 0 350,000 0 350,000 Park & Trail Improvement Fund 0 0 0 200,000 0 200,000 Sanitary Sewer Operating Fund 0 0 0 145,000 0 145,000 Water Operating Fund 0 0 0 75,000 0 75,000 Streetlight Operating Fund 0 0 0 50,000 0 50,000 Total 0 0 1,955,000 6,905,000 0 8,860,000 Produced Using Plan-It CIP Software Page 82Page 712 of 899 Location Produced Using Plan-It CIP Software Page 83Page 713 of 899 CSAH 9 Extension (to CSAH Standards) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #25-19 Project Name CSAH 9 Extension (to CSAH Standards) Total Project Cost $1,000,000 Contact Zach Johnson, City Engineer Cost Type Transportation Type Extension Department Engineering Funding Description Improvement Construction County Project #97-231 SA/SAP #N/A JPA #TBD Description Future CSAH 9 from a) Embers Avenue to Ellsworth Drive, and b) Eagleview Drive to Draft Horse Boulevard. The roadway improvements will be constructed with developer-installed public improvements with the Pheasant Run of Lakeville Eighth Addition and Brookeshire 4th Additions, respectively, to County State Aid Highway standards. The alignment is consistent with Alignment B (between Highview Avenue and MN-3), as identified in the East/West Corridor Preservation Study Phase 2 - Refinement of Preferred System Plan (2006) Prior Expenditures 2026 2027 2028 2029 2030 Total 500,000 Construction 500,000 0 0 0 0 500,000 Total 500,000 0 0 0 0 500,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 500,000 Dakota County 500,000 0 0 0 0 500,000 Total 500,000 0 0 0 0 500,000 Location Produced Using Plan-It CIP Software Page 84Page 714 of 899 CSAH 9 Modernization (210th St - CSAH 50) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #26-04 Project Name CSAH 9 Modernization (210th St - CSAH 50) Total Project Cost $12,495,550 Contact Zach Johnson, City Engineer Cost Type Transportation Type Modernization Department Engineering Funding Description Municipal State Aid County Project #09-065 SA/SAP #TBD Description Modernization of CSAH 9 (Dodd Bouelvard) between 210th Street and CSAH 50 (202nd Street). Project includes a 2-lane divided highway and trails along both sides, with drainage and safety improvements. Prior Expenditures 2026 2027 2028 2029 2030 Total 900,000 Construction 0 9,604,300 0 0 0 9,604,300 Right of Way- Acquisition/Professional fees 1,991,250 0 0 0 0 1,991,250 Total 1,991,250 9,604,300 0 0 0 11,595,550 Prior Funding Sources 2026 2027 2028 2029 2030 Total 900,000 Dakota County 1,721,250 7,989,300 0 0 0 9,710,550 Municipal State Aid 270,000 917,971 0 0 0 1,187,971 Escrows 0 292,029 0 0 0 292,029 Stormwater Infrastructure Fund 0 250,000 0 0 0 250,000 Park Dedication Fund 0 97,500 0 0 0 97,500 General Fund 0 40,000 0 0 0 40,000 Streetlight Operating Fund 0 10,000 0 0 0 10,000 Sanitary Sewer Operating Fund 0 5,000 0 0 0 5,000 Water Operating Fund 0 2,500 0 0 0 2,500 Total 1,991,250 9,604,300 0 0 0 11,595,550 Produced Using Plan-It CIP Software Page 85Page 715 of 899 Location Interstate 35/CSAH 50 Interchange Reconstruction 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #26-05 Project Name Interstate 35/CSAH 50 Interchange Reconstruction Total Project Cost $4,858,026 Contact Zach Johnson, City Engineer Cost Type Transportation Type Interchange Reconstruction Department Engineering Funding Description Municipal State Aid County Project #50-033 SA/SAP #019-650-021 Description Reconstruction of the interchange at I-35 and CSAH 5/50 (Kenwood Trail). The existing interchange is deficient in capacity, sight distance and turn lanes, resulting in delays and safety issues. This project includes replacement of the I-35 bridges over CSAH 5/50 and construction of a northbound auxiliary lane along I-35 between CSAH 5/50 and CSAH 46. Produced Using Plan-It CIP Software Page 86Page 716 of 899 Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 2,103,750 0 0 2,103,750 Dakota County (County share of repayment of 2017 and 2021/2022 RALF Loans)0 0 1,478,161 0 0 1,478,161 MSA- Repay County Advance 0 0 0 840,263 0 840,263 Engineering/Design/Other costs 840,263 0 0 0 0 840,263 Municipal State Aid (City share of repayment of 2017 and 2021/2022 RALF loans)0 0 260,852 0 0 260,852 Stormwater Infrastructure 0 0 135,000 0 0 135,000 Fiber Conduit (Park Dedication Fund)0 0 10,000 0 0 10,000 Fiber conduit (Weather Siren)0 0 10,000 0 0 10,000 Fiber Conduit (Lift Station)0 0 10,000 0 0 10,000 Fiber conduit (Well/tower)0 0 10,000 0 0 10,000 Dakota County- Advance funding of city share 0 0 0 -840,263 0 -840,263 Total 840,263 0 4,017,763 0 0 4,858,026 Funding Sources 2026 2027 2028 2029 2030 Total Dakota County- Advance funding of city share 840,263 0 2,103,750 -840,263 0 2,103,750 Dakota County 0 0 1,478,161 0 0 1,478,161 Municipal State Aid 0 0 260,852 840,263 0 1,101,115 Stormwater Infrastructure Fund 0 0 135,000 0 0 135,000 General Fund 0 0 10,000 0 0 10,000 Park Dedication Fund 0 0 10,000 0 0 10,000 Water Trunk Fund 0 0 10,000 0 0 10,000 Sanitary Sewer Trunk Fund 0 0 10,000 0 0 10,000 Total 840,263 0 4,017,763 0 0 4,858,026 Location Produced Using Plan-It CIP Software Page 87Page 717 of 899 CSAH 50 and Hamburg Avenue RAB 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #26-06 Project Name CSAH 50 and Hamburg Avenue RAB Total Project Cost $30,000 Contact Zach Johnson, City Engineer Cost Type Transportation Type Roundabout Department Engineering Funding Description Municipal State Aid County Project #50-037 SA/SAP #019-650-024 JPA #DCA22893 Description Programmed for 2026 construction as a single-lane roundabout. Dakota County responsible for 100% of project cost per future Joint Powers Agreement. City is only anticipating contributing costs toward streetlights at this time. Expenditures 2026 2027 2028 2029 2030 Total Streetlight costs 30,000 0 0 0 0 30,000 Total 30,000 0 0 0 0 30,000 Funding Sources 2026 2027 2028 2029 2030 Total Streetlight Operating Fund 30,000 0 0 0 0 30,000 Total 30,000 0 0 0 0 30,000 Location Produced Using Plan-It CIP Software Page 88Page 718 of 899 CSAH 60 Alignment Study (CSAH 23 - Flagstaff Ave) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #26-07 Project Name CSAH 60 Alignment Study (CSAH 23 - Flagstaff Ave) Total Project Cost $94,500 Contact Zach Johnson, City Engineer Cost Type Transportation Type Other Department Engineering Funding Description Pavement Management County Project #97-229 SA/SAP #N/A Description Preliminary engineering for future County Highway alignment between the intersections of CSAH 23 (Cedar Avenue)/CSAH 60 (185th Street) and CR 64 (195th Street)/Flagstaff Avenue. The corridor study will recommend preferred alignments. Expenditures 2026 2027 2028 2029 2030 Total Engineering/Design/Other costs 94,500 0 0 0 0 94,500 Total 94,500 0 0 0 0 94,500 Funding Sources 2026 2027 2028 2029 2030 Total Pavement Management Fund 94,500 0 0 0 0 94,500 Total 94,500 0 0 0 0 94,500 Location Produced Using Plan-It CIP Software Page 89Page 719 of 899 CSAH 50/CSAH 60 RAB Modifications 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #26-08 Project Name CSAH 50/CSAH 60 RAB Modifications Total Project Cost $1 Contact Zach Johnson, City Engineer Cost Type Transportation Type Maintenance/Improvement Department Engineering Funding Description Municipal State Aid County Project #50-038 SA/SAP #TBD JPA #TBD Description County-led safety improvement designed to improve pedestrian, bicyclist and vehicle safety. Project includes pavement markings and sign modifications. Expenditures 2026 2027 2028 2029 2030 Total Construction 1 0 0 0 0 1 Total 1 0 0 0 0 1 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 1 0 0 0 0 1 Total 1 0 0 0 0 1 Location Produced Using Plan-It CIP Software Page 90Page 720 of 899 Lake Marion Greenway 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #26-15 Project Name Lake Marion Greenway Total Project Cost $8,272,500 Contact Zach Johnson, City Engineer Cost Type Transportation Type Greenway Department Park Dedication Funding Description Park Dedication Fund County Project #2000453 SA/SAP #N/A JPA #TBD Description Trail improvements to existing local network in coordination with jurisdictional transfer to Dakota County for Lake Marion Greenway. Prior Expenditures 2026 2027 2028 2029 2030 Total 190,000 Segment A-Ritter Farm Park to Downtown 3,600,000 0 0 0 0 3,600,000 Segment C- Downtown to Cedar Ave 0 0 0 325,000 1,800,000 2,125,000 Segment D- Murphy Hanrehan Park to Ritter Farm Park 0 0 0 80,000 1,080,000 1,160,000 Lake Marion Greenway Trailhead Shelter/Restrooms 650,000 0 0 0 0 650,000 Segment E- CSAH 23 to CSAH 31 0 0 150,000 0 0 150,000 Ritter Farm parking lot/roadway improvements 150,000 0 0 0 0 150,000 Fiber Conduit (Park Dedication Fund)90,000 0 0 0 0 90,000 Fiber Conduit (Lift Station)90,000 0 0 0 0 90,000 Segment B- Downtown 0 67,500 0 0 0 67,500 Total 4,580,000 67,500 150,000 405,000 2,880,000 8,082,500 Prior Funding Sources 2026 2027 2028 2029 2030 Total 190,000 Dakota County 1,953,000 0 0 344,250 2,448,000 4,745,250 Other funding- State 2,047,000 0 0 0 0 2,047,000 Park Dedication Fund 490,000 0 150,000 60,750 432,000 1,132,750 Sanitary Sewer Trunk Fund 90,000 0 0 0 0 90,000 Pavement Management Fund 0 67,500 0 0 0 67,500 Total 4,580,000 67,500 150,000 405,000 2,880,000 8,082,500 Produced Using Plan-It CIP Software Page 91Page 721 of 899 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project # 26-15 Contact Zach Johnson, City Engineer Project Name Lake Marion Greenway Cost Type Transportation Produced Using Plan-It CIP Software Page 92Page 722 of 899 CSAH 5 and Kenyon Avenue Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #27-05 Project Name CSAH 5 and Kenyon Avenue Traffic Signal Total Project Cost $472,500 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #05-060 SA/SAP #TBD JPA #TBD Description New traffic signal designed to alleviate congestion and optimize intersection operations. County-led project includes geometric improvements and pavement markings. City cost-share per Dakota County Highway Cost Share Policy F.4.1 (Dakota County 2040 Transportation Plan), Prior Expenditures 2026 2027 2028 2029 2030 Total 67,500 Construction 0 405,000 0 0 0 405,000 Total 0 405,000 0 0 0 405,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 67,500 Municipal State Aid 0 405,000 0 0 0 405,000 Total 0 405,000 0 0 0 405,000 Location Produced Using Plan-It CIP Software Page 93Page 723 of 899 CSAH 31 and CSAH 46 Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #27-06 Project Name CSAH 31 and CSAH 46 Traffic Signal Total Project Cost $1 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #31-125 SA/SAP #TBD JPA #TBD Description Replacement of existing traffic signal that is approaching the end of its useful life. City cost-share per Dakota County Highway Cost Share Policy F.4.2 (Dakota County 2040 Transportation Plan). Expenditures 2026 2027 2028 2029 2030 Total Construction 0 1 0 0 0 1 Total 0 1 0 0 0 1 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 0 1 0 0 0 1 Total 0 1 0 0 0 1 Location Produced Using Plan-It CIP Software Page 94Page 724 of 899 CSAH 60 and Orchard Trail Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #27-07 Project Name CSAH 60 and Orchard Trail Traffic Signal Total Project Cost $476,156 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #60-029 SA/SAP #TBD JPA #TBD Description New traffic signal designed to alleviate congestion and optimize intersection operations. County-led project includes geometric improvements and pavement markings. City cost-share per Dakota County Highway Cost Share Policy F.4.1 (Dakota County 2040 Transportation Plan) Expenditures 2026 2027 2028 2029 2030 Total Construction 0 396,000 0 0 0 396,000 Traffic signal- Design/ROW 80,156 0 0 0 0 80,156 Total 80,156 396,000 0 0 0 476,156 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 80,156 396,000 0 0 0 476,156 Total 80,156 396,000 0 0 0 476,156 Location Produced Using Plan-It CIP Software Page 95Page 725 of 899 CSAH 23 M&O (CSAH 9 to CSAH 42) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #27-09 Project Name CSAH 23 M&O (CSAH 9 to CSAH 42) Total Project Cost $1 Contact Zach Johnson, City Engineer Cost Type Transportation Type Maintenance Department Engineering Funding Description Municipal State Aid County Project #23-088 SA/SAP #TBD Description Mill and overlay of CSAH 23 (Cedar Avenue) from CSAH 9 (179th Street) to CSAH 42 (150th Street).The project will include pavement preservation and ADA improvements. Expenditures 2026 2027 2028 2029 2030 Total Construction 0 1 0 0 0 1 Total 0 1 0 0 0 1 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 0 1 0 0 0 1 Total 0 1 0 0 0 1 Location Produced Using Plan-It CIP Software Page 96Page 726 of 899 CSAH 9 and Glacier Way Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #27-11 Project Name CSAH 9 and Glacier Way Traffic Signal Total Project Cost $1,093,751 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #09-069 SA/SAP #TBD JPA #TBD Description New traffic signal designed to alleviate congestion and optimize intersection operations. City-led project includes geometric improvements and pavement markings. City cost-share per Dakota County Highway Cost Share Policy F.4.1 (Dakota County 2040 Transportation Plan) Expenditures 2026 2027 2028 2029 2030 Total Construction 0 880,000 0 0 0 880,000 Traffic signal- Design/ROW 213,751 0 0 0 0 213,751 Total 213,751 880,000 0 0 0 1,093,751 Funding Sources 2026 2027 2028 2029 2030 Total Dakota County 117,563 484,000 0 0 0 601,563 Municipal State Aid 96,188 326,000 0 0 0 422,188 Escrows 0 70,000 0 0 0 70,000 Total 213,751 880,000 0 0 0 1,093,751 Location Produced Using Plan-It CIP Software Page 97Page 727 of 899 CSAH 9/Dodd Blvd Modernization (215th St- 210th St) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #28-04 Project Name CSAH 9/Dodd Blvd Modernization (215th St-210th St) Total Project Cost $5,800,000 Contact Zach Johnson, City Engineer Cost Type Transportation Type Modernization Department Engineering Funding Description Municipal State Aid County Project #09-067 SA/SAP #TBD Description Modernization of CSAH 9 (Dodd Bouelvard) between CSAH 70 (215th Street) and 210th Street. Project includes a 2-lane divided highway and trails along both sides, with drainage and safety improvements. City cost-share per Dakota County Highway Cost Share Policy F.1 (Dakota County 2040 Transportation Plan). Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 4,400,000 0 0 4,400,000 Right of Way- Acquisition/Professional fees 0 750,000 0 0 0 750,000 Engineering/Design/Other costs 650,000 0 0 0 0 650,000 Total 650,000 750,000 4,400,000 0 0 5,800,000 Funding Sources 2026 2027 2028 2029 2030 Total Dakota County 552,500 637,500 3,740,000 0 0 4,930,000 Municipal State Aid 97,500 112,500 434,000 0 0 644,000 Escrows 0 0 196,000 0 0 196,000 Park Dedication Fund 0 0 30,000 0 0 30,000 Total 650,000 750,000 4,400,000 0 0 5,800,000 Location Produced Using Plan-It CIP Software Page 98Page 728 of 899 CSAH 46 and Foliage Avenue Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #28-06 Project Name CSAH 46 and Foliage Avenue Traffic Signal Total Project Cost $260,156 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #46-065 SA/SAP #TBD JPA #TBD Description Replacement of existing traffic signal that is approaching the end of its useful life. City cost-share per Dakota County Highway Cost Share Policy F.4.2 (Dakota County 2040 Transportation Plan). Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 253,125 0 0 253,125 Traffic signal- Design/ROW 0 7,031 0 0 0 7,031 Total 0 7,031 253,125 0 0 260,156 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 0 7,031 253,125 0 0 260,156 Total 0 7,031 253,125 0 0 260,156 Location Produced Using Plan-It CIP Software Page 99Page 729 of 899 CSAH 46 and Galaxie Avenue Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #28-07 Project Name CSAH 46 and Galaxie Avenue Traffic Signal Total Project Cost $267,187 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #46-064 SA/SAP #TBD JPA #TBD Description Replacement of existing traffic signal that is approaching the end of its useful life. City cost-share per Dakota County Highway Cost Share Policy F.4.2 (Dakota County 2040 Transportation Plan). Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 253,125 0 0 253,125 Traffic signal- Design/ROW 0 14,062 0 0 0 14,062 Total 0 14,062 253,125 0 0 267,187 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 0 14,062 253,125 0 0 267,187 Total 0 14,062 253,125 0 0 267,187 Location Produced Using Plan-It CIP Software Page 100Page 730 of 899 CSAH 9 Improvements at 194th St & 190th St 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #29-04 Project Name CSAH 9 Improvements at 194th St & 190th St Total Project Cost $1,944,938 Contact Zach Johnson, City Engineer Cost Type Transportation Type Maintenance/Improvement Department Engineering Funding Description Municipal State Aid County Project #09-068 SA/SAP #TBD JPA #TBD Description Construction of new intersection control at the CSAH 9 (Dodd Boulevard) and 194th Street/Indiana Avenue intersection. City cost-share per Dakota County Highway Cost Share Policy F.4/F.13 (Dakota County 2040 Transportation Plan). Construction of directional access median at the CSAH 9 (Dodd Boulevard) and 190th Street intersection. City cost-share per Dakota County Highway Cost Share Policy F.15 (Dakota County 2040 Transportation Plan). Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 0 1,701,000 0 1,701,000 Engineering/Design/Other costs 0 168,000 0 0 0 168,000 Right of Way- Acquisition/Professional fees 0 0 75,938 0 0 75,938 Total 0 168,000 75,938 1,701,000 0 1,944,938 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 0 168,000 75,938 1,701,000 0 1,944,938 Total 0 168,000 75,938 1,701,000 0 1,944,938 Location Produced Using Plan-It CIP Software Page 101Page 731 of 899 CSAH 23 Alignment Study (Griffon Tr - 135th St) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #29-05 Project Name CSAH 23 Alignment Study (Griffon Tr - 135th St) Total Project Cost $31,500 Contact Zach Johnson, City Engineer Cost Type Transportation Type Other Department Engineering Funding Description Municipal State Aid County Project #23-089 SA/SAP #N/A Description Preliminary engineering for CSAH 23 (Cedar Avenue) from Griffon Trail/Upper 164th Street to 135th Street. The corridor study will determine best practices to manage future traffic growth, and recommend pedestrian and corridor safety improvements, and potential grade-separated intersections. Expenditures 2026 2027 2028 2029 2030 Total Engineering/Design/Other costs 0 0 0 31,500 0 31,500 Total 0 0 0 31,500 0 31,500 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 0 0 0 31,500 0 31,500 Total 0 0 0 31,500 0 31,500 Location Produced Using Plan-It CIP Software Page 102Page 732 of 899 CSAH 46 and Lac Lavon/Interlachen Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #30-05 Project Name CSAH 46 and Lac Lavon/Interlachen Traffic Signal Total Project Cost $638,437 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #46-066 SA/SAP #TBD JPA #TBD Description Replacement of existing traffic signal that is approaching the end of its useful life. City cost-share per Dakota County Highway Cost Share Policy F.4.2 (Dakota County 2040 Transportation Plan). Expenditures 2026 2027 2028 2029 2030 Total Construction 0 0 0 0 534,375 534,375 Traffic signal- Design/ROW 0 0 104,062 0 0 104,062 Total 0 0 104,062 0 534,375 638,437 Funding Sources 2026 2027 2028 2029 2030 Total Municipal State Aid 0 0 104,062 0 534,375 638,437 Total 0 0 104,062 0 534,375 638,437 Location Produced Using Plan-It CIP Software Page 103Page 733 of 899 CSAH 50 and Iberia Avenue Traffic Safety Mgmt 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #31-05 Project Name CSAH 50 and Iberia Avenue Traffic Safety Mgmt Total Project Cost $1,782,500 Contact Zach Johnson, City Engineer Cost Type Transportation Type Maintenance/Improvement Department Engineering Funding Description Municipal State Aid County Project #50-XXX SA/SAP #TBD JPA #TBD Description Construction of traffic safety management improvements at CSAH 50 (202nd Street) and Iberia Avenue intersection. Expenditures 2026 2027 2028 2029 2030 Total Future Engineering/Design/Other costs 0 0 0 140,000 0 140,000 1,575,000 Right of Way- Acquisition/Professional fees 0 0 0 0 67,500 67,500 Total 0 0 0 140,000 67,500 207,500 Funding Sources 2026 2027 2028 2029 2030 Total Future Municipal State Aid 0 0 0 140,000 67,500 207,500 1,575,000 Total 0 0 0 140,000 67,500 207,500 Location Produced Using Plan-It CIP Software Page 104Page 734 of 899 CSAH 60 and Judicial Road Traffic Signal 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #31-09 Project Name CSAH 60 and Judicial Road Traffic Signal Total Project Cost $300,000 Contact Zach Johnson, City Engineer Cost Type Transportation Type Traffic Signal Department Engineering Funding Description Municipal State Aid County Project #60-XXX SA/SAP #TBD JPA #TBD Description New traffic signal system designed to alleviate congestion and optimize intersection operations. Includes geometric improvements and pavement markings. City-led project Owned/maintained by Dakota County/Scott County Expenditures 2026 2027 2028 2029 2030 Total Future Traffic signal- Design/ROW 0 0 0 50,000 0 50,000 250,000 Total 0 0 0 50,000 0 50,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Municipal State Aid 0 0 0 50,000 0 50,000 250,000 Total 0 0 0 50,000 0 50,000 Location Produced Using Plan-It CIP Software Page 105Page 735 of 899 Pavement Management - Maintenance 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #XX-01 Project Name Pavement Management - Maintenance Total Project Cost $33,235,500 Contact Steve Ferraro, Public Works Coordinator Cost Type Transportation Type Maintenance Department Construction Services Funding Description Pavement Management Description Annual preventive maintenance program designed to protect the City’s investment in public street/road infrastructure assets. Best management practices include crack sealing, seal coating, surface sealing, mill and overlay and roadway patching. Associated maintenance activities such as curb and gutter repair, drain tile repair, pavement marking painting, and stormwater infrastructure repair are included. Maintenance is financed primarily through property taxes. A portion of the City’s annual Municipal State Aid (MSA) allotment is applied toward street/road maintenance, with the remaining MSA balance applied toward MSA-designated projects and debt payments on previously issued bonds supporting these projects. The remaining principal and interest balances due on MSA-supported bonds at the end of 2025 will be $3,045,000. The final principal payment will be made in 2036. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 2,650,500 Patching & Minor Overlays 1,710,000 1,760,000 1,830,000 1,900,000 1,935,000 9,135,000 16,180,000 Surface Sealing 375,000 375,000 375,000 375,000 375,000 1,875,000 Crack Seal 200,000 200,000 200,000 200,000 225,000 1,025,000 Construction- Sanitary Sewer infrastructure (repair/replace)100,000 100,000 100,000 100,000 100,000 500,000 Construction- Water infrastructure (repair/replace)100,000 100,000 100,000 100,000 100,000 500,000 Sidewalk ADA 65,000 65,000 65,000 65,000 65,000 325,000 Safety Improvements 50,000 50,000 50,000 50,000 50,000 250,000 Velocity Patching 35,000 50,000 50,000 50,000 50,000 235,000 Concrete Curb & Draintile 30,000 30,000 30,000 30,000 40,000 160,000 County Road Stormwater Infrastructure 30,000 30,000 30,000 30,000 30,000 150,000 Eclipse Ave Outlot A to Greenway 150,000 0 0 0 0 150,000 Bridge Inspections & Repairs 20,000 20,000 20,000 20,000 20,000 100,000 Total 2,865,000 2,780,000 2,850,000 2,920,000 2,990,000 14,405,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 2,650,500 Pavement Management Fund 2,515,000 2,580,000 2,650,000 2,720,000 2,790,000 13,255,000 16,180,000 Sanitary Sewer Operating Fund 100,000 100,000 100,000 100,000 100,000 500,000 Water Operating Fund 100,000 100,000 100,000 100,000 100,000 500,000 Park Dedication Fund 150,000 0 0 0 0 150,000 Total 2,865,000 2,780,000 2,850,000 2,920,000 2,990,000 14,405,000 Produced Using Plan-It CIP Software Page 106Page 736 of 899 Street Reconstruction 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #XX-02 Project Name Street Reconstruction Total Project Cost $24,407,500 Contact Steve Ferraro, Public Works Coordinator Cost Type Transportation Type Reconstruction/Maintenance Department Construction Services Funding Description Improvement Construction Description Annual program designed to extend street life, minimize total life cycle costs, and improve local streets when routine maintenance costs exceed the cost-benefit of the investment or streets approach the end of their life cycle. Citywide OCI goal for local streets is 75. Both rehabilitation (surface sealing/mill and overlay) and reconstruction (reclamation) practices are utilized. Expenditures 2026 2027 2028 2029 2030 Total Construction 3,580,000 3,682,500 4,690,000 4,320,000 4,010,000 20,282,500 Construction- Water infrastructure (repair/replace)470,000 470,000 470,000 470,000 470,000 2,350,000 Construction- Sanitary Sewer infrastructure (repair/replace)250,000 250,000 250,000 250,000 250,000 1,250,000 Construction- Stormwater infrastructure (new)105,000 105,000 105,000 105,000 105,000 525,000 Total 4,405,000 4,507,500 5,515,000 5,145,000 4,835,000 24,407,500 Funding Sources 2026 2027 2028 2029 2030 Total G.O. Improvement Bonds - Taxes (Streets)3,580,000 3,682,500 3,790,000 3,900,000 4,010,000 18,962,500 Water Operating Fund 470,000 470,000 470,000 470,000 470,000 2,350,000 G.O. Improvement Bonds - Sp. Assess.0 0 900,000 420,000 0 1,320,000 Sanitary Sewer Operating Fund 250,000 250,000 250,000 250,000 250,000 1,250,000 Stormwater Infrastructure Fund 105,000 105,000 105,000 105,000 105,000 525,000 Total 4,405,000 4,507,500 5,515,000 5,145,000 4,835,000 24,407,500 Produced Using Plan-It CIP Software Page 107Page 737 of 899 Collector Roadway Rehabilitation 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #XX-03 Project Name Collector Roadway Rehabilitation Total Project Cost $10,266,527 Contact Zach Johnson, City Engineer Cost Type Transportation Type Rehabilitation Department Engineering Funding Description Improvement Construction Description Annual program designed to extend roadway life, minimize total life cycle costs, or improve collector/arterial roads when routine maintenance costs exceed the cost- benefit of the investment or roads approach the end of their life cycle. Citywide OCI goal for collector/arterial roads is 75. Both rehabilitation (mill and overlay) and reconstruction (reclamation) practices are utilized. Expenditures 2026 2027 2028 2029 2030 Total Streets/Storm- Construction/Engineering/Other 971,152 3,710,709 2,043,578 2,130,488 810,600 9,666,527 Construction- Water infrastructure (repair/replace)0 100,000 100,000 50,000 100,000 350,000 Construction- Sanitary Sewer infrastructure (repair/replace)0 25,000 25,000 25,000 25,000 100,000 Construction- New trails 0 100,000 0 0 0 100,000 Construction- Sanitary Sewer infrastructure (new)0 50,000 0 0 0 50,000 Total 971,152 3,985,709 2,168,578 2,205,488 935,600 10,266,527 Funding Sources 2026 2027 2028 2029 2030 Total G.O. Improvement Bonds - Taxes (Streets)485,576 3,380,709 2,043,578 2,085,799 810,600 8,806,262 Other cost share arrangement- Credit River (Judicial Rd)485,576 0 0 0 0 485,576 G.O. Improvement Bonds - Sp. Assess.0 330,000 0 44,689 0 374,689 Water Operating Fund 0 100,000 100,000 50,000 100,000 350,000 Sanitary Sewer Operating Fund 0 25,000 25,000 25,000 25,000 100,000 Park Dedication Fund 0 100,000 0 0 0 100,000 Sanitary Sewer Trunk Fund 0 50,000 0 0 0 50,000 Total 971,152 3,985,709 2,168,578 2,205,488 935,600 10,266,527 Produced Using Plan-It CIP Software Page 108Page 738 of 899 County Pavement Preservation/City Utility Repairs 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #XX-10 Project Name County Pavement Preservation/City Utility Repairs Total Project Cost $95,000 Contact Zach Johnson, City Engineer Cost Type Transportation Type Maintenance Department Engineering Funding Description Water Operating Fund County Project #TBD SA/SAP #N/A JPA #TBD Description Storm sewer, sanitary sewer and water repairs completed in conjunctions with annual Dakota County pavement preservation program. Prior Expenditures 2026 2027 2028 2029 2030 Total 50,000 Construction 0 25,000 0 0 0 25,000 Construction- Sanitary Sewer infrastructure (repair/replace)5,000 5,000 0 0 0 10,000 Construction- Water infrastructure (repair/replace)5,000 5,000 0 0 0 10,000 Total 10,000 35,000 0 0 0 45,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 50,000 Pavement Management Fund 0 25,000 0 0 0 25,000 Water Operating Fund 5,000 5,000 0 0 0 10,000 Sanitary Sewer Operating Fund 5,000 5,000 0 0 0 10,000 Total 10,000 35,000 0 0 0 45,000 Produced Using Plan-It CIP Software Page 109Page 739 of 899 215th Street Public Improvements (CSAH 5- CSAH 70) 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #26-09 Project Name 215th Street Public Improvements (CSAH 5-CSAH 70) Total Project Cost $6,755,000 Contact Zach Johnson, City Engineer Cost Type Utility Type Extension Department Engineering Funding Description Improvement Construction County Project #N/A SA/SAP #N/A JPA #N/A Description Sanitary sewer and water extension along 215th Street from County Road 70 to west of I-35. Project includes reconstruction of 215th Street to a paved two-lane undivided roadway. Expenditures 2026 2027 2028 2029 2030 Total Construction 5,105,000 0 0 0 0 5,105,000 Engineering/Design/Other costs 1,650,000 0 0 0 0 1,650,000 Total 6,755,000 0 0 0 0 6,755,000 Funding Sources 2026 2027 2028 2029 2030 Total G.O. Improvement Bonds - Sp. Assess.5,240,000 0 0 0 0 5,240,000 Sanitary Sewer Trunk Fund 1,215,000 0 0 0 0 1,215,000 Stormwater Infrastructure Fund 200,000 0 0 0 0 200,000 Water Trunk Fund 100,000 0 0 0 0 100,000 Total 6,755,000 0 0 0 0 6,755,000 Location Produced Using Plan-It CIP Software Page 110Page 740 of 899 Sanitary Sewer Trunk Improvements 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-01 Project Name Sanitary Sewer Trunk Improvements Total Project Cost $825,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Department Utilities Funding Description Equipment Fund Description The Sanitary Sewer Plan anticipates the extension of sanitary sewer trunk facilities to serve areas of anticipated/planned growth. Lift Station 26 is under construction in 2025. Timing of sanitary sewer trunk system improvements subject to growth rate and location of planned land development. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 75,000 Construction 75,000 75,000 75,000 75,000 75,000 375,000 375,000 Total 75,000 75,000 75,000 75,000 75,000 375,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 75,000 Sanitary Sewer Trunk Fund 75,000 75,000 75,000 75,000 75,000 375,000 375,000 Total 75,000 75,000 75,000 75,000 75,000 375,000 Produced Using Plan-It CIP Software Page 111Page 741 of 899 Sanitary Sewer Lift Station Rehabilitation 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-02 Project Name Sanitary Sewer Lift Station Rehabilitation Total Project Cost $1,030,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Type Maintenance Department Utilities Funding Description Equipment Fund Description Lift station service life is 12-15 years. Pumps, motors and equipment are inspected, repaired and replaced to ensure uninterrupted service. Lift stations are inspected/cleaned annually and scheduled for rehabilitation every 12-15 years. Prior Expenditures 2026 2027 2028 2029 2030 Total 215,000 Lift Station 7 0 175,000 0 0 0 175,000 Lift Station 5 0 0 0 100,000 0 100,000 Lift Station 20 80,000 0 0 0 0 80,000 Lift Station 3 0 80,000 0 0 0 80,000 Lift Station 22 0 0 75,000 0 0 75,000 Lift Station 6 0 0 75,000 0 0 75,000 Lift Station 19 0 0 0 40,000 0 40,000 Lift Station 11 0 0 0 40,000 0 40,000 Lift Station 12 0 0 0 0 40,000 40,000 Lift Station 13 0 0 0 0 40,000 40,000 Lift Station 18 40,000 0 0 0 0 40,000 Lift Station 8 30,000 0 0 0 0 30,000 Total 150,000 255,000 150,000 180,000 80,000 815,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 215,000 Sanitary Sewer Operating Fund 150,000 255,000 150,000 180,000 80,000 815,000 Total 150,000 255,000 150,000 180,000 80,000 815,000 Produced Using Plan-It CIP Software Page 112Page 742 of 899 Sanitary Sewer Inflow/Infiltration Maintenance 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-03 Project Name Sanitary Sewer Inflow/Infiltration Maintenance Total Project Cost $3,450,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Department Utilities Funding Description Equipment Fund Description Annual program designed to manage peak discharge rates and maintain/extend the overall service life of the sanitary sewer collection system through rehabilitating infrastructure susceptible to inflow and infiltration (groundwater). Public sanitary sewer infrastructure is inspected (televising 250,000 pipe-feet/year) and cleaned (jetting 75 pipe-miles/year) to maintain the integrity and function of the sanitary sewer collection system. Prior Expenditures 2026 2027 2028 2029 2030 Total 575,000 Construction 575,000 575,000 575,000 575,000 575,000 2,875,000 Total 575,000 575,000 575,000 575,000 575,000 2,875,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 575,000 Sanitary Sewer Operating Fund 575,000 575,000 575,000 575,000 575,000 2,875,000 Total 575,000 575,000 575,000 575,000 575,000 2,875,000 Produced Using Plan-It CIP Software Page 113Page 743 of 899 Well Construction 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-04 Project Name Well Construction Total Project Cost $2,950,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Department Utilities Funding Description Equipment Fund Description The Water Plan provides guidance in identifying future water system facilities required to serve areas of planned land development. Well #23 is currently under construction and will be brought online in 2025, and Wells 24 and 25 are programmed for 2028 construction. Construction timing and well location subject to population demand/water needs. The Wellhead and Source Water Protection Plan must be amended prior to receiving a Minnesota Department of Health permit. Expenditures 2026 2027 2028 2029 2030 Total Future Construction 0 0 1,800,000 0 0 1,800,000 1,050,000 Engineering/Design/Other costs 0 100,000 0 0 0 100,000 Total 0 100,000 1,800,000 0 0 1,900,000 Funding Sources 2026 2027 2028 2029 2030 Total Future Water Trunk Fund 0 100,000 1,800,000 0 0 1,900,000 1,050,000 Total 0 100,000 1,800,000 0 0 1,900,000 Watermain Trunk Extensions 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-05 Project Name Watermain Trunk Extensions Total Project Cost $2,915,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Department Utilities Funding Description Water Trunk Fund Description The Water Plan anticipates the extension of watermain trunk facilities to serve areas of planned land development. Timing of watermain trunk system improvements subject to growth rate and location of planned land development. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 265,000 Construction 265,000 265,000 265,000 265,000 265,000 1,325,000 1,325,000 Total 265,000 265,000 265,000 265,000 265,000 1,325,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 265,000 Water Trunk Fund 265,000 265,000 265,000 265,000 265,000 1,325,000 1,325,000 Total 265,000 265,000 265,000 265,000 265,000 1,325,000 Produced Using Plan-It CIP Software Page 114Page 744 of 899 Water Distribution Features 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-06 Project Name Water Distribution Features Total Project Cost $960,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Department Utilities Funding Description Water Trunk Fund Description The Water Plan provides guidance in identifying future water system features required to serve areas of planned land development, including features to either reduce or boost the water pressure due to the elevation of new development. New pressure reducing valves are programmed for 2026, 2028 and 2030 construction. Construction timing and location subject to growth rate and location of planned land development. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 60,000 Construction 150,000 0 150,000 0 150,000 450,000 450,000 Total 150,000 0 150,000 0 150,000 450,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 60,000 Water Trunk Fund 150,000 0 150,000 0 150,000 450,000 450,000 Total 150,000 0 150,000 0 150,000 450,000 Produced Using Plan-It CIP Software Page 115Page 745 of 899 Well and Pump Rehabilitation 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-07 Project Name Well and Pump Rehabilitation Total Project Cost $1,000,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Department Utilities Funding Description Equipment Fund Description Pumps, motors and equipment are inspected, repaired and replaced to ensure uninterrupted, efficient service and a water system operating at maximum pumping capacity. City wells provide water for on-demand distribution system (24 hours/day, 7 days/week). Multiple starts/stops place tremendous stress on the motors and pump components and constant water exposure can lead to corrosion. Well and pumps are scheduled for rehabilitation every 8-10 years, based on pump type. Prior Expenditures 2026 2027 2028 2029 2030 Total 100,000 Well 8 0 0 0 100,000 0 100,000 Well 9 0 0 0 100,000 0 100,000 Well 10 0 0 100,000 0 0 100,000 Well 21 0 100,000 0 0 0 100,000 Well 22 0 100,000 0 0 0 100,000 Well 20 100,000 0 0 0 0 100,000 Well 19 100,000 0 0 0 0 100,000 Well 12 0 0 0 0 100,000 100,000 Well 11 0 0 0 100,000 0 100,000 Total 200,000 200,000 100,000 300,000 100,000 900,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 100,000 Water Operating Fund 200,000 200,000 100,000 300,000 100,000 900,000 Total 200,000 200,000 100,000 300,000 100,000 900,000 Produced Using Plan-It CIP Software Page 116Page 746 of 899 Tower and Reservoir Maintenance 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-08 Project Name Tower and Reservoir Maintenance Total Project Cost $1,300,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Type Maintenance Department Utilities Funding Description Water Operating Fund Description Maintenance program designed to manage, preserve and protect investment in water storage tanks (interior and exterior). Maintenance removes buildup, dirt/dust, and extends the life of the coating system, minimizing total lifecycle costs. Expenditures 2026 2027 2028 2029 2030 Total Construction 1,150,000 0 0 150,000 0 1,300,000 Total 1,150,000 0 0 150,000 0 1,300,000 Funding Sources 2026 2027 2028 2029 2030 Total Water Operating Fund 1,150,000 0 0 150,000 0 1,300,000 Total 1,150,000 0 0 150,000 0 1,300,000 Water meter replacement 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-09 Project Name Water meter replacement Total Project Cost $2,000,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Department Utilities Funding Description Equipment Fund Description Annual program designed to replace residential and commercial water meters approaching the end of their life cycle, to ensure accurate water monitoring use data for Minnesota Department of Natural Resources reporting. Program goal is 1,200 water meter replacements per year (based on meter age) with the intent of meeting/maintaining a 20-year service life. Routine water meter replacement is completed by City Utilities staff. Prior Expenditures 2026 2027 2028 2029 2030 Total 150,000 Equipment purchase 350,000 350,000 350,000 400,000 400,000 1,850,000 Total 350,000 350,000 350,000 400,000 400,000 1,850,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total 150,000 Water Operating Fund 350,000 350,000 350,000 400,000 400,000 1,850,000 Total 350,000 350,000 350,000 400,000 400,000 1,850,000 Produced Using Plan-It CIP Software Page 117Page 747 of 899 Fiber Optic Cable Connection 2026 thru 2030 Capital Improvement Plan Lakeville, MN Project #U-10 Project Name Fiber Optic Cable Connection Total Project Cost $484,000 Contact Shane Quade, Utilities Superintendent Cost Type Utility Type Other Department Utilities Funding Description Equipment Fund Description Extension of fiber optic cable to remote utility sites (lift stations, wells) for better and more reliable communication. Prior Expenditures 2026 2027 2028 2029 2030 Total Future 70,000 Fiber conduit (Well/tower)37,000 37,000 40,000 30,000 40,000 184,000 80,000 Fiber Conduit (Lift Station)25,000 25,000 30,000 30,000 40,000 150,000 Total 62,000 62,000 70,000 60,000 80,000 334,000 Prior Funding Sources 2026 2027 2028 2029 2030 Total Future 70,000 Water Operating Fund 37,000 37,000 40,000 30,000 40,000 184,000 80,000 Sanitary Sewer Operating Fund 25,000 25,000 30,000 30,000 40,000 150,000 Total 62,000 62,000 70,000 60,000 80,000 334,000 Produced Using Plan-It CIP Software Page 118Page 748 of 899 CITY OF LAKEVILLE STREET RECONSTRUCTION PLANProject # Project description: 2026 2027 2028 2029 2030 TotalXX-02Street Reconstruction 3,580,000 3,682,500 4,690,000 4,320,000 4,010,000 20,282,500 XX-03Collector Rehabilitation 485,576 3,710,709 2,043,578 2,130,488 810,600 9,180,951 - - - - - - 4,065,576$ 7,393,209$ 6,733,578$ 6,450,488$ 4,820,600$ 29,463,451$ Page 749 of 899 Capital Improvement Plan & Operating Budget Infrastructure Specific Plans Water System Plan Adopted 2019 Next update 2028 Transportation Plan Adopted 2019 Next update 2028 Sanitary Sewer Plan Adopted 2019 Next update 2028 Water and Natural Resources Management Plan Adopted 2019 Next update 2028 Parks, Trails and Open Space Plan Last update 2015 Next update 2025 Citywide Planning 2040 Comprehensive Plan / Land Use Plan Adopted 2020 Envision Lakeville 2040 Last Updated 2023 Studies & Site Specific Plans/REPORTS Sanitary Sewer and Water Rates & Fees Study (Last Update 2017) Water Treatment Facility Expansion Plan (Last Update 2022) CMF Expansion Study (Last Update 2015) Dakota County East-West Corridor Preservation Study (Phase 1: 2003 / Phase 2: 2006) NPDES MS4 Permit Implementation (Last Update 2023) Park Dedication Fee Study (Last update 2012) Various Park Master Plans (As needed) ADA Transition Plan (2019) Downtown Development Guide (Last Update 2018) Indoor Athletic Facility Study (2017) 2026 Projects Pavement Maintenance Local Street Rehabilitation Arterial/Collector Rehabilitation County Pavement Preservation and City Utility Repairs 215th Street Public Improvements Lake Marion Greenway Water Quality and Water Conservation Lake Management Stormwater Infrastructure Maintenance Forestry Vegetation Management East Community Park Various other park projects NOTES: not all 2026 CIP projects are listed here (only Highlights) City and Dakota County Partnership Projects Are Subject to Adopted Dakota County 2040 Transportation Plan Cost Share Policies. (Revised in 2020) Fire Resource and Space Needs Study (Last Update 2020) School Road Safety Task Force (2014) Dakota County Principal Arterial Study (2018) Dakota County Pedestrian Crossing Safety Assessment (2022) MnDOT I-35 Roadway Study: Burnsville and Lakeville (2024) Strategic Plan for Economic Development (Last Update 2019) Pedestrian Crossing Study (2024) Trail Condition Review (OCI) (2022) Page 750 of 899 !H !H !H $K #I !H !H !H !H #I !H !H!H #I !H !H !H Kingsley Lake Lee Lake Orchard Lake East LakeLake Marion 5 50 9 31 23 60 46 7035 162ND ST W KENWOOD TRL 160TH ST W 185TH ST W 210TH ST W DODD BLVD185TH ST W 215TH ST W 179TH ST W KE N W O O D T R L DODD BLVD17 9 T H S T W PILOT KNOB RDCEDARAVEDODDBLVD185TH ST W 202ND ST W 200TH ST W 26-09 23-13 26-15B26-01 26 -15A 26-15A 25-15B28-0426-0427-0926-10 26-10 30-0230 -02 29-0229-022 9 - 0 2 28-02 28-0228-0228-0228-0228-0227- 0 227-02 27-02 27-02 26-02 26-0 2 30-0 3 29-03 29-0325-0528-03 28-03 27-03 2 7-0327-0326-0329-0526-15C26-15 D 26-15E26-0729-04 29-04 30-05 26-05 U-4 28-0628-07 27-06 27-07 27-05 26-15B 27-XX 27-11 25-15B 26-15A 24-44 U-8 22-16 26-15A 26-08 2026 - 2030 Capital Improvement Projects 0 1 20.5 Miles ²P:\Projects\Construction Services\CIP Maps\CIP Maps.aprx5 2026 2027 2028 2029 2030 Parks & Recreation"J #I Utilities Transportation!H Environmental&J Local Street Reconstruction Trail Construction/Rehabilitation County Pavement Preservation Collector Roadway Rehabilitation Studies/Preliminary Design County Roadway Expansion/Modernization Utilities Projects Page 751 of 899 CITY OF LAKEVILLE PLANNING COMMISSION MEETING MINUTES September 18, 2025 Chair Zimmer called the meeting to order at 6:00 p.m. in the Council Chambers at City Hall. The Pledge of Allegiance to the flag was given. Members Present: Chair Christine Zimmer, Pat Kaluza, Jason Swenson, Amanda Tinsley, Mark Traffas, Alternate Erin Duckworth, Ex-Officio Jeff Hansen Members Absent: Scott Einck, John Swaney Staff Present: Kris Jenson, Planning Manager; Tina Goodroad, Community Development Director; Heather Botten, Senior Planner; Zach Johnson, City Engineer; Jon Nelson, Assistant City Engineer; Dawn Erickson, Community Development Recorder. 3. Approval of the Meeting Minutes The September 4, 2025 Planning Commission meeting minutes were approved as presented. 4. Announcements Planning Manager Kris Jenson stated there were no announcements. 5a. City of Lakeville City Engineer Zach Johnson presented the 2026-2030 Capital Improvement Plan (CIP). He reviewed the objectives of the CIP and indicated that the CIP’s components include future transportation, parks and recreation, utilities, facilities, environmental resources, equipment and technology for the years 2026-2030. The project descriptions, locations, revenues and expenditures are included in the CIP. Mr. Johnson reviewed the CIP map and explained the reconstruction projects and the specific year that project will be completed. He highlighted several road construction, parks and recreation, and utility projects that will be completed in the next five years. Mr. Johnson stated that staff have reviewed the 2026-2030 CIP and find it to be consistent with the 2040 Comprehensive Plan and therefore recommend approval as presented. Chair Zimmer asked for comments from the Planning Commission. Discussion points included: • Chair Zimmer and Commissioner Kaluza expressed appreciation for staff planning. • Commissioner Swenson inquired about cost sharing for the Judicial Road project. Mr. Johnson stated there is a joint powers agreement and the cost is shared. Page 752 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 2 • Commissioner Swenson noted he is a MN DOT employee, but his position does not have decision making authority regarding these projects, therefore there is no conflict of interest. • Commissioner Traffas inquired about the process to determine when new wells and expansion of the water treatment facility are needed. Mr. Johnson stated a model is used to project growth and demand to make those determinations. Motion was made by Kaluza, seconded by Swenson to recommend to City Council approval of the 2026-2030 Capital Improvement Plan as presented, finding that it is consistent with the City’s 2040 Comprehensive Plan. Ayes – Traffas, Kaluza, Zimmer, Duckworth, Swenson, Tinsley Nays: 0 6a. North Creek Second Addition Chair Zimmer requested a motion be made to table this item to the October 2, 2025 Planning Commission meeting. Motion was made by Swenson, seconded by Tinsley to recommend to table the North Creek Second Addition preliminary plat of 47 single family residential lots to the October 2, 2025 Planning Commission meeting. Ayes: Unanimous Nays: 0 6b. Chart House Chair Zimmer opened the public hearing to consider the application of George Maverick of the Chart House for a conditional use permit to exceed 25% impervious surface in the shoreland overlay district and a variance from the required setback from Kingsley Lake. George Maverick, owner of the Chart House, introduced the project and stated they would like to expand the patio bar. Senior Planner Heather Botten presented the staff report. The Chart House restaurant and banquet facility is proposing to demolish the existing detached bar building and construct a new 2,660 square foot structure. The new building requires a variance from the minimum setback requirements from Kingsley Lake. Additionally, the proposed site improvements require a conditional use permit (CUP) amendment to exceed 25% impervious surface on a natural environment lake. A CUP was approved in 1997 to exceed the 25% impervious surface area. Even though the proposed revisions on site will reduce the amount of impervious surface area to an amount that is less than what was approved with the original CUP, the 1997 approvals were tied to a site plan that is now being modified, thus the CUP amendment. The plans have been reviewed by staff from Community Development, Environmental Resources, and Engineering as well as the DNR. A site improvement agreement and stormwater maintenance Page 753 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 3 agreement are required to address site improvements and stormwater treatment facilities. This requirement ensures that these improvements will be constructed to the satisfaction of the City. Chair Zimmer opened the hearing to the public for comment. There was no public comment. Motion was made by Kaluza, seconded by Swenson to close the public hearing at 6:24 p.m. Voice vote was taken on the motion. Ayes – unanimous Chair Zimmer asked for comments from the Planning Commission. • Commissioners Swenson and Kaluza and Chair Zimmer expressed support for the project. Motion was made by Swenson, seconded by Kaluza to recommend to City Council approval of the Chart House conditional use permit amendment to exceed impervious surface and variance from shoreland setbacks and approval of the findings of fact dated September 18, 2025, subject to the following stipulations: 1. The site shall be developed in substantial conformance with the plat and plan set on file with the Community Development Department except as may be modified by the conditions below. 2. The City Code Enforcement Officer, or other designee, shall be granted right of access to the property at all reasonable times to ensure compliance with the conditions of this permit. 3. A site improvement agreement and stormwater agreement are required to address site improvements and stormwater treatment facilities. 4. The developer shall meet the conditions outlined in the City Engineering review memo dated September 9, 2025 and any subsequent correspondence. 5. Final site, grading, stormwater management, and erosion control plans shall be approved by the City Engineer. 6. Revised building elevations that are in compliance with City Code shall be submitted and approved prior to City Council consideration of the request. 7. Resolution No. 97-18 shall become null and void and shall be replaced by the terms of this Conditional Use Permit. Ayes: Kaluza, Zimmer, Duckworth, Swenson, Tinsley, Traffas Nays: 0 Page 754 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 4 6c. Launch Park Fourth Addition Chair Zimmer opened the public hearing to consider the application of Lakeville Flexspace, LLC for a preliminary plat and development plan for a one lot, one outlot subdivision. Jim French, Lakeville Flexspace, LLC, introduced the project. Mr. French stated he is a developer of small bay industrial space. A Common Interest Community (CIC) plat would be created, which allows individual ownership of the spaces as well as provides declarations, covenants and restrictions for the use of the units. Ms. Botten presented the staff report. The proposed plat includes one lot and one outlot on a 20- acre parcel. Lot 1 is eight acres and the outlot is 12 acres. Lakeville Flexspace is proposing to construct a garage condo development on Lot 1. The proposed storage development is a permitted use in the I-2, General Industrial District. The complex would include three garage condo buildings, each roughly 33,750 square feet (375’ x 90’) in size and one building about 16,875 square feet (375’ x 40’). Each building consists of multiple units, and each unit has access to water and sewer. The property is located east of Cedar Avenue (CSAH 23) and south of future 222nd Street. The preliminary plat plans have been reviewed by the Engineering Division, Fire Marshal, and Parks and Recreation Department. Chair Zimmer opened the hearing to the public for comment. There was no public comment. Motion was made by Kaluza, seconded by Swenson to close the public hearing at 6:35 p.m. Voice vote was taken on the motion. Ayes – unanimous Chair Zimmer asked for comments from the Planning Commission. • Chair Zimmer asked for details on how the CIC is used and what restrictions would be in place. Mr. French stated the CIC is to ensure that the community is in compliance with the permitted uses. He stated some of the restrictions and covenants in the CIC include no excessive noise- producing activities, no excessive smell-producing activities, and no overnight parking. The CIC is enforced and maintained through a commercial property management company that enforces the covenants in addition to maintaining the exteriors of the structures and contract for snow removal. He also stated as these are industrial spaces; the owners are not permitted to live or stay overnight in the spaces. • Commissioner Duckworth asked how many units will be in the project, what the price point is and how they are typically utilized and by whom. Mr. French stated there will be 98 units and be about $185,000 for 1,200 square feet. Mr. French said there are a wide range of uses, including retirees, people who have a lot of toys, workshops, and small business owners. Page 755 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 5 • Commissioner Traffas asked where can the owner park if they drive to the unit. Mr. French stated the owner can park directly in front of the unit that they own. The units are wide enough to accommodate three spaces in front of each unit. • Commissioner Duckworth asked if owners have the ability to sublease. Mr. French stated it is permitted to rent the unit after obtaining permission through the property management company. • Commissioner Kaluza asked about numbering or lettering on each door for emergency service response, as well as if there are crime or drug free requirements. Mr. French stated each unit has a number on the door and there are crime and drug free requirements listed in the CIC. Security cameras will also be included on site. Motion was made by Tinsley, seconded by Traffas to recommend to City Council approval of the Launch Park Fourth Addition preliminary plat, subject to the following stipulations: 1. Implementation of the recommendations listed in the engineering report dated September 8, 2025 and any subsequent correspondence. 2. The final plat shall be in substantial conformance with the preliminary plans on file with the Community Development Department except as may be modified by the conditions herein. 3. A development contract and related agreements shall be approved by the City Council with the approval of the final plat. 4. The site and building shall be developed in accordance with the plans approved by the City Council. 5. Landscaping shall be installed consistent with a landscape plan approved by the City Forester. A financial security shall be submitted with the development contract to guarantee installation of the approved landscaping. All landscaped areas within and adjacent to the building and parking lot shall be irrigated. Trees and shrubs shall not be planted in road right-of-way. 6. The park dedication fee must be paid with the final plat. 7. Site lighting shall not exceed one foot candle at the property line adjacent to public right-of- way. All exterior light fixtures shall be down-cast design so as not to glare onto public right-of- way. 8. Section 11-19-13 of City Code requires 3 parking spaces, plus 1 space per 100 storage units. A revised site plan demonstrating the required parking spaces is required prior to final plat approval. 9. An onsite hydrant about midpoint of the property shall be required on the east side of the development as required by the Fire Marshal. Ayes: Zimmer, Duckworth, Swenson, Tinsley, Traffas, Kaluza Nays: 0 There being no further business, the meeting was adjourned at 6:44 p.m. Page 756 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 6 Respectfully submitted, Dawn Erickson, Community Development Recorder Page 757 of 899 Date: 10/6/2025 Public Hearing and Resolution Adopting Assessment For Unpaid Special Charges Proposed Action Staff recommends adoption of the following motion: Move to approve Resolution Adopting Assessments for the Unpaid Special Charges. Overview The City can minimize its losses due to bankruptcies by assessing unpaid special charges to taxes. These charges include costs and charges incurred by the City for mowing of grass, removal of weeds, property maintenance on nuisance properties, false alarm charges, unpaid utility bills and tree removal charges. In order to recover the unpaid special charges the City must follow State Statute procedures. Those procedures provide that the City must adopt a resolution declaring the unpaid special charges to be assessed and establish a date for the assessment hearing for those charges. Public notice of the hearing was mailed to customers, posted on the City website and published in the newspaper. Delinquent Utility Bills In addition to certifying the amount delinquent, the City also collects a $50 service charge to cover the cost of certification and interest at a rate of 18% per annum of the amount delinquent and service charge for the period of October 6, 2025 until December 31, 2026. The interest rate is the same as what we charge delinquent utilities throughout the year (1.5% per month). The certification process affects approximately six percent (6%) of the Lakeville utility customers. Nuisance Abatement & Unpaid False Alarm Charges The affected parcels will each be assessed the actual contractual cost incurred, re-inspection fees, a $50 administrative fee to cover the cost of the assessment, and interest at a rate of 18% per annum of the amount delinquent and service charge for the period October 6, 2025 until December 31, 2026. Tree Removal Charges The affected parcels will each be assessed the actual contractual cost incurred, a $50 administrative fee to cover the cost of the assessment, and interest at a rate of 4.3% per annum of the amount delinquent plus the service charge based on the term stated below. Term Assessment Amount 1 year $0 - $1,000 3 years $1,001 - $2,999 5 years $3,000 - $4,999 Page 758 of 899 7 years Over $5,000 Supporting Information 1. Background and Notification Process 2. Resolution - Assessment of Unpaid Special Charges 3. Res_Exhibit A - Assessment Summary Unpaid Delinquent Utilities 4. Res_Exhibit B - Assessment Summary Nuisance Abatement 5. Res_Exhibit C - Assessment Summary Unpaid False Alarm Fees 6. Res_Exhibit D - Assessment Summary Tree Removal Charges Financial Impact: $1,042,933.05 Budgeted: No Source: Assessments Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Cheri Donovan, Assistant Finance Director Page 759 of 899 Page 1 CITY OF LAKEVILLE UNPAID SPECIAL CHARGES – ADDITIONAL INFORMATION 2025.10.06 Background and notification process for accounts being certified According to City Attorney Andrea Poehler, “If water service is provided to property and the property is subsequently sold or otherwise transferred, the new owner does not have a personal obligation to pay the bill unless the City and owner have a separate services contract. Unpaid water bills, however, are a lien on the property to which the service was provided. If the property is sold or the ownership transferred, the lien remains. At the time the City provides water service to a property the City has an enforceable lien on the property for the cost of the water provided. Minnesota Statutes, Section 514.67 provides: “All charges…of any nature now or hereafter authorized or required by law…shall constitute and be a first and prior lien from the date of such…service upon all property in this state subject to taxation as the property of the person from whom such charges and expenses are by law authorized or required to be collected. No record of such lien shall be deemed necessary.” The statute’s validity as applied to unpaid utility charges has been upheld. In Re Sheldahl, Inc. 298 B.R. 874 (Bankr. D. Minn. 2003). Minnesota Statute, Section 444.075, Subd. 3 further provides: “The governing body may make the charge a charge against the owner, lessee, occupant, or all of them and may provide and covenant for certifying unpaid charges to the county auditor with taxes against the property served for collection as other taxes are collected.” City Code Section 7-5-6-4 also authorizes the City Council to certify unpaid charges to taxes. Unpaid utility charges, special assessments and real estate taxes are all liens against the property. The liens and their enforceability are not impaired by the transfer of ownership. Current and previous property owners have been notified via letter of the delinquency and certification process. Comparison Data The following chart shows the number of accounts and amounts that were presented to the Council at this point in the certification process in previous years as compared to this year: Number Amount Number Amount Number Amount Delinquent Utilities 893 691,185.35$1373 970,612.73$1564 1,033,958.58$ Nuisance Abatement 4 924.35$ 8 2,077.84$ 19 3,483.84$ False Alarm 5 1,716.13$ 4 423.84$ 4 571.38$ Tree Removal 0 -$ 0 -$ 4 4,919.25$ 2024 20252023 Of the 1564 delinquent utility accounts in 2025, 28 are final billing accounts. Staff has been pro- actively communicating with property owners regarding delinquent final bills and promoting the WaterSmart program which allows customers to view water usage and outstanding amounts owed. Customers had until September 19th to submit their payment in order to be removed from the list Page 760 of 899 Page 2 provided to Council. This is to ensure the payments received were not returned due to insufficient funds or the account being closed. Additional payments will be received prior to the hearing as well as within the 30 days following the hearing when interest is not charged. Those properties will be removed from the final certification list that is sent to Dakota County. Page 761 of 899 CITY OF LAKEVILLE RESOLUTION No______ Resolution Adopting Assessments for Unpaid Special Charges WHEREAS, Minn. Stat. 444.075, Subd. 3 authorizes the City to certify unpaid sanitary sewer, water and storm sewer charges (“utility charges”) to the County Auditor-Treasurer for collection with taxes; and WHEREAS, Minn. Stat, 429.101 authorizes the City to special assess unpaid streetlight charges, weed elimination from streets or private property and tree removal charges (“special charges”); and WHEREAS, Title 8-5-4 of the City Ordinance authorizes the City to special assess unpaid emergency service charges (“special charges”) to the County Auditor-Treasurer for collection with taxes; and WHEREAS, an assessment roll has been prepared specifying the amount, which includes all penalties to be certified against each particular property; and WHEREAS, the resolution setting general government services, states “Accounts certified to the County Treasurer-Auditor for collection with the subsequent year’s taxes will be charged a $50.00 service charge plus 18% interest per year for delinquent utility bills, nuisance abatement for properties and unpaid false alarm charges. A $50.00 service charge plus 4.3% interest per year based on the term stated below will be charged for tree removal charges.” NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Lakeville: 1. Assessment No. 221442 in the amount of $1,033,958.58 relating to the certification of delinquent utility bills is calculated as follows: Total uncollected amount delinquent 767,629.55$ Service charge 78,206.00$ Interest 188,123.03$ Total ce rtifie d 1,033,958.58$ 2. Assessment No. 221440 in the amount of $4,055.22 relating to the nuisance abatement for properties and unpaid false alarm charges, Assessment No. 221441 (3-year term) in the amount of $4,919.25 for tree removal charges calculated as follows: Page 762 of 899 Exhibit B Exhibit C Exhibit D Totals False alarm fees -$ 260.00$ -$ 260.00$ Inspection/Mowing fees 1,900.00 --1,900.00 Tree removal fees --4,600.00 4,600.00 Service charge/late fees 950.00 207.42 319.25 1,476.67 Interest 633.84 103.96 -737.80 Total ce rtifie d 3,483.84$ 571.38$ 4,919.25$8,974.47$ The proposed assessments (Exhibit A, Exhibit B, Exhibit C, Exhibit D), copies of which are attached hereto and made a part hereof, are hereby accepted and shall constitute a special assessment against the lands named therein. The amounts certified in Exhibit A, Exhibit B, and Exhibit C shall bear interest from the date of this resolution until December 31, 2026 at the rate of eighteen percent (18%) per annum plus a service charge. The owner of any property so assessed may, at any time prior to certification of the assessment to the County Auditor, pay to the City Treasurer the whole of the assessment on such property including the administration charge, with interest accrued to the date of payment, except that no interest shall be charged if the entire assessment is paid within thirty (30) days from the adoption of this resolution; and he or she may, at any time thereafter, pay to the City Treasurer the entire amount of the assessment remaining unpaid, with interest accrued to December 31 of the year in which such payment is made. Such payment must be made before December 31, 2025, or interest will be charged through December 31 of the succeeding year. The amount certified in Exhibit D shall bear interest from the date of this resolution based on the term stated below at the rate of 4.3% per annum plus a service charge. The owner of any property so assessed may, at any time prior to certification of the assessment to the County Auditor, pay to the City Treasurer the whole of the assessment on such property including the administration charge, with interest accrued to the date of payment, except that no interest shall be charged if the entire assessment is paid within thirty (30) days from the adoption of this resolution; and he or she may, at any time thereafter, pay to the City Treasurer the entire amount of the assessment remaining unpaid, with interest accrued to December 31 of the year in which such payment is made. Such payment must be made before December 31, 2025, or interest will be charged through December 31 of the succeeding year. Term Assessment Amount 1 year $0 - $1,000 3 years $1,001 - $2,999 5 years $3,000 - $4,999 7 years Over $5,000 A copy of this resolution, together with the assessment roll, is to be forwarded to the Dakota County Treasurer/Auditor for collection with other taxes. Page 763 of 899 ADOPTED by the Lakeville City Council this 6th day of October 2025. CITY OF LAKEVILLE By: ________________________________ Luke M. Hellier, Mayor ATTEST: ________________________________ Ann Orlofsky, City Clerk Page 764 of 899 ACCOUNT NUMBER NAME SERVICE ADDRESS ACCOUNT STATUS TAX ROLL NUMBER CERTIFICATION BALANCE SERVICE CHARGE INTEREST ASSESSMENT TOTAL 00117552-0926129661 SKY LINE SALT SOLUTIONS, LLC 21790 HAMBURG AVE - EAST ACTIVE 21-11000-20-84 173.96$ 50.00$ 49.81$ 273.77$ 00088747-0563163359 JIM MURPHY 16335 KENWOOD TR ACTIVE 22-00110-33-021 311.72$ 50.00$ 80.45$ 442.17$ 00067741-0311175497 DAVID RUCKI 17549 FLAGSTAFF AVE ACTIVE 22-01000-76-020 259.60$ 50.00$ 68.86$ 378.46$ 00109887-0563188174 ANNABELLE VELEZ 18817 KENWOOD TR ACTIVE 22-01300-83-037 158.78$ 50.00$ 46.43$ 255.21$ 00106646-0462184629 JOSHUA WOLTER 18462 IXONIA AVE ACTIVE 22-01800-10-020 186.74$ 50.00$ 52.65$ 289.39$ 00091678-0192099908 DANIEL WINSHIP 9990 192ND ST W ACTIVE 22-01900-09-012 300.15$ 50.00$ 77.88$ 428.03$ 00104646-0461195536 TIMOTHY POEHLING 19553 ITERI AVE ACTIVE 22-01900-78-010 2,129.89$ 50.00$ 484.83$ 2,664.72$ 00098879-0465098504 RICHARD BREZINA 9850 ITERI CT W ACTIVE 22-01900-85-012 1,233.05$ 50.00$ 285.36$ 1,568.41$ 00117074-0210084651 2TEN LAKEVILLE LLC 8465 210TH ST W ACTIVE 22-02800-53-021 585.13$ 50.00$ 141.26$ 776.39$ 00116324-0409203450 ELIZABETH L. SIBET 20345 HOWLAND AVE ACTIVE 22-02900-06-040 383.07$ 50.00$ 96.32$ 529.39$ 00065119-0409204151 RONALD CARRICK 20415 HOWLAND AVE ACTIVE 22-02900-06-060 135.63$ 50.00$ 41.29$ 226.92$ 00110626-0412207704 PATRICIA WALKER 20770 HOLLINS AVE ACTIVE 22-02900-76-030 85.39$ 50.00$ 30.11$ 165.50$ 00082274-0205100256 RICK SCHUMACHER 10025 205TH ST W ACTIVE 22-03000-55-023 507.36$ 50.00$ 123.96$ 681.32$ 00115859-0210095830 ANGELA OSTER 9583 210TH ST W ACTIVE 22-03000-79-010 514.18$ 50.00$ 125.48$ 689.66$ 00078281-0215097756 KURT PLOOG 9775 215TH ST W ACTIVE 22-03100-06-030 547.00$ 50.00$ 132.78$ 729.78$ 00057956-0101218558 HEARTHSIDE FOODS SOLUTIONS 21855 CEDAR AVE ACTIVE 22-03300-83-011 1,382.43$ 50.00$ 318.59$ 1,751.02$ 00057956-0363218502 HEARTHSIDE FOODS SOLUTIONS 21850 GRENADA AVE ACTIVE 22-03300-83-012 7,343.34$ 50.00$ 1,644.36$ 9,037.70$ 00057956-0101217501 HEARTHSIDE FOODS SOLUTIONS 21750 CEDAR AVE ACTIVE 22-03400-50-012 5,072.14$ 50.00$ 1,139.22$ 6,261.36$ 00109926-0785178266 RILEY MONAHAN 17826 IKARIA TR ACTIVE 22-11450-04-030 551.35$ 50.00$ 133.75$ 735.10$ 00093932-0786178695 WILLIAM COOK 17869 IMPALA PATH ACTIVE 22-11450-05-030 766.97$ 50.00$ 181.70$ 998.67$ 00053142-0432177786 MARK HANNA 17778 ICON TR ACTIVE 22-11451-03-060 106.83$ 50.00$ 34.88$ 191.71$ 00066682-0432177943 TOM HARTWELL 17794 ICON TR ACTIVE 22-11452-02-010 1,002.69$ 50.00$ 234.13$ 1,286.82$ 00081475-0199101302 JOHN A BARGER 10130 199TH ST W ACTIVE 22-11500-12-050 442.34$ 50.00$ 109.50$ 601.84$ 00117729-0199098805 CHAD KRAFT 9880 199TH ST W ACTIVE 22-11500-12-291 234.80$ 50.00$ 63.34$ 348.14$ 00096437-0927103232 DARRYL SANDERS 10323 UPPER 196TH WAY W ACTIVE 22-11500-18-031 577.14$ 50.00$ 139.48$ 766.62$ 00110184-0927102457 JOSEPH CARLSON 10245 UPPER 196TH WAY W ACTIVE 22-11500-18-101 399.93$ 50.00$ 100.07$ 550.00$ 00058315-0199103100 LORI SQUIRE SCHWEITZER 10310 199TH ST W ACTIVE 22-11500-20-010 321.54$ 50.00$ 82.63$ 454.17$ 00092029-0505198315 JAIME LABRUYERE 19831 JASMINE AVE ACTIVE 22-11500-21-091 618.11$ 50.00$ 148.59$ 816.70$ 00115373-0926087271 BRYAN KOHL 17248 JOY CT ACTIVE 22-11825-02-040 791.34$ 50.00$ 187.12$ 1,028.46$ 00107955-0926087261 KRISTINA CHRISTENSON 17375 JOY AVE ACTIVE 22-11825-03-030 172.92$ 50.00$ 49.58$ 272.50$ 00097307-0926089861 BADRIYO MOHAMED 17244 JOPLIN AVE ACTIVE 22-11826-01-010 1,037.78$ 50.00$ 241.93$ 1,329.71$ 00087762-0563174000 LAKEVILLE PLAZA LLC 17400 KENWOOD TR STE 202 ACTIVE 22-11850-00-180 576.84$ 50.00$ 139.42$ 766.26$ 00087762-0563174059 LAKEVILLE PLAZA LLC 17400 KENWOOD TR STE 302 ACTIVE 22-11850-00-180 179.90$ 50.00$ 51.13$ 281.03$ 00087762-0926094041 LAKEVILLE PLAZA LLC 17400 KENWOOD TR ACTIVE 22-11850-00-180 365.06$ 50.00$ 92.31$ 507.37$ 00111087-0563174505 RED'S SAVOY PIZZA 17450 KENWOOD TR ACTIVE 22-11850-00-184 1,248.94$ 50.00$ 288.90$ 1,587.84$ 00105200-0926097721 JENNIFER RONCHETTO 20263 HAMPTON AVE ACTIVE 22-11910-01-010 165.90$ 50.00$ 48.02$ 263.92$ 00098787-0926098881 NICOLE SPICER 20416 HAMPTON AVE ACTIVE 22-11910-02-120 99.66$ 50.00$ 33.29$ 182.95$ 00115166-0926113986 EMMANUEL ASAMOA 7880 204TH ST W ACTIVE 22-11920-04-130 150.48$ 50.00$ 44.59$ 245.07$ 00110534-0926115736 AARON BERG 20379 GREENGATE CT ACTIVE 22-11921-01-040 366.20$ 50.00$ 92.57$ 508.77$ 00109713-0926114431 STEVEN ZWEBER 7727 204TH ST W ACTIVE 22-11921-01-100 631.60$ 50.00$ 151.60$ 833.20$ 00093297-0926093351 ANDREW KOLLMANN 6266 UPPER 179TH STW ACTIVE 22-11995-08-050 151.95$ 50.00$ 44.92$ 246.87$ 00113136-0926097816 AMER ABDELHAMID ISMA ALMAGHATHAH 17843 FIELDING WAY ACTIVE 22-11996-02-100 245.44$ 50.00$ 65.71$ 361.15$ 00106408-0926097821 RYAN WIENS 17849 FIELDING WAY ACTIVE 22-11996-02-110 527.80$ 50.00$ 128.51$ 706.31$ 00101666-0926098946 JAMIE MACK 17856 FIELDING WAY ACTIVE 22-11996-03-070 540.37$ 50.00$ 131.30$ 721.67$ 00103108-0926103756 MICHAEL LE 6169 UPPER 179TH ST W ACTIVE 22-11998-01-050 373.50$ 50.00$ 94.19$ 517.69$ 00102063-0926103431 ADAM SIMON 6083 UPPER 179TH ST W ACTIVE 22-11998-03-010 146.84$ 50.00$ 43.78$ 240.62$ 00100682-0926101266 ALYSSA SOM 6067 UPPER 179TH ST W ACTIVE 22-11998-03-020 274.66$ 50.00$ 72.21$ 396.87$ 00101349-0926101481 ARTHUR FARBER 6084 UPPER 179TH ST W ACTIVE 22-11998-04-020 925.56$ 50.00$ 216.98$ 1,192.54$ 00109524-0926112861 BILL MCCLURE JR 18138 GREEN GABLES TR ACTIVE 22-12010-03-040 435.59$ 50.00$ 108.00$ 593.59$ 00107692-0926110991 AARON HEDGES 18184 GREYHAVEN PATH ACTIVE 22-12010-04-120 212.78$ 50.00$ 58.45$ 321.23$ 00107849-0926111546 HEMANTH KUMAR MUTHA 18172 GOLDFINCH WAY ACTIVE 22-12010-04-270 540.19$ 50.00$ 131.26$ 721.45$ 00107842-0926110486 SADIA EGAL 18189 GLENBRIDGE AVE ACTIVE 22-12010-04-340 453.84$ 50.00$ 112.06$ 615.90$ CITY OF LAKEVILLE ASSESSMENT SUMMARY - DELINQUENT UTILITIES OCTOBER 6, 2025 EXHIBIT A Page 765 of 899 00106732-0926109981 PHILIP MOSES 18121 GOLDFINCH WAY ACTIVE 22-12010-05-020 486.67$ 50.00$ 119.36$ 656.03$ 00107407-0926108946 CHRISTOPHER IMALLA 18101 GOLDFINCH WAY ACTIVE 22-12010-05-050 207.16$ 50.00$ 57.20$ 314.36$ 00107690-0926111011 HIMA BINDU NARNI 18191 GOLDFINCH WAY ACTIVE 22-12010-05-070 589.89$ 50.00$ 142.32$ 782.21$ 00107243-0926110301 MUSE GULAN 18185 GOLDFINCH WAY ACTIVE 22-12010-05-080 823.95$ 50.00$ 194.38$ 1,068.33$ 00101977-0926103146 ABDIRAHMAN JAMA 18009 GLEAMING CT ACTIVE 22-12010-10-240 864.76$ 50.00$ 203.45$ 1,118.21$ 00103209-0926104796 KELLIE MAILATYAR 18010 GLEAMING CT ACTIVE 22-12010-10-270 191.74$ 50.00$ 53.77$ 295.51$ 00105908-0926108051 CABDI GACAL 18060 GLEAMING CT ACTIVE 22-12010-10-370 1,628.23$ 50.00$ 373.26$ 2,051.49$ 00110441-0926103486 ABDULKADIR HASHI 18061 GLEAMING CT ACTIVE 22-12010-11-060 800.50$ 50.00$ 189.16$ 1,039.66$ 00113840-0926105206 TIRUMALA RAO DUMPALA 18150 GLENBRIDGE AVE ACTIVE 22-12010-12-010 737.78$ 50.00$ 175.21$ 962.99$ 00115260-0926108151 GAYAN KAUSHALYA YALPATHWALA 18109 GLANSHAW AVE ACTIVE 22-12010-23-010 637.83$ 50.00$ 152.98$ 840.81$ 00118708-0926106656 ABDULRAHMAN NOOR 18138 GLADSTONE TR ACTIVE 22-12010-24-050 315.80$ 50.00$ 81.36$ 447.16$ 00102386-0926103771 GIRISH BANGALORE 18118 GLADSTONE TR ACTIVE 22-12010-24-100 464.19$ 50.00$ 114.36$ 628.55$ 00105222-0926106406 AHMED GULED 18110 GLADSTONE TR ACTIVE 22-12010-24-120 422.51$ 50.00$ 105.09$ 577.60$ 00105729-0926108116 EDWARD SPINNER 18148 GLANSHAW AVE ACTIVE 22-12010-25-060 383.99$ 50.00$ 96.52$ 530.51$ 00112352-0926108571 AHMED ABDLAHI 18119 GLADSTONE TR ACTIVE 22-12010-25-100 544.24$ 50.00$ 132.17$ 726.41$ 00106439-0926108726 JASON PRICE 18111 GLADSTONE TR ACTIVE 22-12010-25-110 1,437.60$ 50.00$ 330.86$ 1,818.46$ 00110690-0926109121 MAHESH GAJJALA RAMACHANDRA 18103 GLADSTONE TR ACTIVE 22-12010-25-120 992.74$ 50.00$ 231.92$ 1,274.66$ 00100888-0926101526 ZIAD ASIM 18107 GLASSFERN LA ACTIVE 22-12011-01-010 113.54$ 50.00$ 36.37$ 199.91$ 00102351-0926103456 SALMAN SIDDIQUI 18157 GLASSFERN LA ACTIVE 22-12011-04-050 393.21$ 50.00$ 98.57$ 541.78$ 00108289-0926111381 MESFIN GHEDREYESUS 18325 GLEED RD ACTIVE 22-12012-01-040 131.59$ 50.00$ 40.39$ 221.98$ 00116645-0926110411 ESSAM MAHADI 18303 GLASSNER WAY ACTIVE 22-12012-02-010 1,041.86$ 50.00$ 242.84$ 1,334.70$ 00107084-0926109346 ELIZABETH KELLY 18383 GLASSNER WAY ACTIVE 22-12012-02-100 300.85$ 50.00$ 78.03$ 428.88$ 00108028-0926111106 KEITH CONN 18329 GLADDEN LA ACTIVE 22-12012-02-240 456.33$ 50.00$ 112.61$ 618.94$ 00113410-0926121126 VICTOR ARREDONDO 18308 GLASSWORT DR ACTIVE 22-12012-03-020 77.08$ 50.00$ 28.26$ 155.34$ 00113885-0926112351 JOSIE REHM 18348 GLASSWORT DR ACTIVE 22-12012-03-110 328.11$ 50.00$ 84.10$ 462.21$ 00111234-0926116311 NICOLE EILERS 18058 HAWKSBILL DR ACTIVE 22-12013-04-160 528.96$ 50.00$ 128.77$ 707.73$ 00117213-0926115971 JOESEPH A. THEISEN 18056 HARTLIN AVE ACTIVE 22-12013-05-030 1,171.77$ 50.00$ 271.74$ 1,493.51$ 00110642-0926115976 SHARATH KUMAR ANUMANTHU GOPAL 18064 HARTLIN AVE ACTIVE 22-12013-05-040 153.05$ 50.00$ 45.16$ 248.21$ 00118479-0926117326 TUSHAR KULKARNI 18072 HARTLIN AVE ACTIVE 22-12013-05-050 100.78$ 50.00$ 33.54$ 184.32$ 00111798-0926117401 NIKOLAY DOROH 18136 HARTLIN AVE ACTIVE 22-12013-05-130 475.92$ 50.00$ 116.97$ 642.89$ 00113257-0926117746 ALI HERSI 8029 182ND ST W ACTIVE 22-12013-05-190 966.27$ 50.00$ 226.03$ 1,242.30$ 00099071-0926118231 FREDERICK ONYANGO 8070 182ND ST W ACTIVE 22-12013-06-020 538.86$ 50.00$ 130.97$ 719.83$ 00109500-0926112256 RYAN JEX 7957 182ND ST W ACTIVE 22-12013-07-030 169.36$ 50.00$ 48.79$ 268.15$ 00110743-0926114576 GULED MOHAMED 18418 GREENSTONE WAY ACTIVE 22-12013-10-090 1,064.46$ 50.00$ 247.87$ 1,362.33$ 00111774-0926116916 SATYANAND KUMAR REVOORI 18386 GREENSTONE WAY ACTIVE 22-12013-10-130 200.58$ 50.00$ 55.73$ 306.31$ 00110676-0926115261 TERRY BILBRO 18378 GREENSTONE WAY ACTIVE 22-12013-10-140 777.19$ 50.00$ 183.98$ 1,011.17$ 00115678-0926118091 GANGA SAI RAM SUGGUNA 18369 GRASSHOPPER DR ACTIVE 22-12013-10-320 135.63$ 50.00$ 41.29$ 226.92$ 00000000-2000000297 UVAIS S MOHAMMED 7808 184TH ST W ACTIVE 22-12013-10-380 166.86$ 50.00$ 48.23$ 265.09$ 00109635-0926114176 KARTHIK SAI PRASAD 7796 184TH ST W ACTIVE 22-12013-10-390 736.87$ 50.00$ 175.01$ 961.88$ 00110159-0926114726 PERVEZ SIDDIQUI 7784 184TH ST W ACTIVE 22-12013-10-400 1,152.51$ 50.00$ 267.45$ 1,469.96$ 00109012-0926112916 DHAVAL RAJU 18315 GREENSTONE WAY ACTIVE 22-12013-11-130 272.84$ 50.00$ 71.80$ 394.64$ 00110467-0926115251 BRET WISKI 18346 GRASSHOPPER DR ACTIVE 22-12013-12-010 137.21$ 50.00$ 41.64$ 228.85$ 00111093-0926116401 RAMESH KUMAR VENKITASAMY 18351 GLENBRIDGE AVE ACTIVE 22-12013-13-070 418.50$ 50.00$ 104.20$ 572.70$ 00111096-0926115276 SANTOSH REDDY ANUMULA 18383 GLENBRIDGE AVE ACTIVE 22-12013-13-110 602.47$ 50.00$ 145.12$ 797.59$ 00113960-0926120931 ERIC PALMER 18350 GOLDEN EYE PATH ACTIVE 22-12013-13-220 834.05$ 50.00$ 196.62$ 1,080.67$ 00108872-0926112431 GIRISH KUMAR SURE 7786 183RD ST W ACTIVE 22-12013-13-260 344.00$ 50.00$ 87.63$ 481.63$ 00108553-0926112141 HASSAN MOHAMED 7750 183RD ST W ACTIVE 22-12013-13-290 965.35$ 50.00$ 225.82$ 1,241.17$ 00117640-0926116431 SADIK GULED SHARIFF 18377 GRASSHOPPER DR ACTIVE 22-12013-13-30 189.34$ 50.00$ 53.23$ 292.57$ 00110462-0926110501 THE CHURCH OF PENTECOST USA INC 18390 GLENBRIDGE AVE ACTIVE 22-12013-14-120 176.40$ 50.00$ 50.35$ 276.75$ 00107116-0926110061 GABRIELLE WHITE 18373 GLEED RD ACTIVE 22-12013-14-170 137.80$ 50.00$ 41.77$ 229.57$ 00115124-0926118716 NAREN SWAMY JAMITHIREDDY 7560 184TH ST W ACTIVE 22-12013-16-150 279.87$ 50.00$ 73.37$ 403.24$ 00111897-0926117711 SHAHEER KOOTTEERI 7588 184TH ST W ACTIVE 22-12013-16-220 335.92$ 50.00$ 85.83$ 471.75$ 00110124-0926112731 FAREEDAH HASAN 18304 GLASTONBURY DR ACTIVE 22-12013-17-010 437.80$ 50.00$ 108.49$ 596.29$ 00112796-0926118736 HODAN MOHAMED 7593 184TH ST W ACTIVE 22-12013-17-260 100.72$ 50.00$ 33.52$ 184.24$ 00114374-0926121621 IFRAH ABDULLAHI 8065 188TH ST W ACTIVE 22-12014-06-100 121.23$ 50.00$ 38.08$ 209.31$ 00113519-0926120211 AISHA JELLE 8113 188TH ST W ACTIVE 22-12014-06-140 2,180.88$ 50.00$ 496.17$ 2,727.05$ 00113807-0926120946 HANAD YUSUF 18665 HARCOURT PATH ACTIVE 22-12014-07-060 151.95$ 50.00$ 44.92$ 246.87$ Page 766 of 899 00117323-0926127706 ABDULLAHI OMAR 8129 186TH ST W ACTIVE 22-12014-09-080 263.97$ 50.00$ 69.83$ 383.80$ 00115872-0926125376 TREVOR ENROTH 18540 HANCOCK AVE ACTIVE 22-12014-09-160 805.88$ 50.00$ 190.36$ 1,046.24$ 00116180-0926125016 SUDHAKAR DASARI 18562 HANCOCK AVE ACTIVE 22-12014-09-170 535.27$ 50.00$ 130.17$ 715.44$ 00112066-0450173253 AMY LUNKA 17325 IPSWICH WAY ACTIVE 22-13200-01-080 285.66$ 50.00$ 74.65$ 410.31$ 00056802-0450173188 NEIL A JOHNSON 17318 IPSWICH WAY ACTIVE 22-13200-03-040 269.94$ 50.00$ 71.16$ 391.10$ 00118430-0482173255 GILBERTO TLASECA MARIN 17325 IXONIA PATH ACTIVE 22-13200-06-010 425.02$ 50.00$ 105.65$ 580.67$ 00092957-0482173834 ROBERT ZIMMER 17383 IXONIA PATH ACTIVE 22-13200-06-040 387.34$ 50.00$ 97.27$ 534.61$ 00057785-0936097688 SHANNON SHIEK 9768 UPPER 173RD CT W ACTIVE 22-13201-04-020 142.83$ 50.00$ 42.89$ 235.72$ 00119023-0447173325 CAG MINNESOTA FUND II LLC 17332 ITHACA LA ACTIVE 22-13201-04-030 240.29$ 50.00$ 64.56$ 354.85$ 00073885-0447174240 SUE HUONDER 17424 ITHACA LA ACTIVE 22-13201-04-130 128.43$ 50.00$ 39.68$ 218.11$ 00057788-0936098173 CHRIS GARTZKE 9817 UPPER 173RD CT W ACTIVE 22-13201-06-040 2,000.31$ 50.00$ 456.01$ 2,506.32$ 00102587-0936098637 NICHOLAS GILBERTSON 9863 UPPER 173RD CT W ACTIVE 22-13201-06-070 473.91$ 50.00$ 116.52$ 640.43$ 00099911-0936098827 JOE ADAMS 9882 UPPER 173RD CT W ACTIVE 22-13201-06-100 457.25$ 50.00$ 112.82$ 620.07$ 00111903-0499172902 LINDSAY CURTIS 17290 JADE TER ACTIVE 22-13202-03-030 220.86$ 50.00$ 60.24$ 331.10$ 00096540-0514191525 KELLY FINNEY 19152 ORCHARD TR ACTIVE 22-13301-02-040 168.95$ 50.00$ 48.70$ 267.65$ 00117505-0663188926 MELINDA FIELDS 18892 ORCHARD CT ACTIVE 22-13302-01-010 121.23$ 50.00$ 38.08$ 209.31$ 00112349-0926119096 WENDY BAUER 20206 GLENBROOK PATH ACTIVE 22-13620-02-020 583.36$ 50.00$ 140.87$ 774.23$ 00118262-0205087271 ANDRES FELIPE JIMENEZ 8727 205TH ST W ACTIVE 22-13650-01-011 1,735.28$ 50.00$ 397.07$ 2,182.35$ 00101323-0410204604 JEFF OLSON 20460 HOLYOKE AVE ACTIVE 22-13650-01-021 696.65$ 50.00$ 166.06$ 912.71$ 00117841-0410206609 PRECIOUS DIXON 20660 HOLYOKE AVE ACTIVE 22-13700-02-040 593.74$ 50.00$ 143.17$ 786.91$ 00105901-0411205659 COLE BJORGE 20565 HOLT AVE ACTIVE 22-13700-04-090 517.07$ 50.00$ 126.12$ 693.19$ 00103141-0411206202 SARAH THORPE 20620 HOLT AVE ACTIVE 22-13700-06-030 339.00$ 50.00$ 86.52$ 475.52$ 00059015-0412206250 DAVE PRANKE 20625 HOLLINS AVE ACTIVE 22-13700-06-062 324.80$ 50.00$ 83.36$ 458.16$ 00058992-0411207200 CBC 202 LIMITED PARTNERSHIP 20720 HOLT AVE ACTIVE 22-13700-08-050 1,475.94$ 50.00$ 339.39$ 1,865.33$ 00111299-0926103936 CORY ODLAND 8223 200TH ST W ACTIVE 22-13710-01-020 1,610.66$ 50.00$ 369.35$ 2,030.01$ 00102211-0926102806 CURT HEDIN 20136 HARNESS AVE ACTIVE 22-13710-02-180 146.95$ 50.00$ 43.80$ 240.75$ 00102296-0926101741 ELIZABETH VISKER 20072 HEATH AVE ACTIVE 22-13710-02-350 155.14$ 50.00$ 45.63$ 250.77$ 00103221-0926102161 GERRAD GRIFFEY 20128 HEATH AVE ACTIVE 22-13710-02-390 591.77$ 50.00$ 142.74$ 784.51$ 00114813-0926110306 JITENDERPAL DHILLON 19898 HEXHAM WAY ACTIVE 22-13711-02-030 387.49$ 50.00$ 97.30$ 534.79$ 00110971-0926105356 ROBERT DUNBAR 19997 HENLEY LA ACTIVE 22-13711-02-100 233.87$ 50.00$ 63.14$ 347.01$ 00106517-0926109216 SAM BENFANTE 8476 200TH ST W ACTIVE 22-13711-04-010 225.46$ 50.00$ 61.27$ 336.73$ 00111611-0926110521 AHMED ABRAHAM 8096 200TH ST W ACTIVE 22-13712-02-020 1,084.02$ 50.00$ 252.22$ 1,386.24$ 00106258-0926108606 JUSTIN HAILEY 20096 HAMLET LA ACTIVE 22-13712-03-090 183.62$ 50.00$ 51.96$ 285.58$ 00112798-0926109701 JASON RAINS 8066 201ST ST W ACTIVE 22-13712-04-030 159.78$ 50.00$ 46.66$ 256.44$ 00107924-0926110321 NANCY SCHULTZ 20156 HARVEST DR ACTIVE 22-13712-04-130 554.14$ 50.00$ 134.37$ 738.51$ 00111784-0926118541 JOSE ANDRADE 19740 HENLEY LA ACTIVE 22-13714-03-010 438.55$ 50.00$ 108.66$ 597.21$ 00113637-0926121176 TERRY ROBERTSON 19782 HENNING AVE ACTIVE 22-13715-01-060 628.25$ 50.00$ 150.85$ 829.10$ 00116340-0926126411 SHAYNE HALL 19775 HENNING AVE ACTIVE 22-13715-02-040 195.92$ 50.00$ 54.70$ 300.62$ 00119178-0926122856 JEREMY WILLIAMS 8212 198TH ST W ACTIVE 22-13715-02-120 127.55$ 50.00$ 39.49$ 217.04$ 00113712-0926120016 DEONTA EL-SHABAZZ 19813 HARVEST DR ACTIVE 22-13715-03-010 216.62$ 50.00$ 59.30$ 325.92$ 00115160-0926123811 JOSEPH HONSEY 19810 HENNING AVE ACTIVE 22-13716-03-020 158.19$ 50.00$ 46.30$ 254.49$ 00000000-2000001614 MATTHEW LEONETTI 19515 HARBOR DR ACTIVE 22-13717-01-020 381.73$ 50.00$ 96.02$ 527.75$ 00000000-2000000708 JOSEPHINE WANNER 19571 HARBOR DR ACTIVE 22-13717-01-060 75.22$ 50.00$ 27.85$ 153.07$ 00000000-2000000164 ROBERT NOTERMANN 19544 HARBOR DR ACTIVE 22-13717-02-040 199.32$ 50.00$ 55.45$ 304.77$ 00116389-0926084446 LUCAS E. SANCHEZ 15818 DUPONT AVE ACTIVE 22-13950-01-010 331.80$ 50.00$ 84.92$ 466.72$ 00086138-0439160203 TRACY SKARE 16020 INGLEWOOD DR ACTIVE 22-14500-01-020 353.15$ 50.00$ 89.66$ 492.81$ 00093801-0161095403 KEITH HALGRIMSON 9540 161ST ST W ACTIVE 22-14500-03-010 165.90$ 50.00$ 48.02$ 263.92$ 00116851-0609161577 CAITLIN HART 16157 LOGARTO LA ACTIVE 22-14500-04-090 752.29$ 50.00$ 178.44$ 980.73$ 00101028-0439161201 STEVEN HUFF 16120 INGLEWOOD DR ACTIVE 22-14500-05-060 244.04$ 50.00$ 65.40$ 359.44$ 00062587-0609161270 JOHN OLSON 16127 LOGARTO LA ACTIVE 22-14500-05-200 390.13$ 50.00$ 97.89$ 538.02$ 00092565-0787165628 STEPHANIE ROSS 16562 IREDALE CT ACTIVE 22-14651-03-110 470.28$ 50.00$ 115.72$ 636.00$ 00079912-0790165508 PATRICK HOGAN 16550 IRWIN CT ACTIVE 22-14652-02-090 580.63$ 50.00$ 140.26$ 770.89$ 00069389-0777165125 SCOTT PETE 16512 IRWINDALE WAY ACTIVE 22-14750-01-040 85.39$ 50.00$ 30.11$ 165.50$ 00093807-0606177556 HEATHER MANEY 17755 LAYTON PATH ACTIVE 22-14990-01-040 1,099.81$ 50.00$ 255.73$ 1,405.54$ 00060154-0531179669 JEAN BAKKEN 17966 JUDICIAL RD ACTIVE 22-15000-03-120 302.41$ 50.00$ 78.38$ 430.79$ 00112727-0492180581 FRANK PINEX 18058 JUDICIAL WAY N ACTIVE 22-15000-03-270 121.44$ 50.00$ 38.13$ 209.57$ 00117788-0926127566 LEONG LING TAN 17107 DYSART PL ACTIVE 22-15100-01-080 658.25$ 50.00$ 157.52$ 865.77$ Page 767 of 899 00118492-0926129261 NARAYANAN SUNDARESAN 17074 DYSART PL ACTIVE 22-15100-01-520 698.16$ 50.00$ 166.40$ 914.56$ 00118962-0926129246 NARIN SOK 17088 DYSART PL ACTIVE 22-15100-01-590 557.93$ 50.00$ 135.21$ 743.14$ 00118063-0926127666 ANDREW DIMARCO 4964 171ST ST W ACTIVE 22-15100-06-020 419.72$ 50.00$ 104.47$ 574.19$ 00000000-2000000689 ABDIKADIR IDIFLE 4838 171ST ST W ACTIVE 22-15100-06-110 135.63$ 50.00$ 41.29$ 226.92$ 00118014-0926129806 ERICK PENA 17265 DURHAM DR ACTIVE 22-15100-06-370 108.10$ 50.00$ 35.16$ 193.26$ 00117328-0926127466 MOHAMED IBRAHIM 17074 DOPPLER LA ACTIVE 22-15100-09-060 176.85$ 50.00$ 50.45$ 277.30$ 00000000-2000000621 FEISAL MUSSE WARSAME 4632 172ND ST W ACTIVE 22-15100-10-080 130.58$ 50.00$ 40.16$ 220.74$ 00117780-0926127651 MINH PHAN 17260 DURHAM DR ACTIVE 22-15100-13-050 570.28$ 50.00$ 137.96$ 758.24$ 00117308-0926128021 KRISTINA BAKER 17366 DUVALL CT ACTIVE 22-15100-14-110 324.11$ 50.00$ 83.21$ 457.32$ 00000000-2000000581 LEYLA ADEN 17920 HINCKLEY AVE ACTIVE 22-16350-01-030 184.39$ 50.00$ 52.13$ 286.52$ 00118184-0926129161 IBRAHIM ADEN 18064 HINCKLEY AVE ACTIVE 22-16350-03-050 1,130.97$ 50.00$ 262.66$ 1,443.63$ 00118350-0926128461 RODA ADAM 18104 HINCKLEY AVE ACTIVE 22-16350-04-010 1,267.36$ 50.00$ 293.00$ 1,610.36$ 00118275-0926129761 SUJITH KOLAN 18033 HINCKLEY AVE ACTIVE 22-16350-05-130 137.80$ 50.00$ 41.77$ 229.57$ 00109319-0926113161 ANGILA SCHMIDTKE 7779 205TH ST W ACTIVE 22-16620-01-020 467.30$ 50.00$ 115.05$ 632.35$ 00110042-0926114796 JADE OHLUND 7778 205TH ST W ACTIVE 22-16620-02-020 753.84$ 50.00$ 178.78$ 982.62$ 00111423-0926117086 DEVINE NGWANG 7697 206TH ST W ACTIVE 22-16620-02-130 559.99$ 50.00$ 135.67$ 745.66$ 00109940-0926115391 JONATHAN A BUCK 7767 206TH ST W ACTIVE 22-16620-02-180 135.63$ 50.00$ 41.29$ 226.92$ 00112940-0926119101 NAVEEN BABU MANKENA 20584 GEYSER CT ACTIVE 22-16621-01-080 250.88$ 50.00$ 66.92$ 367.80$ 00112933-0926119611 RENEE ROBERTSON 20570 GEYSER CT ACTIVE 22-16621-01-090 82.36$ 50.00$ 29.44$ 161.80$ 00112340-0926118606 CORY HUNT 20611 GOSFORD WAY ACTIVE 22-16621-03-010 83.97$ 50.00$ 29.80$ 163.77$ 00112892-0926119116 VARA PRASAD YERICHERLA 20617 GOSFORD WAY ACTIVE 22-16621-03-020 507.48$ 50.00$ 123.99$ 681.47$ 00117792-0926118616 DEBRA MILLER 20629 GOSFORD WAY ACTIVE 22-16621-03-040 640.20$ 50.00$ 153.51$ 843.71$ 00114931-0926122751 GUSTAVO MARTINS GOERG 7655 207TH ST W ACTIVE 22-16622-02-080 143.42$ 50.00$ 43.02$ 236.44$ 00116248-0926124736 KATHERINE JOHNSON 20758 GLADE AVE ACTIVE 22-16622-03-090 499.06$ 50.00$ 122.12$ 671.18$ 00118322-0926123076 CRYSTAL KOHLER 7794 207TH ST W ACTIVE 22-16622-05-010 135.63$ 50.00$ 41.29$ 226.92$ 00104630-0251162141 YULIANA ESPINAL 16214 GLEN OAKS RD ACTIVE 22-16650-01-020 699.56$ 50.00$ 166.71$ 916.27$ 00000000-2000001243 KEOLAMTHOUANE SOUNTHAVIN 16320 GLEN OAKS RD ACTIVE 22-16650-01-090 292.14$ 50.00$ 76.10$ 418.24$ 00104809-0252162496 BENIAM TESFAZGY 16249 GLEN OAKS CT ACTIVE 22-16650-02-060 832.71$ 50.00$ 196.32$ 1,079.03$ 00107807-0252162595 ARACELI SALAZAR 16259 GLEN OAKS CT ACTIVE 22-16650-02-080 298.09$ 50.00$ 77.42$ 425.51$ 00109711-0253163204 TIM LANIGAN 16320 GODSON DR ACTIVE 22-16651-01-030 380.10$ 50.00$ 95.66$ 525.76$ 00086869-0253163253 JARED KAMPF 16325 GODSON DR ACTIVE 22-16651-03-130 230.82$ 50.00$ 62.46$ 343.28$ 00080949-0253164681 EDWARD WESEE 16468 GODSON DR ACTIVE 22-16652-01-090 1,077.65$ 50.00$ 250.80$ 1,378.45$ 00069127-0386163105 ELTON CAMPBELL 16310 GOODVIEW TR ACTIVE 22-16653-01-070 353.64$ 50.00$ 89.77$ 493.41$ 00107014-0255164135 JUSTIN THILL 16413 GRENOBLE AVE ACTIVE 22-16653-04-130 129.11$ 50.00$ 39.84$ 218.95$ 00115577-0255164275 ARUN NAMBOODUAD 16427 GRENOBLE AVE ACTIVE 22-16653-04-140 191.55$ 50.00$ 53.72$ 295.27$ 00055793-0366168991 MARI OLSON 16899 GARCIA WAY W ACTIVE 22-16700-01-020 586.09$ 50.00$ 141.47$ 777.56$ 00074355-0366169296 DAWN ERICKSON 16929 GARCIA WAY ACTIVE 22-16700-01-080 369.65$ 50.00$ 93.33$ 512.98$ 00065514-0170074658 TERRY CUSHMAN 7465 170TH ST W APT 1 ACTIVE 22-16700-01-150 1,441.56$ 50.00$ 331.74$ 1,823.30$ 00065514-0170074674 TERRY CUSHMAN 7465 170TH ST W APT 2 ACTIVE 22-16700-01-150 184.60$ 50.00$ 52.18$ 286.78$ 00065514-0170074690 TERRY CUSHMAN 7465 170TH ST W APT 3 ACTIVE 22-16700-01-150 289.30$ 50.00$ 75.46$ 414.76$ 00065514-0170074716 TERRY CUSHMAN 7465 170TH ST W APT 4 ACTIVE 22-16700-01-150 200.10$ 50.00$ 55.62$ 305.72$ 00118057-0366169247 GUADALUPE SANDOVAL 16924 GARCIA WAY ACTIVE 22-16700-02-090 273.66$ 50.00$ 71.99$ 395.65$ 00059252-0366169429 JAMES ROEMHILDT 16942 GARCIA WAY ACTIVE 22-16700-02-120 2,048.13$ 50.00$ 466.65$ 2,564.78$ 00057692-0930074303 BRUCE WILCOX 7430 170TH CT W ACTIVE 22-16700-03-060 489.70$ 50.00$ 120.04$ 659.74$ 00086629-0364169447 JOHN SIMO 16944 GANNON WAY ACTIVE 22-16701-01-090 450.52$ 50.00$ 111.32$ 611.84$ 00105520-0364169504 JUSTIN MACK 16950 GANNON WAY ACTIVE 22-16701-01-100 346.40$ 50.00$ 88.16$ 484.56$ 00094141-0364169686 JEREMIAH B. OLSON 16968 GANNON WAY ACTIVE 22-16701-01-130 513.63$ 50.00$ 125.36$ 688.99$ 00099737-0364169173 NICOLE JOHNSON 16917 GANNON WAY ACTIVE 22-16701-02-020 436.05$ 50.00$ 108.10$ 594.15$ 00096025-0368071656 DEQA KHALIF 7165 GERDINE CT ACTIVE 22-16702-01-080 434.95$ 50.00$ 107.86$ 592.81$ 00115639-0359170806 ANTHONY WILSON 17080 GERDINE PATH ACTIVE 22-16702-02-040 498.33$ 50.00$ 121.95$ 670.28$ 00055753-0364171682 RUTH G BLONDIN 17168 GANNON WAY ACTIVE 22-16703-01-030 164.02$ 50.00$ 47.60$ 261.62$ 00105678-0364171021 ERIC GOEMAN 17102 GANNON WAY ACTIVE 22-16703-01-070 552.16$ 50.00$ 133.93$ 736.09$ 00076501-0364171757 SHAWN HERDINA 17175 GANNON WAY ACTIVE 22-16703-02-010 332.92$ 50.00$ 85.17$ 468.09$ 00055736-0364170254 ARTHUR ROBERTS 17025 GANNON WAY ACTIVE 22-16703-02-130 230.98$ 50.00$ 62.49$ 343.47$ 00097196-0264169919 MINDY HILL 16991 GEORGETOWN WAY ACTIVE 22-16704-01-040 260.04$ 50.00$ 68.96$ 379.00$ 00053079-0170073197 TAMMY COSSETTE-POLAK 7319 170TH ST W ACTIVE 22-16704-02-020 430.12$ 50.00$ 106.78$ 586.90$ 00103651-0264170172 VICTOR MAKORI 17017 GEORGETOWN WAY ACTIVE 22-16704-04-060 809.56$ 50.00$ 191.18$ 1,050.74$ Page 768 of 899 00064254-0264170750 ALVIN SMITH 17075 GEORGETOWN WAY ACTIVE 22-16704-04-180 328.92$ 50.00$ 84.28$ 463.20$ 00053947-0264170792 BRIAN HART 17079 GEORGETOWN WAY ACTIVE 22-16704-04-190 515.99$ 50.00$ 125.88$ 691.87$ 00053931-0264170081 KENT JOYNER 17008 GEORGETOWN WAY ACTIVE 22-16704-06-020 370.03$ 50.00$ 93.42$ 513.45$ 00076389-0264170123 KEVIN FOX 17012 GEORGETOWN WAY ACTIVE 22-16704-06-030 266.00$ 50.00$ 70.28$ 386.28$ 00114511-0264170941 DOSTONBEK MUMINOV 17094 GEORGETOWN WAY ACTIVE 22-16704-06-150 632.18$ 50.00$ 151.72$ 833.90$ 00077503-0264170982 ERIK SUNSDAHL 17098 GEORGETOWN WAY ACTIVE 22-16704-06-160 532.52$ 50.00$ 129.56$ 712.08$ 00117053-0926123416 BRENDA ESTERLY 20177 GINSENG WAY ACTIVE 22-16716-01-050 377.00$ 50.00$ 94.97$ 521.97$ 00116694-0926123411 MICHAEL HILLER 20176 GINSENG WAY ACTIVE 22-16716-01-140 106.83$ 50.00$ 34.88$ 191.71$ 00119111-0926129941 ERIK MARTINEZ 20171 GAMBREL PATH ACTIVE 22-16716-03-050 150.03$ 50.00$ 44.49$ 244.52$ 00118809-0926129666 CURTIS KELLY 20412 GALVESTON PL ACTIVE 22-16716-04-020 269.88$ 50.00$ 71.14$ 391.02$ 00116215-0926125506 MOHAMED ALI 7355 204TH ST W ACTIVE 22-16716-06-010 787.69$ 50.00$ 186.31$ 1,024.00$ 00115234-0926123586 MICHAEL THOMPSON 7403 204TH ST W ACTIVE 22-16716-06-040 185.85$ 50.00$ 52.46$ 288.31$ 00115812-0926125116 JONATHAN WU 7356 204TH ST W ACTIVE 22-16716-06-100 414.13$ 50.00$ 103.23$ 567.36$ 00117216-0926126821 AHMED HUSSEIN 20457 GINGER CT ACTIVE 22-16716-06-110 192.22$ 50.00$ 53.87$ 296.09$ 00118898-0926130271 JUSTIN ROSS 20341 GARGOYLE LA ACTIVE 22-16717-08-050 200.58$ 50.00$ 55.73$ 306.31$ 00118595-0926129986 NICHOLAS DULAS 20405 GALVESTON PL ACTIVE 22-16717-09-070 114.03$ 50.00$ 36.48$ 200.51$ 00000000-2000000737 SAMUEL LARSON 7012 205TH ST W ACTIVE 22-16717-11-020 118.89$ 50.00$ 37.56$ 206.45$ 00000000-2000000736 ZERFIE FEREDE 7036 205TH ST W ACTIVE 22-16717-11-040 96.72$ 50.00$ 32.63$ 179.35$ 00104114-0926098856 AARON ABDISSA 20962 GROMMET AVE ACTIVE 22-16740-02-040 323.93$ 50.00$ 83.17$ 457.10$ 00113404-0926100266 SANTIAGO ORTIZ 20933 GROMMET AVE ACTIVE 22-16740-02-040 381.73$ 50.00$ 96.02$ 527.75$ 00106546-0926105476 VICKY INSIXIENGMAY 20878 GREENWOOD AVE ACTIVE 22-16740-03-060 581.65$ 50.00$ 140.49$ 772.14$ 00099171-0926099626 DAVID BANKS 20914 GROMMET AVE ACTIVE 22-16740-07-080 197.00$ 50.00$ 54.94$ 301.94$ 00110470-0926101746 HEATHER COUGHLIN 20953 GREENWOOD CT ACTIVE 22-16740-07-140 551.29$ 50.00$ 133.73$ 735.02$ 00104633-0926105001 XAVIER SOGOYOU 20863 HARTFORD WAY ACTIVE 22-16741-01-110 588.00$ 50.00$ 141.90$ 779.90$ 00099733-0926100911 RICHARD MACK 20855 GOODHUE WAY ACTIVE 22-16741-03-030 185.02$ 50.00$ 52.27$ 287.29$ 00113782-0926105231 OULWATOSIN BADEJO 20881 GUTHRIE DR ACTIVE 22-16742-01-030 107.53$ 50.00$ 35.04$ 192.57$ 00101074-0209086758 NEIL ROBERTS 8675 209TH ST W ACTIVE 22-16900-01-010 513.99$ 50.00$ 125.44$ 689.43$ 00110170-0797189196 SANYII LAMU 18919 INCA AVE ACTIVE 22-16950-01-090 234.28$ 50.00$ 63.23$ 347.51$ 00102091-0797189543 NICOLE YOHN 18954 INCA AVE ACTIVE 22-16950-02-010 291.79$ 50.00$ 76.02$ 417.81$ 00113100-0797189162 LESLIE BUTLER 18916 INCA AVE ACTIVE 22-16950-02-080 292.60$ 50.00$ 76.20$ 418.80$ 00105231-0797188628 JAY SCHLIESMAN 18862 INCA AVE ACTIVE 22-16950-02-160 351.10$ 50.00$ 89.21$ 490.31$ 00117139-0795189370 KARLA TILLMAN 18937 INLET RD ACTIVE 22-16950-02-220 166.88$ 50.00$ 48.24$ 265.12$ 00118056-0795189107 NATHAN BOYER 18910 INLET RD ACTIVE 22-16950-03-210 499.80$ 50.00$ 122.28$ 672.08$ 00112127-0795189024 KAREN LEE 18902 INLET RD ACTIVE 22-16950-03-230 312.58$ 50.00$ 80.64$ 443.22$ 00078023-0190092856 CATHY SCOTT 9285 190TH ST W ACTIVE 22-16951-01-020 150.02$ 50.00$ 44.49$ 244.51$ 00087035-0926087846 TAMARA CAMPBELL 21283 IXONIA LA ACTIVE 22-16975-02-010 486.52$ 50.00$ 119.33$ 655.85$ 00114065-0898213200 PAUL BAKER 21320 ISOTOPE TR ACTIVE 22-16975-03-010 430.03$ 50.00$ 106.76$ 586.79$ 00085321-0926086081 BRIAN LARSON 21245 ISOTOPE TR ACTIVE 22-16975-04-020 166.86$ 50.00$ 48.23$ 265.09$ 00085021-0926086106 BENJAMIN SHEA 21068 ISTRIA PATH ACTIVE 22-16976-02-180 135.63$ 50.00$ 41.29$ 226.92$ 00096521-0926087496 RYAN LAMOUREUX 9801 211TH ST W ACTIVE 22-16976-03-090 664.18$ 50.00$ 158.84$ 873.02$ 00075619-0926091041 JOYCE AYESU 21161 ISOTOPE TR ACTIVE 22-16977-01-020 174.57$ 50.00$ 49.95$ 274.52$ 00102223-0926089856 STEVEN AMOAPIM 21259 INSPIRATION PATH ACTIVE 22-16977-02-080 625.10$ 50.00$ 150.15$ 825.25$ 00087784-0926090336 KRISHNA TINGELHOFF 21290 INSPIRATION CT ACTIVE 22-16977-04-110 345.53$ 50.00$ 87.97$ 483.50$ 00106551-0926093531 AMY WOODFILL 9501 212TH ST W ACTIVE 22-16978-01-120 642.68$ 50.00$ 154.06$ 846.74$ 00091381-0926092926 DANIEL CONNER 9692 212TH ST W ACTIVE 22-16978-02-020 667.13$ 50.00$ 159.50$ 876.63$ 00108369-0926092606 JEFFREY DOLAN 9606 212TH ST W ACTIVE 22-16978-02-050 426.93$ 50.00$ 106.07$ 583.00$ 00103433-0374161145 IRENE WON 16114 GOODVIEW WAY ACTIVE 22-17000-02-070 81.01$ 50.00$ 29.14$ 160.15$ 00107261-0380161261 ANNE MCCLIMON 16126 GROVE TR ACTIVE 22-17000-03-170 296.59$ 50.00$ 77.09$ 423.68$ 00098289-0386162073 AMANDA JOVANOVIC 16207 GOODVIEW TR ACTIVE 22-17000-04-040 542.75$ 50.00$ 131.83$ 724.58$ 00056160-0380162756 THOMAS REINAN 16275 GROVE TR ACTIVE 22-17001-02-070 363.97$ 50.00$ 92.07$ 506.04$ 00066864-0256163144 BRUCE CLEMENT 16314 GRINNELL CIR ACTIVE 22-17002-01-130 238.13$ 50.00$ 64.08$ 352.21$ 00055309-0349163614 KENT WENGENROTH 16361 GRINNELL AVE ACTIVE 22-17002-01-170 771.89$ 50.00$ 182.80$ 1,004.69$ 00000000-2000000049 BRYAN LAM 16276 GREENBRIAR CT ACTIVE 22-17002-02-350 203.63$ 50.00$ 56.41$ 310.04$ 00119176-0347163350 SEAN RAYBALL 16335 GREENBRIAR LA ACTIVE 22-17002-02-370 122.71$ 50.00$ 38.41$ 211.12$ 00108421-0382173504 SCOTT MONSON 17350 GREENVIEW CIR ACTIVE 22-17050-03-030 316.13$ 50.00$ 81.43$ 447.56$ 00114596-0381173224 NURA DEDALE 17322 GOLDENVIEW AVE ACTIVE 22-17050-04-010 769.50$ 50.00$ 182.27$ 1,001.77$ 00089667-0381174305 FRANCISCA STAND STRONG 17430 GOLDENVIEW AVE ACTIVE 22-17050-04-070 159.25$ 50.00$ 46.54$ 255.79$ Page 769 of 899 00000000-2000000256 HEATHER RODRIGUEZ 17446 GOLDENVIEW AVE ACTIVE 22-17050-04-090 157.25$ 50.00$ 46.09$ 253.34$ 00092866-0942077922 OMAR GURASE 7792 UPPER 171ST ST W ACTIVE 22-17051-03-030 980.52$ 50.00$ 229.20$ 1,259.72$ 00101859-0942078045 HOA T MAI 7804 UPPER 171ST ST W ACTIVE 22-17051-03-040 415.32$ 50.00$ 103.49$ 568.81$ 00109377-0172077873 AMY LORD 7787 172ND ST W ACTIVE 22-17051-03-060 534.38$ 50.00$ 129.97$ 714.35$ 00099241-0172077535 KATHY STRESE 7753 172ND ST W ACTIVE 22-17051-03-080 354.34$ 50.00$ 89.93$ 494.27$ 00106444-0261174318 BETH VOELKER 17431 GOODHUE AVE ACTIVE 22-17052-03-130 180.70$ 50.00$ 51.31$ 282.01$ 00097993-0261174144 JIAXI LU 17414 GOODHUE AVE ACTIVE 22-17052-04-010 169.79$ 50.00$ 48.88$ 268.67$ 00091474-0174084182 ELIZABETH SUTTER 8418 174TH ST W ACTIVE 22-17075-02-040 238.91$ 50.00$ 64.26$ 353.17$ 00117237-0173079456 MARION SLUSHER 7945 173RD ST W ACTIVE 22-17100-01-090 786.52$ 50.00$ 186.05$ 1,022.57$ 00064536-0174079992 ERIC SHARBO 7999 174TH ST W ACTIVE 22-17100-03-080 216.20$ 50.00$ 59.21$ 325.41$ 00095736-0173079407 CURT PETERSON 7940 173RD ST W ACTIVE 22-17100-03-160 267.70$ 50.00$ 70.66$ 388.36$ 00105054-0384173106 NATHAN WATERMAN 17310 GROVE AVE ACTIVE 22-17100-04-010 828.09$ 50.00$ 195.30$ 1,073.39$ 00089616-0174080321 MAXWELL LASALLE 8032 174TH ST W ACTIVE 22-17100-05-010 115.41$ 50.00$ 36.79$ 202.20$ 00110781-0174079661 DAVID GLESMANN 7966 174TH ST W ACTIVE 22-17100-05-050 230.81$ 50.00$ 62.46$ 343.27$ 00082618-0422174587 GLEN D SHAW 17458 HAYES AVE ACTIVE 22-17101-02-110 193.27$ 50.00$ 54.11$ 297.38$ 00083287-0384174187 ANN HELVICK 17418 GROVE AVE ACTIVE 22-17102-02-030 563.16$ 50.00$ 136.37$ 749.53$ 00106313-0419171422 SHARON HEGGEDAHL 17142 HAMILTON DR ACTIVE 22-17150-02-130 536.21$ 50.00$ 130.38$ 716.59$ 00066681-0419170887 ANDREW KNOX 17088 HAMILTON DR ACTIVE 22-17150-02-180 717.75$ 50.00$ 170.76$ 938.51$ 00089633-0420171890 ROBERT EPPLE 17189 HANNIBAL CT ACTIVE 22-17151-02-110 376.94$ 50.00$ 94.96$ 521.90$ 00102229-0419170564 MICHAEL HANSON 17056 HAMILTON DR ACTIVE 22-17151-03-030 921.22$ 50.00$ 216.01$ 1,187.23$ 00056565-0419170325 D POWELL 17032 HAMILTON DR ACTIVE 22-17151-03-070 251.05$ 50.00$ 66.96$ 368.01$ 00110411-0421171212 GENARO CARAVANTES 17121 HARRINGTON WAY ACTIVE 22-17152-04-050 228.23$ 50.00$ 61.88$ 340.11$ 00056640-0422170486 RUSS TERRELL 17048 HAYES AVE ACTIVE 22-17152-05-120 161.60$ 50.00$ 47.06$ 258.66$ 00086124-0422170114 SHAWN DAY 17011 HAYES AVE ACTIVE 22-17152-06-110 544.39$ 50.00$ 132.20$ 726.59$ 00110423-0419170200 JOHN WOLD 17020 HAMILTON DR ACTIVE 22-17152-07-020 158.26$ 50.00$ 46.32$ 254.58$ 00103050-0421172400 HEATHER LEEKE 17240 HARRINGTON WAY ACTIVE 22-17153-02-050 274.67$ 50.00$ 72.21$ 396.88$ 00084872-0421172723 GINA NGUYEN 17272 HARRINGTON WAY ACTIVE 22-17153-02-090 349.28$ 50.00$ 88.80$ 488.08$ 00114591-0926100611 WILSON OBUNGA 18886 IBARRA TR ACTIVE 22-17200-04-080 990.51$ 50.00$ 231.42$ 1,271.93$ 00100483-0926099631 NIKOLA VARBANOV 18805 HYLA AVE ACTIVE 22-17200-04-130 859.97$ 50.00$ 202.39$ 1,112.36$ 00102847-0926103861 PAUL HEBERT 18917 HYLA AVE ACTIVE 22-17200-04-200 695.02$ 50.00$ 165.70$ 910.72$ 00099371-0926099011 JEFFEREY WOOD 18838 IDEN AVE ACTIVE 22-17201-04-060 1,257.63$ 50.00$ 290.83$ 1,598.46$ 00094737-0926099016 MYKE SAMPAYO 18717 HUXLEY AVE ACTIVE 22-17201-05-010 774.83$ 50.00$ 183.45$ 1,008.28$ 00099899-0926100926 MARK ULMEN 18805 IDEN WAY ACTIVE 22-17201-05-090 1,248.80$ 50.00$ 288.87$ 1,587.67$ 00099410-0926100311 AMY MCCALLISTER 18910 IDEN WAY ACTIVE 22-17201-06-040 335.49$ 50.00$ 85.74$ 471.23$ 00116107-0926114771 ADANE KOJI 8728 188TH ST W ACTIVE 22-17203-03-050 715.36$ 50.00$ 170.22$ 935.58$ 00107146-0926110241 ADAM BOARD 18862 HOUSTON WAY ACTIVE 22-17203-03-130 466.38$ 50.00$ 114.85$ 631.23$ 00108390-0926111631 MEGAN RILEY 18801 HOUSTON WAY ACTIVE 22-17203-05-010 609.76$ 50.00$ 146.74$ 806.50$ 00114665-0926108041 MAGGIE HINCHLEY 8782 189TH ST W ACTIVE 22-17203-06-020 461.37$ 50.00$ 113.73$ 625.10$ 00105601-0926107776 SHELLY GARNER 8740 189TH ST W ACTIVE 22-17203-06-050 564.86$ 50.00$ 136.75$ 751.61$ 00083778-0926109731 JENNIFER SUCHA 8698 189TH ST W ACTIVE 22-17203-06-080 661.29$ 50.00$ 158.20$ 869.49$ 00107515-0926109841 CURTIS BATULIS 8670 189TH ST W ACTIVE 22-17203-06-100 1,119.75$ 50.00$ 260.17$ 1,429.92$ 00106488-0926109041 GREG SELLERS 18976 HUNTLEY TR ACTIVE 22-17203-06-140 1,039.47$ 50.00$ 242.31$ 1,331.78$ 00106880-0926109141 MICHAEL BURNETT 18937 HUNTLEY TR ACTIVE 22-17203-07-100 326.41$ 50.00$ 83.72$ 460.13$ 00105389-0926107046 BRYLEE DEML 18941 HUNTLEY TR ACTIVE 22-17203-07-110 319.94$ 50.00$ 82.28$ 452.22$ 00074699-0517208425 TIM ALLEN 20842 JACQUARD AVE ACTIVE 22-17750-01-030 500.43$ 50.00$ 122.42$ 672.85$ 00114229-0461209981 GEORGE LELAND MEYER 20998 ITERI AVE ACTIVE 22-17750-03-120 347.58$ 50.00$ 88.43$ 486.01$ 00116419-0456208857 JSW PROPERTIES LLC 20885 ITALY AVE ACTIVE 22-17750-03-190 394.06$ 50.00$ 98.76$ 542.82$ 00107651-0456208428 ERIC RUTHIG 20842 ITALY AVE ACTIVE 22-17750-04-030 230.54$ 50.00$ 62.40$ 342.94$ 00101268-0455208437 MIRIAM DUQUE 20843 ISLE AVE ACTIVE 22-17750-04-220 616.98$ 50.00$ 148.34$ 815.32$ 00118586-0455208429 JOHN MCDONALD 20842 ISLE AVE ACTIVE 22-17750-05-030 277.29$ 50.00$ 72.79$ 400.08$ 00115998-0926124901 SCOTT BORCHERT 17965 GIANTS WAY ACTIVE 22-18090-01-150 266.36$ 50.00$ 70.36$ 386.72$ 00118214-0926128066 KHADRA AHMED IBRAHIM 17947 GIANTS WAY ACTIVE 22-18090-01-240 107.61$ 50.00$ 35.05$ 192.66$ 00000000-2000000291 SCOTT CHANDRADAT 17905 GIANTS WAY ACTIVE 22-18090-01-450 129.38$ 50.00$ 39.90$ 219.28$ 00117144-0926125741 AARON KOTHE 17974 GIANTS WAY ACTIVE 22-18090-01-670 122.71$ 50.00$ 38.41$ 211.12$ 00115716-0926124451 SAI RAMYA VANI KANAKAM 17990 GIANTS WAY ACTIVE 22-18090-01-750 484.83$ 50.00$ 118.95$ 653.78$ 00115715-0926124456 DARA RISHI 17992 GIANTS WAY ACTIVE 22-18090-01-760 114.91$ 50.00$ 36.68$ 201.59$ 00104286-0245170903 JIMMY COLLIER 17090 EMBERS AVE ACTIVE 22-18100-05-102 898.73$ 50.00$ 211.01$ 1,159.74$ Page 770 of 899 00107066-0245171307 MICHAEL LIEN 17130 EMBERS AVE ACTIVE 22-18100-05-301 1,083.15$ 50.00$ 252.02$ 1,385.17$ 00112338-0245171463 RACHEL A BORST 17146 EMBERS AVE ACTIVE 22-18100-05-402 282.71$ 50.00$ 74.00$ 406.71$ 00104241-0247170786 DANIEL HEMCHAND RAMROOP 17078 ENCINA PATH ACTIVE 22-18100-06-602 451.56$ 50.00$ 111.55$ 613.11$ 00109803-0247171610 ABEBECH SEYOUM 17161 ENCINA PATH ACTIVE 22-18101-06-007 324.21$ 50.00$ 83.23$ 457.44$ 00104324-0247171453 KRISTOPHER JOHNSTONE 17145 ENCINA PATH ACTIVE 22-18101-06-107 179.34$ 50.00$ 51.01$ 280.35$ 00110338-0247171156 PEI THOMPSON GBATU 17115 ENCINA PATH ACTIVE 22-18101-06-304 336.75$ 50.00$ 86.02$ 472.77$ 00109540-0247170950 ERIK NOLTE 17095 ENCINA PATH ACTIVE 22-18101-06-407 179.40$ 50.00$ 51.02$ 280.42$ 00104259-0245171414 KASSANDRA AUGEDAHL 17141 EMBERS AVE ACTIVE 22-18101-07-203 151.44$ 50.00$ 44.80$ 246.24$ 00109217-0247170653 FABIAN SEGURA 17065 ENCINA PATH ACTIVE 22-18102-07-406 1,598.61$ 50.00$ 366.67$ 2,015.28$ 00119155-0926085871 LLOYD SALIMBAO 17040 EMBERS AVE ACTIVE 22-18102-07-506 248.27$ 50.00$ 66.34$ 364.61$ 00114426-0172053742 NIMO SHEIKH 5374 172ND ST W ACTIVE 22-18103-05-701 3,284.82$ 50.00$ 741.70$ 4,076.52$ 00112123-0172053940 SUSAN ECKLEY 5394 172ND ST W ACTIVE 22-18103-05-803 304.03$ 50.00$ 78.74$ 432.77$ 00117642-0247172071 JOSIAH MOMANYI 17207 ENCINA PATH ACTIVE 22-18103-05-906 329.94$ 50.00$ 84.50$ 464.44$ 00112150-0172053692 RICHARD KAISER 5369 172ND ST W ACTIVE 22-18103-06-901 244.45$ 50.00$ 65.49$ 359.94$ 00116979-0172053833 ERIC FROOM 5383 172ND ST W ACTIVE 22-18103-06-905 694.44$ 50.00$ 165.57$ 910.01$ 00112122-0172053916 DUNG TRUONG 5391 172ND ST W ACTIVE 22-18103-07-004 737.89$ 50.00$ 175.24$ 963.13$ 00112521-0247172295 TEJASHREE ITZEL SHRI CHOUDHARY 17229 ENCINA PATH ACTIVE 22-18103-07-604 320.95$ 50.00$ 82.50$ 453.45$ 00112138-0247172345 NICOLE KROENKE 17234 ENCINA PATH ACTIVE 22-18103-07-706 151.22$ 50.00$ 44.75$ 245.97$ 00061228-0771204953 LINDA TREPANIER 20495 INDEPENDENCE AVE ACTIVE 22-18200-01-030 1,535.33$ 50.00$ 352.59$ 1,937.92$ 00094633-0207093855 DEXTER LEWIS 9385 207TH ST W ACTIVE 22-18200-04-070 997.19$ 50.00$ 232.91$ 1,280.10$ 00099160-0778203792 GRANT BOWDEN 20379 IDAHO CT ACTIVE 22-18201-01-020 905.99$ 50.00$ 212.62$ 1,168.61$ 00068980-0778203784 ERIC WOODRUFF 20378 IDAHO CT ACTIVE 22-18201-01-050 142.69$ 50.00$ 42.86$ 235.55$ 00071767-0773204407 THOMAS CARR 20440 IMPATIENS WAY ACTIVE 22-18201-02-080 158.67$ 50.00$ 46.41$ 255.08$ 00095397-0173065950 MELLISSA REMBLESKI 6595 173RD ST W ACTIVE 22-18300-01-060 716.25$ 50.00$ 170.42$ 936.67$ 00065704-0329066050 TIM SANDAGE 6605 FOLSOM PATH ACTIVE 22-18300-02-070 786.09$ 50.00$ 185.96$ 1,022.05$ 00066329-0175065610 MICHAEL LIDEN 6561 175TH ST W ACTIVE 22-18301-02-080 466.12$ 50.00$ 114.79$ 630.91$ 00096204-0175066709 SAMATHA RIBELIN 6670 175TH ST W ACTIVE 22-18301-03-020 216.77$ 50.00$ 59.33$ 326.10$ 00092048-0175067293 KEVIN MILLER 6729 175TH ST W ACTIVE 22-18301-04-070 659.37$ 50.00$ 157.77$ 867.14$ 00115563-0300173651 ACCESS RECOVERY CENTER 17365 FONTANA PATH ACTIVE 22-18301-04-080 578.91$ 50.00$ 139.88$ 768.79$ 00079756-0300174055 ISAAC FRIMPONG 17405 FONTANA PATH ACTIVE 22-18301-04-100 122.71$ 50.00$ 38.41$ 211.12$ 00053541-0175067202 JEFFREY PIERICK 6720 175TH ST W ACTIVE 22-18301-05-030 473.25$ 50.00$ 116.38$ 639.63$ 00089890-0341175103 NATHAN BRACKENBURY 17510 FOXBORO LA ACTIVE 22-18304-04-020 526.01$ 50.00$ 128.11$ 704.12$ 00075160-0365175203 SCOT DROTNING 17520 GAGE AVE ACTIVE 22-18305-01-040 476.48$ 50.00$ 117.09$ 643.57$ 00066782-0365175435 STEVEN SIRRINE 17543 GAGE AVE ACTIVE 22-18305-02-020 1,003.56$ 50.00$ 234.32$ 1,287.88$ 00114541-0174069613 CARLOS RAMIREZ 6961 174TH ST W ACTIVE 22-18306-02-030 481.59$ 50.00$ 118.23$ 649.82$ 00070216-0173069903 PATRICK GOUGH 6990 173RD ST W ACTIVE 22-18306-03-050 509.63$ 50.00$ 124.47$ 684.10$ 00067496-0173069549 MERLE HILTNER 6954 173RD ST W ACTIVE 22-18306-03-070 86.34$ 50.00$ 30.32$ 166.66$ 00116281-0174068417 ADDIS MESKELA 6841 174TH ST W ACTIVE 22-18306-03-140 537.05$ 50.00$ 130.57$ 717.62$ 00090572-0391169501 DEREK SCHMEIDEL 16950 HARBOR CT ACTIVE 22-18501-01-010 527.61$ 50.00$ 128.47$ 706.08$ 00091696-0391169154 JENAYE GREER 16915 HARBOR CT ACTIVE 22-18501-01-070 93.49$ 50.00$ 31.91$ 175.40$ 00099567-0277166506 GRAHAM JOHNSON 16650 HEARTHSIDE CT ACTIVE 22-18520-01-090 267.35$ 50.00$ 70.58$ 387.93$ 00101908-0926103606 DAKOTA TRUCK 21450 HUMBOLDT CT ACTIVE 22-18525-01-023 1,714.79$ 50.00$ 392.51$ 2,157.30$ 00081525-0678170131 VLADIMIR BRUTSKY 17013 GALLEON CIR ACTIVE 22-18530-02-060 308.41$ 50.00$ 79.71$ 438.12$ 00096907-0926097766 KRISTOFFER VERPLANK 19332 HILLDALE AVE ACTIVE 22-18536-01-040 140.37$ 50.00$ 42.34$ 232.71$ 00095366-0926095191 WILLIAM FLIKEID 19356 HEARTH CT ACTIVE 22-18536-02-100 607.65$ 50.00$ 146.27$ 803.92$ 00096593-0926097046 TINA GAROFOLO 19073 HARAPPA AVE ACTIVE 22-18537-01-010 119.53$ 50.00$ 37.71$ 207.24$ 00097703-0926096871 JASON DECKER 19175 HARAPPA AVE ACTIVE 22-18537-01-040 647.67$ 50.00$ 155.17$ 852.84$ 00095742-0926095701 STEPHANIE SWANSON 19472 195TH CT ACTIVE 22-18537-06-060 331.80$ 50.00$ 84.92$ 466.72$ 00117953-0926100336 DESERT MEDIA GROUP 19265 HILLDALE AVE ACTIVE 22-18538-01-040 167.34$ 50.00$ 48.34$ 265.68$ 00110661-0926098201 AHMED MADAR 19198 HILLDALE AVE ACTIVE 22-18538-02-080 570.45$ 50.00$ 137.99$ 758.44$ 00099276-0926099856 MATTHEW NELSEN 19293 HIMALAYA AVE ACTIVE 22-18538-02-220 678.41$ 50.00$ 162.01$ 890.42$ 00110286-0231162902 DAVID THILL 16290 CRYSTAL HILLS DR ACTIVE 22-18550-01-190 453.73$ 50.00$ 112.04$ 615.77$ 00103098-0594166751 SATYA CONGER 16675 INNSBROOK DR ACTIVE 22-18586-01-010 806.92$ 50.00$ 190.59$ 1,047.51$ 00113119-0274170410 TODD WRIGHT 17041 HUNTINGTON PATH ACTIVE 22-18590-01-050 467.97$ 50.00$ 115.20$ 633.17$ 00115478-0473167957 NELLY HERNANDEZ-OLIVARES 16795 ILLINOIS AVE ACTIVE 22-18595-01-040 302.13$ 50.00$ 78.32$ 430.45$ 00083074-0596166563 CHRISTOPHER D ABURIME TSTE 16656 IMPERIAL CT ACTIVE 22-18595-04-040 83.97$ 50.00$ 29.80$ 163.77$ 00079330-0651166882 GREGG STEVENS 16688 INTERLACHEN BLVD ACTIVE 22-18597-01-090 641.06$ 50.00$ 153.70$ 844.76$ Page 771 of 899 00080008-0651162545 WENDY SWANSON 16254 INTERLACHEN BLVD ACTIVE 22-18598-02-060 437.31$ 50.00$ 108.38$ 595.69$ 00109679-0161090974 TARA SHEPPARD 9097 161ST ST W ACTIVE 22-18599-01-060 291.87$ 50.00$ 76.04$ 417.91$ 00101384-0656164359 ANDREA OVERGAARD 16435 IRIS CT ACTIVE 22-18599-05-060 1,014.44$ 50.00$ 236.74$ 1,301.18$ 00103393-0656164405 GERIS KRAUS 16440 IRIS CT ACTIVE 22-18599-05-070 754.22$ 50.00$ 178.87$ 983.09$ 00085013-0926095121 ADAM HARKLERODE 17329 GALLE CT ACTIVE 22-18600-03-040 685.82$ 50.00$ 163.65$ 899.47$ 00097117-0926093731 LUKE RITCHIE 17338 GALLE CT ACTIVE 22-18600-03-080 1,142.67$ 50.00$ 265.26$ 1,457.93$ 00081576-0235179617 MARK KIECKER 17961 FULDA TR ACTIVE 22-18600-06-150 555.41$ 50.00$ 134.65$ 740.06$ 00089066-0234179733 DORI HARRIS 17973 FULLERTON CT ACTIVE 22-18600-06-170 415.32$ 50.00$ 103.49$ 568.81$ 00082877-0234179931 TRACY TRAN 17993 FULLERTON CT ACTIVE 22-18600-06-220 158.26$ 50.00$ 46.32$ 254.58$ 00082657-0725179341 VERONIKA BARBER 17934 FLUSHING HILLS LA ACTIVE 22-18600-06-270 1,186.83$ 50.00$ 275.08$ 1,511.91$ 00091425-0926085216 ADAM M GODES 17596 GERDINE PATH ACTIVE 22-18601-03-070 472.94$ 50.00$ 116.31$ 639.25$ 00082854-0720177548 JON LARSON 17754 FORTUNE TR ACTIVE 22-18601-05-010 1,042.16$ 50.00$ 242.91$ 1,335.07$ 00109154-0177071400 WAYNE BEDEAUX 7140 177TH ST W ACTIVE 22-18602-03-030 107.61$ 50.00$ 35.05$ 192.66$ 00107565-0229178427 ADUGNA DINKA 17842 FORMOSA CT ACTIVE 22-18603-01-010 1,103.89$ 50.00$ 256.64$ 1,410.53$ 00086112-0926084811 CHUDI IGBANUGO 17865 FORMOSA CT ACTIVE 22-18603-01-080 897.23$ 50.00$ 210.67$ 1,157.90$ 00116358-0926123926 ALISSA M. BOCK 16409 JAFFNA PL ACTIVE 22-18670-01-110 315.25$ 50.00$ 81.24$ 446.49$ 00117648-0926123941 MOHAMED WEHELIE 16421 JAFFNA PL ACTIVE 22-18670-01-130 967.22$ 50.00$ 226.24$ 1,243.46$ 00117331-0926125201 RAJITHA KILARU 16368 JAFFNA PL ACTIVE 22-18670-01-310 375.55$ 50.00$ 94.65$ 520.20$ 00116312-0926124021 MOHAMED A. FARAH 16494 JAFFNA PL ACTIVE 22-18670-01-520 304.44$ 50.00$ 78.83$ 433.27$ 00104233-0495163064 DELVIN ROY 16306 JAVA LA ACTIVE 22-18700-01-050 827.82$ 50.00$ 195.24$ 1,073.06$ 00112809-0495163703 SHONTEL WILSON 16370 JAVA LA ACTIVE 22-18700-01-120 300.53$ 50.00$ 77.96$ 428.49$ 00085915-0495164057 CELESTE ERNST 16405 JAVA LA ACTIVE 22-18700-02-020 450.67$ 50.00$ 111.35$ 612.02$ 00109011-0547163062 CALEB FISHER 16306 JEWEL AVE ACTIVE 22-18700-03-180 582.93$ 50.00$ 140.77$ 773.70$ 00094527-0461195445 AMY MAYER 19540 ITERI AVE ACTIVE 22-18950-01-015 127.68$ 50.00$ 39.52$ 217.20$ 00114239-0462177268 JENNIFER ULMER 17726 IXONIA AVE ACTIVE 22-19400-02-090 1,047.95$ 50.00$ 244.20$ 1,342.15$ 00113215-0462179900 YASMIN NOOR 17990 IXONIA AVE ACTIVE 22-19401-03-090 132.71$ 50.00$ 40.64$ 223.35$ 00099719-0180098903 ROBERT PALMER 9890 180TH ST W ACTIVE 22-19401-04-030 481.39$ 50.00$ 118.19$ 649.58$ 00056880-0457175954 THOMAS BRANHAM 17595 ITALY CT ACTIVE 22-19402-01-050 216.47$ 50.00$ 59.27$ 325.74$ 00071227-0457176259 SUZANNE AMANOR-WILKS 17625 ITALY CT ACTIVE 22-19402-01-080 381.50$ 50.00$ 95.97$ 527.47$ 00067611-0458176555 PATRICK MOYLAN 17655 ITALY PATH ACTIVE 22-19402-01-100 76.69$ 50.00$ 28.18$ 154.87$ 00107351-0178097255 MICHAEL MURRAY 9725 178TH ST W ACTIVE 22-19403-02-050 660.60$ 50.00$ 158.05$ 868.65$ 00116881-0459177800 SUMMIT RE-ENTRY 17780 ITEN CT N ACTIVE 22-19403-02-060 720.51$ 50.00$ 171.37$ 941.88$ 00114138-0178095804 SOLANGE MORELLI BAIRD 9580 178TH ST W ACTIVE 22-19403-04-060 320.23$ 50.00$ 82.34$ 452.57$ 00066650-0454176963 LAWRENCE MCGUNNIGLE 17696 ISLETON CT ACTIVE 22-19403-05-050 102.63$ 50.00$ 33.95$ 186.58$ 00102044-0178095309 ADAM PRCHAL 9530 178TH ST W ACTIVE 22-19404-01-020 132.71$ 50.00$ 40.64$ 223.35$ 00106672-0458178650 CACIE PADDOCK 17865 ITALY PATH ACTIVE 22-19405-02-010 401.60$ 50.00$ 100.44$ 552.04$ 00106057-0458179054 JOEL STROZEWSKI 17905 ITALY PATH ACTIVE 22-19405-02-050 395.48$ 50.00$ 99.08$ 544.56$ 00109281-0458179450 LEANNA HOFFMANN 17945 ITALY PATH ACTIVE 22-19405-02-090 165.41$ 50.00$ 47.91$ 263.32$ 00112614-0455178604 TRISTAN YOREK 17860 ISLE AVE ACTIVE 22-19405-04-050 382.65$ 50.00$ 96.23$ 528.88$ 00114993-0474176621 JULIE SOMERSON 17662 IONIA CT ACTIVE 22-19406-01-061 242.81$ 50.00$ 65.12$ 357.93$ 00106430-0479175552 FELIPE CAMPOS 17555 ILLINOIS CT ACTIVE 22-19407-01-050 395.65$ 50.00$ 99.12$ 544.77$ 00080815-0480175559 TIM BROWN 17555 ICELAND CT ACTIVE 22-19407-01-150 961.66$ 50.00$ 225.00$ 1,236.66$ 00106469-0481175244 RENNIE HUMENSKY 17524 ICELAND TR ACTIVE 22-19407-02-040 512.11$ 50.00$ 125.02$ 687.13$ 00057136-0481177240 CLAYTON SNYDER 17724 ICELAND TR ACTIVE 22-19407-05-050 287.13$ 50.00$ 74.98$ 412.11$ 00074200-0481176804 JAMIE CLAFLIN 17680 ICELAND TR ACTIVE 22-19407-05-100 460.67$ 50.00$ 113.58$ 624.25$ 00115397-0481177232 COLTON SCHOCK 17723 ICELAND TR ACTIVE 22-19407-06-050 83.97$ 50.00$ 29.80$ 163.77$ 00118969-0481177075 ROBERT HANSEN 17707 ICELAND TR ACTIVE 22-19407-06-070 161.49$ 50.00$ 47.04$ 258.53$ 00057126-0481176655 ARNOLD STEINHAUER 17665 ICELAND TR ACTIVE 22-19407-07-010 566.68$ 50.00$ 137.16$ 753.84$ 00083171-0176093207 DANIEL WIGGINS 9320 176TH ST W ACTIVE 22-19407-07-030 438.11$ 50.00$ 108.56$ 596.67$ 00098729-0431176805 ERIC CASTRO 17680 IDALIA PATH ACTIVE 22-19600-03-020 1,083.99$ 50.00$ 252.21$ 1,386.20$ 00102771-0926098566 KELLY SHERWIN 16672 DIAMONTE PATH ACTIVE 22-20205-01-200 207.90$ 50.00$ 57.36$ 315.26$ 00119242-0926109441 ABDISHAJUR JAAMAC 16154 ESTATE LA ACTIVE 22-20580-02-110 80.57$ 50.00$ 29.04$ 159.61$ 00117672-0926109721 QADIYA BOQOR 16114 ESTATE LA ACTIVE 22-20580-02-160 932.50$ 50.00$ 218.52$ 1,201.02$ 00114223-0926107501 ISSE OMAR 16074 ESTATE LA ACTIVE 22-20580-02-210 305.73$ 50.00$ 79.12$ 434.85$ 00110689-0926105746 NASRA GIAMA 16019 ESTATE LA ACTIVE 22-20580-03-030 398.19$ 50.00$ 99.68$ 547.87$ 00105662-0926107811 DAN MARTINEZ 16155 ESTATE LA ACTIVE 22-20580-03-170 1,172.90$ 50.00$ 271.99$ 1,494.89$ 00118856-0926107571 ADDIAZIZ BARRE 16163 ESTATE LA ACTIVE 22-20580-03-180 115.41$ 50.00$ 36.79$ 202.20$ Page 772 of 899 00106508-0926109261 DURR-E-HABIB ROOMI 5673 162ND ST W ACTIVE 22-20580-03-270 526.77$ 50.00$ 128.28$ 705.05$ 00068426-0322171139 CAROL HAUSCHILD 17113 FRAZER PATH ACTIVE 22-20850-01-050 86.34$ 50.00$ 30.32$ 166.66$ 00109878-0322171055 DALTON STEVENS 17105 FRAZER PATH ACTIVE 22-20850-01-060 177.32$ 50.00$ 50.56$ 277.88$ 00073358-0322170792 KARLA BJORKQUIST 17079 FRAZER PATH ACTIVE 22-20850-01-110 508.32$ 50.00$ 124.18$ 682.50$ 00101048-0322170396 SAVON LONG 17039 FRAZER PATH ACTIVE 22-20850-01-210 4,456.38$ 50.00$ 1,002.27$ 5,508.65$ 00078058-0365171756 KAELENE KLEMICK 17175 GAGE AVE ACTIVE 22-20850-02-130 376.91$ 50.00$ 94.95$ 521.86$ 00102738-0326170855 JACOB THIELEN 17085 FRANCHISE WAY ACTIVE 22-20850-03-160 179.83$ 50.00$ 51.12$ 280.95$ 00116761-0365171343 BENJAMIN JOHNSON 17134 GAGE AVE ACTIVE 22-20850-04-040 267.36$ 50.00$ 70.58$ 387.94$ 00118219-0322170305 RICHARD SAUCEDA 17030 FRAZER PATH ACTIVE 22-20850-05-010 176.85$ 50.00$ 50.45$ 277.30$ 00096852-0316171152 TSION HAILU 17115 FOLIAGE AVE ACTIVE 22-20850-05-140 534.22$ 50.00$ 129.94$ 714.16$ 00096263-0324170980 JOLIE PEREZ 17098 FORBES CT ACTIVE 22-20850-06-070 83.23$ 50.00$ 29.63$ 162.86$ 00000000-2000000026 MARVIN ROSEMAN 16147 EXCELSIOR DR ACTIVE 22-20860-01-090 151.10$ 50.00$ 44.73$ 245.83$ 00101677-0240161915 JULIA WENCL 16191 EXCELSIOR DR ACTIVE 22-20860-01-120 115.41$ 50.00$ 36.79$ 202.20$ 00053726-0238162156 KENDALL SNARE 16215 EXCELSIOR CIR ACTIVE 22-20860-01-160 306.88$ 50.00$ 79.37$ 436.25$ 00102669-0238162271 JUAN MORALES 16227 EXCELSIOR CIR ACTIVE 22-20860-01-190 364.01$ 50.00$ 92.08$ 506.09$ 00113338-0239161348 CATALINO ARCE GALAN 16134 EXCELSIOR CT ACTIVE 22-20860-02-060 692.24$ 50.00$ 165.08$ 907.32$ 00083531-0240162400 VICTOR PYNE 16240 EXCELSIOR DR ACTIVE 22-20861-01-090 281.96$ 50.00$ 73.83$ 405.79$ 00102864-0240162384 SAMUEL HALVERSON 16238 EXCELSIOR DR ACTIVE 22-20861-01-100 303.83$ 50.00$ 78.70$ 432.53$ 00097837-0240162327 CHRIS EKEGREN 16232 EXCELSIOR DR ACTIVE 22-20861-01-130 114.42$ 50.00$ 36.57$ 200.99$ 00081524-0240162475 JOY RUDKIN 16247 EXCELSIOR DR ACTIVE 22-20861-02-060 362.51$ 50.00$ 91.75$ 504.26$ 00103431-0222160943 BEN MARTIN 16094 DODD LA ACTIVE 22-20861-03-080 371.09$ 50.00$ 93.66$ 514.75$ 00092361-0237160607 SARAH VOTO 16060 EXCEL WAY ACTIVE 22-20862-01-080 567.82$ 50.00$ 137.41$ 755.23$ 00115499-0237160235 JOSHUA PICKETT 16023 EXCEL WAY ACTIVE 22-20862-02-090 281.98$ 50.00$ 73.84$ 405.82$ 00113887-0173064631 CORY SAWREY 6463 173RD ST W ACTIVE 22-20876-02-020 122.71$ 50.00$ 38.41$ 211.12$ 00090217-0173064409 JUSTEN KASTNER 6440 173RD ST W ACTIVE 22-20876-03-010 758.33$ 50.00$ 179.78$ 988.11$ 00083515-0173064607 TODD COLLETT 6460 173RD ST W ACTIVE 22-20876-03-020 100.79$ 50.00$ 33.54$ 184.33$ 00109996-0331173282 ROBERTO OMANA 17328 FIRMAN CT ACTIVE 22-20876-03-060 159.25$ 50.00$ 46.54$ 255.79$ 00098669-0330174281 NICOLE ORR 17428 FINCH PATH ACTIVE 22-20877-01-070 615.44$ 50.00$ 148.00$ 813.44$ 00103986-0330172954 SHERRI ORELLANA 17295 FINCH PATH ACTIVE 22-20877-02-130 556.99$ 50.00$ 135.00$ 741.99$ 00118974-0175062989 TAMAN ABDI 6298 175TH ST W ACTIVE 22-20877-04-030 137.33$ 50.00$ 41.66$ 228.99$ 00096841-0295174961 NATHAN ROSE 17496 FISHER CT ACTIVE 22-20878-01-010 715.40$ 50.00$ 170.23$ 935.63$ 00073292-0295174714 MICHAEL THELEN 17471 FISHER CT ACTIVE 22-20878-01-050 537.86$ 50.00$ 130.75$ 718.61$ 00113496-0175064761 NEANG NHEAN 6476 175TH ST W ACTIVE 22-20878-03-020 516.54$ 50.00$ 126.00$ 692.54$ 00098916-0452209743 JOSHUA TOMLINSON 20974 IRAN AVE ACTIVE 22-20900-01-010 346.77$ 50.00$ 88.25$ 485.02$ 00085324-0452208703 TOM BREIT 20870 IRAN AVE ACTIVE 22-20900-01-070 121.23$ 50.00$ 38.08$ 209.31$ 00076908-0336165358 DEBBIE BROOKE 16535 FIELDCREST AVE ACTIVE 22-20980-04-030 1,777.12$ 50.00$ 406.37$ 2,233.49$ 00113083-0715165086 JEFFREY HEALY 16508 FALLBROOK DR ACTIVE 22-20981-02-050 1,194.81$ 50.00$ 276.86$ 1,521.67$ 00114744-0336166091 ALYSHA NELSON 16609 FIELDCREST AVE ACTIVE 22-20981-02-080 238.12$ 50.00$ 64.08$ 352.20$ 00054767-0336165887 JIM OLLHOFF 16588 FIELDCREST AVE ACTIVE 22-20981-03-040 137.33$ 50.00$ 41.66$ 228.99$ 00108930-0717165589 ERIC ACKERMAN 16558 FARRAGO TR ACTIVE 22-20981-04-010 768.68$ 50.00$ 182.08$ 1,000.76$ 00071574-0721166573 JAMES JAUCH 16657 FALLBROOK CT ACTIVE 22-20981-05-140 608.70$ 50.00$ 146.50$ 805.20$ 00072022-0718166594 BRETT STUCKER 16659 FESTAL AVE ACTIVE 22-20981-06-040 378.27$ 50.00$ 95.25$ 523.52$ 00090675-0165074390 KARA BOLAND 7439 165TH ST W ACTIVE 22-21100-03-050 383.76$ 50.00$ 96.47$ 530.23$ 00109784-0361166958 CESAR FLORES 16695 GLADIOLA AVE ACTIVE 22-21100-03-120 86.34$ 50.00$ 30.32$ 166.66$ 00110777-0167073507 HENRY ONSONGO 7350 167TH ST W ACTIVE 22-21100-04-010 165.46$ 50.00$ 47.92$ 263.38$ 00114628-0900074531 LUIS REYES 7453 UPPER 167TH CT W ACTIVE 22-21100-04-090 787.98$ 50.00$ 186.38$ 1,024.36$ 00090788-0167072871 TARA BERGUM 7287 167TH ST W ACTIVE 22-21100-05-130 405.36$ 50.00$ 101.28$ 556.64$ 00091161-0167073259 JEREMY MITCHELL 7325 167TH ST W ACTIVE 22-21100-05-160 551.42$ 50.00$ 133.76$ 735.18$ 00087927-0361165406 DYLAN ROHDA 16540 GLADIOLA AVE ACTIVE 22-21100-05-250 370.71$ 50.00$ 93.57$ 514.28$ 00083763-0165072840 RYAN SMITH 7284 165TH ST W ACTIVE 22-21100-06-030 900.19$ 50.00$ 211.33$ 1,161.52$ 00090523-0357166004 JOSHUA WESSEL 16600 GENESEE AVE ACTIVE 22-21100-06-270 824.23$ 50.00$ 194.44$ 1,068.67$ 00110474-0353166420 RUSSELL GALLAWAY 16642 GANNON AVE ACTIVE 22-21101-02-130 260.05$ 50.00$ 68.96$ 379.01$ 00106315-0913071300 CARLISHA LYLES 7130 167TH CT W ACTIVE 22-21101-04-130 689.59$ 50.00$ 164.49$ 904.08$ 00112700-0168070759 JOSHUA NAATJES 7075 168TH ST W ACTIVE 22-21101-04-200 159.25$ 50.00$ 46.54$ 255.79$ 00087060-0353167980 DANNY HARJO 16798 GANNON AVE ACTIVE 22-21101-05-030 649.11$ 50.00$ 155.49$ 854.60$ 00118052-0353161629 SIAD SHUKUWE 16162 GANNON AVE ACTIVE 22-21170-01-060 283.23$ 50.00$ 74.11$ 407.34$ 00101767-0353162189 HOWARD COLLETTE 16218 GANNON AVE ACTIVE 22-21170-01-090 600.78$ 50.00$ 144.74$ 795.52$ Page 773 of 899 00093215-0353163443 KEVIN BARTH 16344 GANNON AVE ACTIVE 22-21170-01-170 724.06$ 50.00$ 172.16$ 946.22$ 00055432-0353163989 ALAN GENTILI 16398 GANNON AVE ACTIVE 22-21170-01-200 80.57$ 50.00$ 29.04$ 159.61$ 00055437-0353164326 NORMAN WELCH 16432 GANNON AVE ACTIVE 22-21170-01-230 83.45$ 50.00$ 29.68$ 163.13$ 00065100-0906071192 MICHAEL PERSONS 7119 UPPER 164TH ST W ACTIVE 22-21170-01-300 698.39$ 50.00$ 166.45$ 914.84$ 00113143-0906070459 BIRHAN MELAKE 7045 UPPER 164TH ST W ACTIVE 22-21170-01-340 336.03$ 50.00$ 85.86$ 471.89$ 00104455-0353162551 BRIAN SCHIEGAL 16255 GANNON AVE ACTIVE 22-21170-02-050 525.72$ 50.00$ 128.05$ 703.77$ 00055423-0353163195 DENNIS D HUSTON 16319 GANNON AVE ACTIVE 22-21170-02-070 159.25$ 50.00$ 46.54$ 255.79$ 00110892-0353164474 COURTNEY FOSTER 16447 GANNON AVE ACTIVE 22-21170-02-160 353.01$ 50.00$ 89.63$ 492.64$ 00077783-0353164557 MICHAEL BERNARD 16455 GANNON AVE ACTIVE 22-21170-02-180 353.26$ 50.00$ 89.69$ 492.95$ 00113524-0353164631 SHAWN ROSS 16463 GANNON AVE ACTIVE 22-21170-02-190 783.01$ 50.00$ 185.27$ 1,018.28$ 00089264-0358164537 WILLIAM FINK 16453 GENESEE CT ACTIVE 22-21170-02-340 172.75$ 50.00$ 49.54$ 272.29$ 00112371-0360163196 PHILIP KOWNSLAR 16319 GERMANE CT ACTIVE 22-21170-02-480 165.46$ 50.00$ 47.92$ 263.38$ 00065797-0360163436 MICHELLE CLOUTIER 16343 GERMANE CT ACTIVE 22-21170-02-500 136.07$ 50.00$ 41.38$ 227.45$ 00080951-0361162254 KEITH TARG 16225 GLADIOLA AVE ACTIVE 22-21170-03-100 1,601.62$ 50.00$ 367.34$ 2,018.96$ 00087093-0361162593 KEVIN STEINOLFSON 16259 GLADIOLA AVE ACTIVE 22-21170-03-120 463.47$ 50.00$ 114.20$ 627.67$ 00118682-0906073503 JENNIFER NGUYEN 7350 UPPER 164TH ST W ACTIVE 22-21170-04-010 168.35$ 50.00$ 48.56$ 266.91$ 00055336-0351166356 RANDY DAHLEN 16635 GALAXIE WAY ACTIVE 22-21171-05-120 401.54$ 50.00$ 100.43$ 551.97$ 00103535-0352166900 WILLIAM FISCHER 16690 GALENA AVE ACTIVE 22-21171-05-200 642.78$ 50.00$ 154.08$ 846.86$ 00095033-0352166488 HARVEY BILL 16648 GALENA AVE ACTIVE 22-21171-05-250 660.04$ 50.00$ 157.92$ 867.96$ 00099403-0352168476 SOKHOM SOK 16847 GALENA AVE ACTIVE 22-21171-07-060 725.12$ 50.00$ 172.40$ 947.52$ 00080823-0319161853 RICK KIELAS 16185 FRANCHISE AVE ACTIVE 22-21172-01-060 124.93$ 50.00$ 38.91$ 213.84$ 00083508-0161068990 DAVID BENNETT 6899 161ST ST W ACTIVE 22-21172-01-110 99.43$ 50.00$ 33.23$ 182.66$ 00067081-0161067554 SHAWN MARKHART 6755 161ST ST W ACTIVE 22-21172-01-190 430.25$ 50.00$ 106.81$ 587.06$ 00113103-0161068529 RYAN WINCHESTER 6852 161ST ST W ACTIVE 22-21172-02-040 397.33$ 50.00$ 99.49$ 546.82$ 00108039-0162067058 EDWIN KALINA 6705 162ND ST W ACTIVE 22-21172-02-120 562.16$ 50.00$ 136.15$ 748.31$ 00102892-0162067371 CAYLA SCHLEUTER 6737 162ND ST W ACTIVE 22-21172-02-130 236.85$ 50.00$ 63.80$ 350.65$ 00081815-0162068734 GREG LONG 6873 162ND ST W ACTIVE 22-21172-02-210 868.56$ 50.00$ 204.30$ 1,122.86$ 00112771-0319162307 CRAIG MYERS 16230 FRANCHISE AVE ACTIVE 22-21172-03-010 328.80$ 50.00$ 84.25$ 463.05$ 00095252-0904067911 SEAN DOWD 6791 UPPER 162ND ST W ACTIVE 22-21172-03-170 322.99$ 50.00$ 82.96$ 455.95$ 00114172-0319162463 KAYLA SILVERS 16246 FRANCHISE AVE ACTIVE 22-21172-03-230 330.30$ 50.00$ 84.58$ 464.88$ 00102655-0904068067 DENISE CONRIGHT 6806 UPPER 162ND ST W ACTIVE 22-21172-04-070 646.88$ 50.00$ 154.99$ 851.87$ 00104223-0313162840 JODI HANSEN 16284 FLORIDA WAY ACTIVE 22-21172-05-070 546.04$ 50.00$ 132.57$ 728.61$ 00092156-0313163228 MIKE MARTIN 16322 FLORIDA WAY ACTIVE 22-21172-05-130 256.12$ 50.00$ 68.08$ 374.20$ 00101289-0313162659 BECKY EMERSON 16265 FLORIDA WAY ACTIVE 22-21172-06-010 303.89$ 50.00$ 78.71$ 432.60$ 00112777-0313162733 JUAN CERVANTES 16273 FLORIDA WAY ACTIVE 22-21172-06-040 716.19$ 50.00$ 170.41$ 936.60$ 00110684-0313163657 PAUL LIEBENOW 16365 FLORIDA WAY ACTIVE 22-21172-06-110 441.71$ 50.00$ 109.36$ 601.07$ 00069928-0359066376 JOSEPH D SILVA 6637 GERDINE PATH ACTIVE 22-21172-06-150 783.44$ 50.00$ 185.37$ 1,018.81$ 00073942-0359068406 JEFFREY ERICKSON 6840 GERDINE PATH ACTIVE 22-21172-07-010 541.95$ 50.00$ 131.66$ 723.61$ 00110117-0359067242 BRAD ELLSWORTH 6724 GERDINE PATH ACTIVE 22-21172-07-080 252.74$ 50.00$ 67.33$ 370.07$ 00110583-0320165349 JACOB VONRENTZELL 16534 FRAZER WAY ACTIVE 22-21172-08-040 312.70$ 50.00$ 80.67$ 443.37$ 00075625-0320165745 BRENT LARROW 16574 FRAZER WAY ACTIVE 22-21172-08-080 244.33$ 50.00$ 65.46$ 359.79$ 00054702-0316165972 ROBERT STARKS 16597 FOLIAGE AVE ACTIVE 22-21172-09-120 640.32$ 50.00$ 153.53$ 843.85$ 00085510-0167068606 MARCUS HUBMER 6860 167TH ST W ACTIVE 22-21172-11-010 724.63$ 50.00$ 172.29$ 946.92$ 00096277-0941068369 ADRIAN LAFFITTE 6836 168TH CT W ACTIVE 22-21172-11-260 185.66$ 50.00$ 52.41$ 288.07$ 00057802-0941068054 KEITH JOHNSON 6805 168TH CT W ACTIVE 22-21172-11-290 437.25$ 50.00$ 108.37$ 595.62$ 00078778-0165065851 DEAN GARANT 6585 165TH ST W ACTIVE 22-21173-01-080 447.92$ 50.00$ 110.74$ 608.66$ 00078378-0165065752 JEFFREY COLLINS 6575 165TH ST W ACTIVE 22-21173-01-090 742.18$ 50.00$ 176.19$ 968.37$ 00098266-0165065257 AARON HOLM 6525 165TH ST W ACTIVE 22-21173-01-120 314.18$ 50.00$ 81.00$ 445.18$ 00054595-0314165164 CHERYL PRESLER 16516 FLORIN AVE ACTIVE 22-21173-01-130 247.34$ 50.00$ 66.13$ 363.47$ 00088939-0314166105 PHILLIP BRUNNER 16610 FLORIN AVE ACTIVE 22-21173-01-210 702.47$ 50.00$ 167.36$ 919.83$ 00112642-0314166154 ELLIOT SNESRUD 16615 FLORIN AVE ACTIVE 22-21173-01-270 320.46$ 50.00$ 82.39$ 452.85$ 00099392-0167066303 MATTHEW NAGEL 6630 167TH ST W ACTIVE 22-21173-01-330 223.50$ 50.00$ 60.83$ 334.33$ 00116225-0166065959 LISA OSTRANDER 6595 166TH ST W ACTIVE 22-21173-02-120 175.50$ 50.00$ 50.15$ 275.65$ 00110312-0911065866 SICKEL PROPERTIES 6586 165TH CT W ACTIVE 22-21173-02-160 610.24$ 50.00$ 146.84$ 807.08$ 00103086-0911065973 CLINTON CARSTON 6597 165TH CT W ACTIVE 22-21173-02-190 431.08$ 50.00$ 107.00$ 588.08$ 00116060-0911065858 JEREMY OKEEFE 6585 165TH CT W ACTIVE 22-21173-02-210 277.87$ 50.00$ 72.92$ 400.79$ 00085925-0316164660 SARA POPPLE 16466 FOLIAGE AVE ACTIVE 22-21173-03-210 770.86$ 50.00$ 182.57$ 1,003.43$ Page 774 of 899 00063995-0166066486 MARLYS BERUBE 6648 166TH ST W ACTIVE 22-21173-04-030 487.04$ 50.00$ 119.44$ 656.48$ 00073994-0166066668 ADAM D WOLFE 6666 166TH ST W ACTIVE 22-21173-04-040 347.98$ 50.00$ 88.52$ 486.50$ 00108620-0316166541 ERIC CRAM 16654 FOLIAGE AVE ACTIVE 22-21173-04-060 388.91$ 50.00$ 97.62$ 536.53$ 00100130-0168066005 JUAN MAYA 6600 168TH ST W ACTIVE 22-21174-01-180 163.12$ 50.00$ 47.40$ 260.52$ 00076292-0908067008 SARA WENSTAD 6700 UPPER 167TH ST W ACTIVE 22-21174-02-050 117.36$ 50.00$ 37.22$ 204.58$ 00083818-0316167903 JASON ELLIS 16790 FOLIAGE AVE ACTIVE 22-21174-02-090 762.14$ 50.00$ 180.63$ 992.77$ 00081359-0168066633 DEAN TRAYNOR 6663 168TH ST W ACTIVE 22-21174-02-170 437.52$ 50.00$ 108.43$ 595.95$ 00074092-0909066355 PATRICIA RUTHERFORD 6635 LOWER 169TH ST W ACTIVE 22-21174-03-160 914.19$ 50.00$ 214.45$ 1,178.64$ 00111501-0169065550 AMANDA BYLANDER 6555 169TH ST W ACTIVE 22-21174-04-070 455.80$ 50.00$ 112.50$ 618.30$ 00088043-0315066262 PETER HUNTER 6626 FLOUNDER CT ACTIVE 22-21174-04-170 1,315.47$ 50.00$ 303.70$ 1,669.17$ 00068675-0169065402 RONALD G DAVIS 6540 169TH ST W ACTIVE 22-21174-05-020 223.50$ 50.00$ 60.83$ 334.33$ 00067117-0169066103 ROBIN ARENDS 6610 169TH ST W ACTIVE 22-21174-05-060 122.71$ 50.00$ 38.41$ 211.12$ 00118458-0163070754 SONJA BUCKNER 7075 163RD ST W ACTIVE 22-21175-01-010 289.28$ 50.00$ 75.46$ 414.74$ 00112687-0904072903 ALLEN DIAZ 7290 UPPER 162ND ST W ACTIVE 22-21175-03-010 415.30$ 50.00$ 103.49$ 568.79$ 00092801-0355162757 DAVID KLEM 16275 GARNER AVE ACTIVE 22-21175-03-120 308.63$ 50.00$ 79.76$ 438.39$ 00119275-0355164159 MIKE MAIN 16415 GARNER AVE ACTIVE 22-21175-03-190 188.74$ 50.00$ 53.10$ 291.84$ 00080029-0355164456 ERIC WICKOREN 16445 GARNER AVE ACTIVE 22-21175-03-210 918.39$ 50.00$ 215.38$ 1,183.77$ 00103557-0355163508 ADAM BRUERS 16350 GARNER AVE ACTIVE 22-21175-05-150 494.28$ 50.00$ 121.05$ 665.33$ 00108422-0905071458 EMMA WRIGHT 7145 UPPER 163RD ST W ACTIVE 22-21175-05-170 443.65$ 50.00$ 109.79$ 603.44$ 00116246-0905071052 MATT KOCH 7105 UPPER 163RD ST W ACTIVE 22-21175-05-190 626.51$ 50.00$ 150.46$ 826.97$ 00100619-0311163816 CORY KINSMAN 16381 FLAGSTAFF AVE ACTIVE 22-21176-01-080 614.07$ 50.00$ 147.70$ 811.77$ 00076322-0901060935 JUNE ANDERSON 6093 LOWER 161ST ST W ACTIVE 22-21177-01-050 93.49$ 50.00$ 31.91$ 175.40$ 00057458-0901062816 STEVEN C LORENZ 6281 LOWER 161ST ST W ACTIVE 22-21177-02-030 728.37$ 50.00$ 173.12$ 951.49$ 00074581-0901063715 LARRY KENDRICK 6371 LOWER 161ST ST W ACTIVE 22-21177-02-080 932.76$ 50.00$ 218.58$ 1,201.34$ 00066560-0901064259 JAMES WEAVER 6425 LOWER 161ST ST W ACTIVE 22-21177-02-110 580.63$ 50.00$ 140.26$ 770.89$ 00104130-0311162081 TRAVIS HILDEBRANDT 16208 FLAGSTAFF AVE ACTIVE 22-21177-02-260 281.97$ 50.00$ 73.83$ 405.80$ 00105699-0309163653 ASHLEY GARCIA 16365 FISHING AVE ACTIVE 22-21177-03-060 347.38$ 50.00$ 88.38$ 485.76$ 00109407-0164064350 SARAH WILLIAMS 6435 164TH ST W ACTIVE 22-21177-03-070 655.40$ 50.00$ 156.89$ 862.29$ 00102822-0311163303 PETER RALSTON 16330 FLAGSTAFF AVE ACTIVE 22-21177-03-130 637.52$ 50.00$ 152.91$ 840.43$ 00057743-0309164917 BRIAN KILMARTIN 16491 FISHING AVE ACTIVE 22-21177-04-050 728.87$ 50.00$ 173.23$ 952.10$ 00103815-0311165167 BLAINE JACKSON 16516 FLAGSTAFF AVE ACTIVE 22-21177-04-230 230.82$ 50.00$ 62.46$ 343.28$ 00092465-0312165703 SARA MARCHESE 16570 FLAGSTAFF WAY W ACTIVE 22-21177-05-050 823.13$ 50.00$ 194.19$ 1,067.32$ 00105528-0312165802 JENNIFER CANEDO 16580 FLAGSTAFF WAY W ACTIVE 22-21177-05-060 440.03$ 50.00$ 108.99$ 599.02$ 00117267-0312166305 MONTANAY ADAMS 16630 FLAGSTAFF WAY W ACTIVE 22-21177-05-110 108.10$ 50.00$ 35.16$ 193.26$ 00054297-0303164418 JUDY HALLAWAY 16441 FARCRY WAY ACTIVE 22-21177-06-010 217.90$ 50.00$ 59.58$ 327.48$ 00099931-0312164102 JASON BENESH 16410 FLAGSTAFF WAY W ACTIVE 22-21177-06-060 267.35$ 50.00$ 70.58$ 387.93$ 00082332-0304165505 DOMONIC NELSON 16550 FERNANDO WAY ACTIVE 22-21177-07-140 186.03$ 50.00$ 52.50$ 288.53$ 00103205-0312165133 SANDRA RODRIGUEZ 16513 FLAGSTAFF WAY W ACTIVE 22-21177-07-260 117.01$ 50.00$ 37.14$ 204.15$ 00109656-0306164100 JOSHUA ODELL 16410 FINCH WAY ACTIVE 22-21177-08-050 238.13$ 50.00$ 64.08$ 352.21$ 00090540-0306164324 JANET HAWES 16432 FINCH WAY ACTIVE 22-21177-08-060 359.54$ 50.00$ 91.09$ 500.63$ 00111412-0304165216 CHRISTINE DORAN 16521 FERNANDO WAY ACTIVE 22-21177-08-120 178.39$ 50.00$ 50.80$ 279.19$ 00109647-0304164813 TYLER LEMMERMAN 16481 FERNANDO WAY ACTIVE 22-21177-08-160 346.65$ 50.00$ 88.22$ 484.87$ 00076690-0304164714 BRIAN DALY 16471 FERNANDO WAY ACTIVE 22-21177-08-170 946.82$ 50.00$ 221.70$ 1,218.52$ 00111361-0304164516 AARON WESSEL 16451 FERNANDO WAY ACTIVE 22-21177-08-190 260.05$ 50.00$ 68.96$ 379.01$ 00076069-0307164133 BILL LUCIER 16413 FINDLAY WAY ACTIVE 22-21177-08-210 739.07$ 50.00$ 175.50$ 964.57$ 00113115-0304163914 TYTUS THIEDE 16391 FERNANDO WAY ACTIVE 22-21177-09-080 187.13$ 50.00$ 52.74$ 289.87$ 00054313-0304163443 KATHY PROVOST 16344 FERNANDO WAY ACTIVE 22-21177-10-100 397.70$ 50.00$ 99.57$ 547.27$ 00111264-0304163625 AMAN MUHAMED 16362 FERNANDO WAY ACTIVE 22-21177-10-110 289.28$ 50.00$ 75.46$ 414.74$ 00104103-0302163437 AMY PETER 16343 FANTASIA AVE ACTIVE 22-21177-10-150 673.19$ 50.00$ 160.85$ 884.04$ 00116429-0302163254 MOHAMUD MOHAMED 16325 FANTASIA AVE ACTIVE 22-21177-10-160 321.49$ 50.00$ 82.62$ 454.11$ 00111136-0301163610 ROBINDYANAUTH PERSAUD 16361 FAIRGREEN AVE ACTIVE 22-21177-11-010 315.73$ 50.00$ 81.34$ 447.07$ 00077307-0302164146 MICHAEL MORK 16414 FANTASIA AVE ACTIVE 22-21177-11-230 201.59$ 50.00$ 55.96$ 307.55$ 00090982-0161061888 DARREN LAWRENCE 6188 161ST ST W ACTIVE 22-21177-13-100 469.13$ 50.00$ 115.46$ 634.59$ 00052703-0162060210 FAYE NELSON 6021 162ND ST W ACTIVE 22-21177-13-250 216.37$ 50.00$ 59.24$ 325.61$ 00094311-0901060802 BRAD FREDRICKSON 6080 LOWER 161ST ST W ACTIVE 22-21177-14-040 773.69$ 50.00$ 183.20$ 1,006.89$ 00111697-0161062019 AHMED ALI 6201 161ST ST W ACTIVE 22-21177-14-140 208.89$ 50.00$ 57.58$ 316.47$ 00112594-0161061839 EDOH ADADE 6183 161ST ST W ACTIVE 22-21177-14-150 235.35$ 50.00$ 63.46$ 348.81$ Page 775 of 899 00092041-0901062501 STEVE GISCH 6250 LOWER 161ST ST W ACTIVE 22-21177-15-010 355.10$ 50.00$ 90.10$ 495.20$ 00052676-0161062902 BETH ELLEN HOO 6290 161ST ST W ACTIVE 22-21177-17-030 158.26$ 50.00$ 46.32$ 254.58$ 00091515-0308161567 LORI REIS 16156 FINLAND AVE ACTIVE 22-21177-17-060 506.66$ 50.00$ 123.81$ 680.47$ 00106214-0162062919 MELISSA ROSE 6291 162ND ST W ACTIVE 22-21177-17-100 447.58$ 50.00$ 110.67$ 608.25$ 00088460-0310162405 MELISSA GOLDSWORTHY 16240 FISHING WAY ACTIVE 22-21177-19-060 588.47$ 50.00$ 142.00$ 780.47$ 00092566-0306163680 JARED MORTON 16368 FINCH WAY ACTIVE 22-21177-20-060 920.24$ 50.00$ 215.79$ 1,186.03$ 00113400-0926095871 JESSICA GITCH 8852 196TH ST W ACTIVE 22-21195-04-030 223.67$ 50.00$ 60.87$ 334.54$ 00087831-0926089226 PATRICK RANDALL 8978 196TH ST W ACTIVE 22-21195-04-120 726.32$ 50.00$ 172.66$ 948.98$ 00093709-0926094046 RAMPRASATH PRAKASH 8883 197TH ST W ACTIVE 22-21195-04-190 256.02$ 50.00$ 68.06$ 374.08$ 00080734-0926096101 NICOLE ZICH 8884 197TH ST W ACTIVE 22-21195-06-050 275.85$ 50.00$ 72.47$ 398.32$ 00100980-0926087011 DEREK CAMPBELL 19864 ITEA AVE ACTIVE 22-21195-07-310 257.00$ 50.00$ 68.28$ 375.28$ 00093754-0926088621 LINDSEY MARTIN 19876 IBERIS AVE ACTIVE 22-21196-08-040 258.24$ 50.00$ 68.56$ 376.80$ 00107432-0926098486 MUSA DHINBIL 19697 IDEALIC AVE ACTIVE 22-21198-01-070 1,211.02$ 50.00$ 280.46$ 1,541.48$ 00102377-0926102386 MATT WEIERS 19832 ITEA AVE ACTIVE 22-21198-03-070 151.61$ 50.00$ 44.84$ 246.45$ 00114048-0926102096 ABDDALLE ADDE 20597 KAISER CIR ACTIVE 22-23800-01-030 675.89$ 50.00$ 161.45$ 887.34$ 00112392-0926102721 NICHOLAS BROWN 20635 KAISER WAY ACTIVE 22-23800-03-070 113.15$ 50.00$ 36.29$ 199.44$ 00101702-0926100346 SHEHAAN HUSSEIN 20657 KAISER WAY ACTIVE 22-23800-03-150 1,272.06$ 50.00$ 294.04$ 1,616.10$ 00110330-0408205605 LAXMI RAMJATTAN 20560 HUGHES AVE ACTIVE 22-23900-01-060 453.18$ 50.00$ 111.91$ 615.09$ 00058855-0408206405 NICK MAHOWALD 20640 HUGHES AVE ACTIVE 22-23900-02-050 250.18$ 50.00$ 66.76$ 366.94$ 00103476-0926105321 KELLEY DETLEFSEN 9142 187TH ST W ACTIVE 22-26570-02-110 413.20$ 50.00$ 103.02$ 566.22$ 00111976-0926112296 YASIM HASSAN 9128 187TH ST W ACTIVE 22-26570-02-120 1,015.01$ 50.00$ 236.87$ 1,301.88$ 00114873-0926092131 JALENE URGESSA 16201 FALLBROOK DR ACTIVE 22-26700-01-120 223.50$ 50.00$ 60.83$ 334.33$ 00087104-0926089146 ANKUR CHAKRABARTY 16397 FANNING CT ACTIVE 22-26700-03-100 256.05$ 50.00$ 68.07$ 374.12$ 00110261-0926092136 BRIAN CARLETON 16216 FALLBROOK DR ACTIVE 22-26700-03-180 340.16$ 50.00$ 86.78$ 476.94$ 00099598-0926090706 CORY CORDELL 16473 FALKIRK CIR ACTIVE 22-26700-04-090 203.26$ 50.00$ 56.33$ 309.59$ 00090599-0926091131 KANDASAMY BALAKRISHNAN 16425 ENDEAVOR CT ACTIVE 22-26700-06-100 544.00$ 50.00$ 132.11$ 726.11$ 00109873-0926090976 ASHLEY NANDLALL 16479 ENDEAVOR CT ACTIVE 22-26700-06-140 733.30$ 50.00$ 174.21$ 957.51$ 00103158-0926092541 DEBRA STUBBS 16591 FALKIRK TR ACTIVE 22-26703-01-060 799.39$ 50.00$ 188.91$ 1,038.30$ 00090580-0926092051 TARA SPILLERS 16544 DODD LA ACTIVE 22-26703-03-040 125.37$ 50.00$ 39.00$ 214.37$ 00117241-0926092631 AYANLE JAMA 16572 DODD LA ACTIVE 22-26703-03-060 2,385.97$ 50.00$ 541.79$ 2,977.76$ 00110234-0926092651 JOSHUA SORENSON 16632 DODD LA ACTIVE 22-26704-03-030 803.21$ 50.00$ 189.76$ 1,042.97$ 00117107-0207089903 NATE SANDEEN 8990 207TH ST W ACTIVE 22-27000-01-050 560.21$ 50.00$ 135.72$ 745.93$ 00098213-0510174053 SARA FRAZIER 17405 JERSEY WAY ACTIVE 22-27500-01-250 287.07$ 50.00$ 74.97$ 412.04$ 00109682-0510173360 MAGGIE ABBOUD 17336 JERSEY WAY ACTIVE 22-27500-02-030 213.12$ 50.00$ 58.52$ 321.64$ 00084019-0507174306 JEREMY GALLEY 17430 JAVA CT N ACTIVE 22-27500-02-210 586.88$ 50.00$ 141.65$ 778.53$ 00059679-0507174462 MICHAEL J MCKASY 17446 JAVA CT N ACTIVE 22-27500-02-230 551.41$ 50.00$ 133.76$ 735.17$ 00087407-0207090653 BARB MAXWELL 9065 207TH ST W ACTIVE 22-27550-02-010 89.97$ 50.00$ 31.13$ 171.10$ 00089855-0925205955 JESSE PEDERSON 20595 207TH CT W ACTIVE 22-27550-02-160 300.55$ 50.00$ 77.97$ 428.52$ 00073573-0925205856 MARK CAHOW 20585 207TH CT W ACTIVE 22-27550-02-170 526.92$ 50.00$ 128.31$ 705.23$ 00104075-0908075159 NICK HEBERT 7515 UPPER 167TH ST W ACTIVE 22-27600-01-030 636.44$ 50.00$ 152.67$ 839.11$ 00085414-0908075639 ANNE PAHL 7563 UPPER 167TH ST W ACTIVE 22-27600-01-070 92.99$ 50.00$ 31.80$ 174.79$ 00074539-0908075878 ERIC SCHMIDT 7587 UPPER 167TH ST W ACTIVE 22-27600-01-090 705.77$ 50.00$ 168.09$ 923.86$ 00093172-0369169277 TAMI STELLICK 16927 GRENADIER AVE ACTIVE 22-27600-04-170 102.74$ 50.00$ 33.97$ 186.71$ 00104856-0170079236 ASHLEY LUND 7923 170TH ST W ACTIVE 22-27600-04-220 93.49$ 50.00$ 31.91$ 175.40$ 00084008-0370168557 KEITH JOHNSON 16855 GREENLAND PATH ACTIVE 22-27600-05-070 149.65$ 50.00$ 44.40$ 244.05$ 00100406-0170078238 MARK BUSCHBACHER 7823 170TH ST W ACTIVE 22-27600-05-210 100.30$ 50.00$ 33.43$ 183.73$ 00089397-0170077230 PAUL OLSON 7723 170TH ST W ACTIVE 22-27600-05-260 270.14$ 50.00$ 71.20$ 391.34$ 00088905-0373169974 JODY REYES 16997 GLENWOOD AVE ACTIVE 22-27600-06-010 130.03$ 50.00$ 40.04$ 220.07$ 00082793-0373168653 NICOLE RUUD 16865 GLENWOOD AVE ACTIVE 22-27600-06-060 599.09$ 50.00$ 144.36$ 793.45$ 00084204-0908076827 HAQUE KAZI 7682 UPPER 167TH ST W ACTIVE 22-27600-06-120 285.25$ 50.00$ 74.56$ 409.81$ 00085084-0908075605 TUAN VU 7560 UPPER 167TH ST W ACTIVE 22-27600-07-110 1,268.76$ 50.00$ 293.31$ 1,612.07$ 00105659-0373169040 TRISHA BRANDT 16904 GLENWOOD AVE ACTIVE 22-27600-07-200 215.54$ 50.00$ 59.06$ 324.60$ 00082310-0373169289 MARK SUKOW 16928 GLENWOOD AVE ACTIVE 22-27600-07-210 355.09$ 50.00$ 90.10$ 495.19$ 00105349-0373169842 TEKLEAB GOITOM 16984 GLENWOOD AVE ACTIVE 22-27600-07-250 222.53$ 50.00$ 60.61$ 333.14$ 00099502-0170077420 LEVI KROPP 7742 170TH ST W ACTIVE 22-27600-10-070 208.90$ 50.00$ 57.58$ 316.48$ 00108720-0170077925 BRIGHTPRCH PROPERTIES, LLC 7792 170TH ST W ACTIVE 22-27600-10-100 441.66$ 50.00$ 109.35$ 601.01$ 00115219-0375164163 ISTARLIN MUMIN 16416 GRIFFON TR ACTIVE 22-27601-02-050 89.73$ 50.00$ 31.08$ 170.81$ Page 776 of 899 00079333-0375164213 JAMIE LARSON 16421 GRIFFON TR ACTIVE 22-27601-04-040 725.99$ 50.00$ 172.59$ 948.58$ 00056136-0378079954 K BARSNESS 7995 GRINNELL WAY ACTIVE 22-27601-04-110 201.59$ 50.00$ 55.96$ 307.55$ 00101613-0376078651 ADAM KLYM 7865 GRINNELL CT E ACTIVE 22-27601-04-192 100.79$ 50.00$ 33.54$ 184.33$ 00080670-0376078503 LINDA CARTER 7850 GRINNELL CT E ACTIVE 22-27601-04-280 130.03$ 50.00$ 40.04$ 220.07$ 00073040-0376078909 ELIZABETH LINDEMAN 7890 GRINNELL CT E ACTIVE 22-27601-04-300 346.66$ 50.00$ 88.22$ 484.88$ 00087275-0378079111 ROBERT SCHLUESSLER 7911 GRINNELL WAY ACTIVE 22-27601-04-310 607.08$ 50.00$ 146.14$ 803.22$ 00098592-0378078618 WADE ARMS 7861 GRINNELL WAY ACTIVE 22-27601-04-360 159.25$ 50.00$ 46.54$ 255.79$ 00105761-0378077305 RODNEY KITZROW 7730 GRINNELL WAY ACTIVE 22-27601-05-090 430.78$ 50.00$ 106.93$ 587.71$ 00097090-0165075637 TORI ADDISON 7563 165TH ST W ACTIVE 22-27601-06-060 752.87$ 50.00$ 178.57$ 981.44$ 00100639-0165075363 JAY BARTA 7536 165TH ST W ACTIVE 22-27601-06-090 336.52$ 50.00$ 85.97$ 472.49$ 00105382-0378077529 ADRIENNE EAN 7752 GRINNELL WAY ACTIVE 22-27601-07-040 375.78$ 50.00$ 94.70$ 520.48$ 00114367-0378078089 RACHEL WILL 7808 GRINNELL WAY ACTIVE 22-27601-08-020 369.34$ 50.00$ 93.27$ 512.61$ 00090668-0377079716 JASON BARR 7971 GRINNELL CT W ACTIVE 22-27601-10-100 638.62$ 50.00$ 153.16$ 841.78$ 00111245-0377079443 JOSEPH WORD 7944 GRINNELL CT W ACTIVE 22-27601-10-170 250.00$ 50.00$ 66.72$ 366.72$ 00110367-0377079328 DAISY FERMIN 7932 GRINNELL CT W ACTIVE 22-27601-10-180 497.03$ 50.00$ 121.67$ 668.70$ 00117486-0378078303 ARDIE NEAR 7830 GRINNELL WAY ACTIVE 22-27602-01-030 469.41$ 50.00$ 115.52$ 634.93$ 00089731-0520187400 JOHN NORLING 18740 JOPLIN AVE ACTIVE 22-27800-02-030 325.22$ 50.00$ 83.45$ 458.67$ 00088042-0188105355 BREHANE ABREHAM 10535 188TH ST W ACTIVE 22-27800-02-120 319.47$ 50.00$ 82.17$ 451.64$ 00108712-0926109371 FOX MEADOWS CONDO ASSOCIATION 18618 JONESBORO CT ACTIVE 22-27801-03-020 166.55$ 50.00$ 48.16$ 264.71$ 00114408-0926112726 BRENTON REED BLACK 18602 JONESBORO CT ACTIVE 22-27801-03-030 342.43$ 50.00$ 87.28$ 479.71$ 00112618-0926120146 PAUL CRUZ 7155 181ST ST W ACTIVE 22-30180-01-030 279.59$ 50.00$ 73.30$ 402.89$ 00113585-0926121311 CHENELLE DELOACH 7107 181ST ST W ACTIVE 22-30180-01-120 382.17$ 50.00$ 96.12$ 528.29$ 00113761-0926121266 TYLER MOORE 7077 181ST ST W ACTIVE 22-30180-01-170 210.60$ 50.00$ 57.96$ 318.56$ 00114412-0926122686 ALYSSA ALTENDORF 7029 181ST ST W ACTIVE 22-30180-01-250 207.90$ 50.00$ 57.36$ 315.26$ 00112248-0926118711 KAMARAJ SIVVA 7118 181ST ST W ACTIVE 22-30180-02-070 267.87$ 50.00$ 70.70$ 388.57$ 00113550-0926121261 BILLIE ALI 7076 181ST ST W ACTIVE 22-30180-02-140 136.84$ 50.00$ 41.56$ 228.40$ 00114135-0926121216 HEATHER KUMMET 7040 181ST ST W ACTIVE 22-30180-02-180 149.86$ 50.00$ 44.45$ 244.31$ 00116683-0926126871 BENJAMIN GUTIERREZ 18268 GLACIER WAY ACTIVE 22-30181-02-020 757.69$ 50.00$ 179.64$ 987.33$ 00115785-0926126091 ISTAR YUSUS 7067 183RD ST W ACTIVE 22-30181-02-080 533.56$ 50.00$ 129.79$ 713.35$ 00115081-0926123331 RYAN MINCHOW 18137 GARLAND PATH ACTIVE 22-30182-01-150 75.65$ 50.00$ 27.95$ 153.60$ 00117322-0926126166 LEELA CHEKKALA 18104 GAVEL LA ACTIVE 22-30182-02-200 106.34$ 50.00$ 34.77$ 191.11$ 00119182-0926125881 AMINA MOHAMUD 18178 GARLAND PATH ACTIVE 22-30182-02-290 175.55$ 50.00$ 50.16$ 275.71$ 00118242-0926124591 DEJANIRA BUSH 18162 GARLAND PATH ACTIVE 22-30182-02-330 115.12$ 50.00$ 36.72$ 201.84$ 00115896-0926126266 RUTH BRUNO 7087 182ND ST W ACTIVE 22-30183-01-020 708.57$ 50.00$ 168.71$ 927.28$ 00115673-0926124636 ISMAIL ABDULLE 18309 GLACIER WAY ACTIVE 22-30183-02-010 298.25$ 50.00$ 77.45$ 425.70$ 00110354-0926127066 DANIELLE COMMERFORD 18357 GLACIER WAY ACTIVE 22-30183-02-070 347.26$ 50.00$ 88.35$ 485.61$ 00115679-0926126201 DOL ALI 18340 GLACIER WAY ACTIVE 22-30183-03-030 573.89$ 50.00$ 138.76$ 762.65$ 00116882-0926127016 JAMAC IBRAHIM JAMAC 18372 GLACIER WAY ACTIVE 22-30184-02-010 709.78$ 50.00$ 168.98$ 928.76$ 00116832-0926127121 SURYAPRAKASH GANESAN 7093 184TH ST W ACTIVE 22-30184-02-030 191.91$ 50.00$ 53.80$ 295.71$ 00116878-0926127006 YUSSUF ADULLE 18339 GIBBON CT ACTIVE 22-30184-02-100 1,007.88$ 50.00$ 235.28$ 1,293.16$ 00092399-0469205379 ALICIA SPRINGER 20537 IDALIA AVE ACTIVE 22-30200-04-030 519.38$ 50.00$ 126.64$ 696.02$ 00101206-0221204504 JUSTIN HEWITT 20450 DODD BLVD ACTIVE 22-30200-05-060 106.41$ 50.00$ 34.79$ 191.20$ 00110587-0260160391 SHEIKHNOOR KALMOLE 16039 GOODVIEW CT ACTIVE 22-30740-01-100 511.99$ 50.00$ 124.99$ 686.98$ 00117179-0775211335 WILLIAM A. FAHEY 21133 IBIS AVE ACTIVE 22-30801-01-100 180.30$ 50.00$ 51.22$ 281.52$ 00071890-0755210497 ROBERT POE 21049 HONEYCOMB CT ACTIVE 22-30802-02-030 551.05$ 50.00$ 133.68$ 734.73$ 00103078-0212089088 KATHY HENRIKSON 8908 212TH ST W ACTIVE 22-30825-01-130 110.02$ 50.00$ 35.59$ 195.61$ 00087220-0720176904 SCOTT RICE 17690 FORTUNE TR ACTIVE 22-30945-03-020 305.39$ 50.00$ 79.04$ 434.43$ 00072273-0720177217 JAMES SLATTERY 17721 FORTUNE TR ACTIVE 22-30945-06-050 372.80$ 50.00$ 94.04$ 516.84$ 00107774-0720177258 NORA KAUFMAN 17725 FORTUNE TR ACTIVE 22-30945-06-060 363.00$ 50.00$ 91.86$ 504.86$ 00072938-0250177454 WILLIAM TERNES 17745 GALERY DR ACTIVE 22-30945-08-010 604.24$ 50.00$ 145.51$ 799.75$ 00114425-0720177209 SOLOMON HABTEMARIAM 17720 FORTUNE TR ACTIVE 22-30945-08-050 431.68$ 50.00$ 107.13$ 588.81$ 00093872-0341176242 JOSHUA ANDERSON 17624 FOXBORO LA ACTIVE 22-30946-04-040 245.43$ 50.00$ 65.71$ 361.14$ 00109573-0365176383 AFTAB OSMAN 17638 GAGE AVE ACTIVE 22-30946-05-160 90.11$ 50.00$ 31.16$ 171.27$ 00074721-0365176268 KRISTEN FRITZ 17626 GAGE AVE ACTIVE 22-30946-05-170 776.75$ 50.00$ 183.88$ 1,010.63$ 00071430-0365175948 NIC GEROLD 17594 GAGE AVE ACTIVE 22-30946-05-190 1,004.68$ 50.00$ 234.57$ 1,289.25$ 00071733-0365176391 PATRICK BUCHERT 17639 GAGE AVE ACTIVE 22-30946-06-080 158.26$ 50.00$ 46.32$ 254.58$ 00118692-0675176248 MICHAEL PADILLA 17624 GANDER LA ACTIVE 22-30946-06-130 115.41$ 50.00$ 36.79$ 202.20$ Page 777 of 899 00071889-0675175760 RYAN WAGNER 17576 GANDER LA ACTIVE 22-30946-06-170 108.10$ 50.00$ 35.16$ 193.26$ 00103484-0720177464 MEGHAN RYAN 17746 FORTUNE TR ACTIVE 22-30946-08-010 159.25$ 50.00$ 46.54$ 255.79$ 00100268-0707172090 MOHAMMAD ROOMI 17209 FAIRMEADOW WAY ACTIVE 22-31501-05-050 387.38$ 50.00$ 97.28$ 534.66$ 00091493-0707172173 CYNTHIA BOROWSKI 17217 FAIRMEADOW WAY ACTIVE 22-31501-05-070 962.11$ 50.00$ 225.10$ 1,237.21$ 00110293-0169061906 SAMANTHA KYLLO 6190 169TH ST W ACTIVE 22-31502-02-060 333.29$ 50.00$ 85.25$ 468.54$ 00077819-0169061757 BRENT VENESS 6175 169TH ST W ACTIVE 22-31502-05-210 108.10$ 50.00$ 35.16$ 193.26$ 00103412-0169061435 PETE FORBES 6143 169TH ST W ACTIVE 22-31502-05-250 1,478.31$ 50.00$ 339.91$ 1,868.22$ 00096545-0926097056 NICK WOLF 8503 172ND ST W ACTIVE 22-31600-03-010 697.53$ 50.00$ 166.26$ 913.79$ 00062086-0677161388 ALAN ERTZ 16138 GUNFLINT CIR ACTIVE 22-31750-02-140 311.20$ 50.00$ 80.33$ 441.53$ 00115034-0764201701 BE-YOU TIFULL SOL SALON 20170 HERITAGE DR ACTIVE 22-32025-01-010 681.40$ 50.00$ 162.67$ 894.07$ 00117307-0748201041 ADONIA MCCORMICK 20104 HOMEFIRE WAY ACTIVE 22-32100-02-030 90.18$ 50.00$ 31.18$ 171.36$ 00079918-0748201223 GUILLERMO LUEBBERT MORENO 20122 HOMEFIRE WAY ACTIVE 22-32100-02-120 295.39$ 50.00$ 76.82$ 422.21$ 00112846-0748201660 JENNA DARDIS 20166 HOMEFIRE WAY ACTIVE 22-32100-02-330 224.88$ 50.00$ 61.14$ 336.02$ 00101267-0748201686 JOSE VILLANUEVA 20168 HOMEFIRE WAY ACTIVE 22-32100-02-340 375.41$ 50.00$ 94.62$ 520.03$ 00078370-0748201298 KATHERINE PESOLA 20129 HOMEFIRE WAY ACTIVE 22-32100-02-470 315.21$ 50.00$ 81.23$ 446.44$ 00102104-0424200598 ALAN BUNDE 20059 HIGHVIEW AVE ACTIVE 22-32175-01-090 276.42$ 50.00$ 72.60$ 399.02$ 00116195-0424200614 ANTHONY CARTER 20061 HIGHVIEW AVE ACTIVE 22-32175-01-100 663.28$ 50.00$ 158.64$ 871.92$ 00114608-0424200796 LINCOLN REAL ESTATE & HOMES LLC 20079 HIGHVIEW AVE ACTIVE 22-32175-01-220 96.00$ 50.00$ 32.47$ 178.47$ 00097329-0729201309 BILL GRITZMACHER 20130 HOLISTER LA ACTIVE 22-32175-01-340 237.21$ 50.00$ 63.88$ 351.09$ 00091379-0764200356 CANDACE SERRANO 20035 HERITAGE DR ACTIVE 22-32175-01-550 620.39$ 50.00$ 149.10$ 819.49$ 00107713-0764200331 DEVIN DELICH 20033 HERITAGE DR ACTIVE 22-32175-01-560 227.08$ 50.00$ 61.63$ 338.71$ 00086092-0729201499 MEGAN RITCHIE 20149 HOLISTER LA ACTIVE 22-32175-02-080 305.36$ 50.00$ 79.04$ 434.40$ 00106368-0729201416 MACEY CODY 20141 HOLISTER LA ACTIVE 22-32175-02-130 106.34$ 50.00$ 34.77$ 191.11$ 00105594-0411200288 IGOR LIHNAKEVIC 20028 HOLT AVE ACTIVE 22-32175-04-020 316.70$ 50.00$ 81.56$ 448.26$ 00079952-0411200304 JESSICA BROGGER 20030 HOLT AVE ACTIVE 22-32175-04-030 151.90$ 50.00$ 44.90$ 246.80$ 00106234-0411200585 JON CONRAD 20058 HOLT AVE ACTIVE 22-32175-04-140 224.00$ 50.00$ 60.94$ 334.94$ 00000000-2000000271 LARISSA KREBS 20072 HOLT AVE ACTIVE 22-32175-04-180 93.52$ 50.00$ 31.92$ 175.44$ 00081281-0764200182 JED MADSEN 20018 HERITAGE DR ACTIVE 22-32175-04-460 219.05$ 50.00$ 59.84$ 328.89$ 00107700-0764200141 SHEA SMITH 20014 HERITAGE DR ACTIVE 22-32175-04-480 120.74$ 50.00$ 37.97$ 208.71$ 00066694-0404167849 NANCY BROWN 16784 HERSHEY CT ACTIVE 22-32900-01-140 137.33$ 50.00$ 41.66$ 228.99$ 00083405-0943084737 RYAN KINNEY 8473 169TH CT W ACTIVE 22-32900-02-100 559.83$ 50.00$ 135.63$ 745.46$ 00110036-0943084307 SHIZBACHAN MANGRU 8430 169TH CT W ACTIVE 22-32900-02-150 605.96$ 50.00$ 145.89$ 801.85$ 00066540-0943084208 JAMES BRUMM 8420 169TH CT W ACTIVE 22-32900-02-160 160.78$ 50.00$ 46.88$ 257.66$ 00115493-0166082509 CRAIG LIVINGSTON 8250 166TH ST W ACTIVE 22-32901-03-110 423.05$ 50.00$ 105.21$ 578.26$ 00054680-0398165494 TUOI L DANG 16549 HARWELL CT ACTIVE 22-32901-04-040 312.70$ 50.00$ 80.67$ 443.37$ 00110404-0398165619 SUE SEYKORA 16561 HARWELL CT ACTIVE 22-32901-04-070 137.33$ 50.00$ 41.66$ 228.99$ 00074977-0399165956 DANIEL BRUNS 16595 HARWELL AVE ACTIVE 22-32901-04-100 82.01$ 50.00$ 29.36$ 161.37$ 00113799-0399165709 MOSIAH LEBARON 16570 HARWELL AVE ACTIVE 22-32901-05-050 644.10$ 50.00$ 154.38$ 848.48$ 00117785-0375162886 REID SAARELA 16288 GRIFFON TR ACTIVE 22-32902-02-040 274.66$ 50.00$ 72.21$ 396.87$ 00069430-0399164512 ELIZABETH CALHOUN 16451 HARWELL AVE ACTIVE 22-32902-03-030 580.94$ 50.00$ 140.33$ 771.27$ 00056437-0393165853 JAMES GILHOUSEN 16585 HAVELOCK WAY ACTIVE 22-32902-04-020 448.00$ 50.00$ 110.76$ 608.76$ 00101246-0393165812 MARIBEL ARANA-HJERMSTAD 16581 HAVELOCK WAY ACTIVE 22-32902-04-030 676.14$ 50.00$ 161.50$ 887.64$ 00092746-0393165010 ANDREW FORSETH 16501 HAVELOCK WAY ACTIVE 22-32902-04-090 740.67$ 50.00$ 175.85$ 966.52$ 00054006-0280163904 LESLEY WACHENDORF 16390 HARVARD DR ACTIVE 22-32903-01-050 345.54$ 50.00$ 87.97$ 483.51$ 00096581-0258162979 MARTIN MONARI 16297 GRIFFON CT ACTIVE 22-32904-02-100 576.74$ 50.00$ 139.39$ 766.13$ 00090951-0280163201 BRIAN SEILER 16320 HARVARD DR ACTIVE 22-32904-03-040 248.79$ 50.00$ 66.45$ 365.24$ 00103763-0388162139 RUEBEN HERNANDEZ 16213 HARMONY PATH ACTIVE 22-32905-03-200 274.66$ 50.00$ 72.21$ 396.87$ 00054136-0291161236 WAYNE R MATTSFIELD 16123 HARVARD LA ACTIVE 22-32905-04-050 108.10$ 50.00$ 35.16$ 193.26$ 00000000-2000000119 PEDRO DOMINGUEZ OLGUIN 17997 HIDDEN CREEK TR ACTIVE 22-32980-01-010 93.18$ 50.00$ 31.84$ 175.02$ 00000000-2000000108 KYLE FREDRICKSON 17378 IONIA PATH ACTIVE 22-33300-04-100 362.17$ 50.00$ 91.67$ 503.84$ 00113789-0173093556 MEGAN JORGENSEN 9355 173RD ST W ACTIVE 22-33300-05-010 709.65$ 50.00$ 168.95$ 928.60$ 00095131-0442174229 SHAUNA KETCHUM 17422 INLAND LOOP ACTIVE 22-33300-06-010 779.76$ 50.00$ 184.55$ 1,014.31$ 00056760-0442174187 THOMAS MCCLURE 17418 INLAND LOOP ACTIVE 22-33300-06-020 230.16$ 50.00$ 62.31$ 342.47$ 00094738-0484172248 JOY WITT 17224 IDLEWOOD WAY ACTIVE 22-33302-02-120 157.23$ 50.00$ 46.09$ 253.32$ 00107013-0484172305 DONEVA BATTY 17230 IDLEWOOD WAY ACTIVE 22-33302-02-130 274.03$ 50.00$ 72.07$ 396.10$ 00108848-0282174263 GENET AYALEW 17426 HOLLAND CT ACTIVE 22-33310-01-120 186.74$ 50.00$ 52.65$ 289.39$ 00095774-0286173832 MICHAEL MCGINN 17383 HOMESTEAD TR ACTIVE 22-33311-03-020 622.44$ 50.00$ 149.56$ 822.00$ Page 778 of 899 00067843-0286173592 SCOTT PARKS 17359 HOMESTEAD TR ACTIVE 22-33311-03-050 758.79$ 50.00$ 179.88$ 988.67$ 00115899-0286173436 AMY PERUSSE 17343 HOMESTEAD TR ACTIVE 22-33311-03-070 738.16$ 50.00$ 175.30$ 963.46$ 00104885-0286174186 INSAR ULLAH 17418 HOMESTEAD TR ACTIVE 22-33312-02-120 500.44$ 50.00$ 122.42$ 672.86$ 00077329-0293174179 BILL HARRISON 17417 HUMMINGBIRD AVE ACTIVE 22-33312-02-140 425.10$ 50.00$ 105.67$ 580.77$ 00110613-0293174559 AARON MCGOWAN 17455 HUMMINGBIRD AVE ACTIVE 22-33312-02-180 606.65$ 50.00$ 146.05$ 802.70$ 00080997-0293174658 SHANNA LUND 17465 HUMMINGBIRD AVE ACTIVE 22-33312-02-190 386.62$ 50.00$ 97.11$ 533.73$ 00099630-0293174427 BRYNN ROBERTS 17442 HUMMINGBIRD AVE ACTIVE 22-33312-03-040 106.83$ 50.00$ 34.88$ 191.71$ 00062100-0284164359 KENNETH WELLER 16435 HYLAND CIR ACTIVE 22-34600-01-080 772.05$ 50.00$ 182.83$ 1,004.88$ 00099093-0426163806 JEFF METCALF 16380 HUDSON AVE ACTIVE 22-34601-01-080 183.24$ 50.00$ 51.88$ 285.12$ 00106994-0651167963 JOHN HAMMAR 16796 INTERLACHEN BLVD ACTIVE 22-34603-03-160 183.24$ 50.00$ 51.88$ 285.12$ 00119140-0651168037 JEFF SNYDER 16803 INTERLACHEN BLVD ACTIVE 22-34603-04-020 441.55$ 50.00$ 109.33$ 600.88$ 00116410-0274168794 RESIDENT 16879 HUNTINGTON PATH ACTIVE 22-34606-01-020 649.19$ 50.00$ 155.51$ 854.70$ 00099697-0258162938 RESIDENT 16293 GRIFFON CT ACTIVE 22-32904-02-090 770.84$ 50.00$ 182.56$ 1,003.40$ 00072574-0274168430 GREG ABERLE 16843 HUNTINGTON PATH ACTIVE 22-34606-01-060 106.83$ 50.00$ 34.88$ 191.71$ 00085553-0274168158 SARISSE CREIGHTON 16815 HUNTINGTON PATH ACTIVE 22-34606-01-080 347.65$ 50.00$ 88.44$ 486.09$ 00116006-0746169941 ORIOL PATEAU 16994 HUBBARD TR ACTIVE 22-34606-02-060 85.39$ 50.00$ 30.11$ 165.50$ 00098387-0746169909 WILLIAM SPRINGER 16990 HUBBARD TR ACTIVE 22-34606-02-070 1,559.04$ 50.00$ 357.87$ 1,966.91$ 00110177-0756169625 NHUNG THI TRUONG 16962 HOPEWELL CT ACTIVE 22-34606-02-140 562.44$ 50.00$ 136.21$ 748.65$ 00069223-0780168460 BRAD PETERSON 16846 INTERLACHEN CT ACTIVE 22-37500-02-010 690.97$ 50.00$ 164.80$ 905.77$ 00066891-0746169065 JOHN REMMEN 16906 HUBBARD TR ACTIVE 22-37500-06-010 640.77$ 50.00$ 153.63$ 844.40$ 00083831-0908111154 ADAM KLEIN 11115 UPPER 167TH ST W ACTIVE 22-37950-02-100 337.52$ 50.00$ 86.19$ 473.71$ 00118422-0908111204 KAREN VONGPARCHAN 11120 UPPER 167TH ST W ACTIVE 22-37950-03-090 132.71$ 50.00$ 40.64$ 223.35$ 00098988-0560168609 DAN GORDON 16860 KENMORE DR ACTIVE 22-37951-01-090 789.89$ 50.00$ 186.80$ 1,026.69$ 00102214-0560169151 DAVID BROOKS 16915 KENMORE DR ACTIVE 22-37951-02-010 693.78$ 50.00$ 165.42$ 909.20$ 00063605-0567168354 MARY NELL DURBAND 16835 KENMORE CT ACTIVE 22-37951-03-030 79.71$ 50.00$ 28.85$ 158.56$ 00114409-0926092826 NATHAN LEE 16975 EVENING TER ACTIVE 22-38200-03-020 589.29$ 50.00$ 142.19$ 781.48$ 00093155-0926093711 DAWN ROSARIO 16933 EVENING TER ACTIVE 22-38201-03-010 647.37$ 50.00$ 155.10$ 852.47$ 00088593-0926093706 DAN CORLEY 16963 EVENING TER ACTIVE 22-38201-03-060 432.92$ 50.00$ 107.41$ 590.33$ 00112001-0926095306 TANIA HOCHHALTER 16897 EVENTIDE WAY ACTIVE 22-38202-01-050 1,522.90$ 50.00$ 349.83$ 1,922.73$ 00096069-0926096336 JILL BURNS 16929 EVENTIDE WAY ACTIVE 22-38202-03-030 169.79$ 50.00$ 48.88$ 268.67$ 00096880-0703176152 DANIEL ABBE 17615 FINESSE TR ACTIVE 22-41625-07-060 312.09$ 50.00$ 80.53$ 442.62$ 00102056-0708176058 MOHAMED ALI BEL FADEL 17605 FAIR ISLE PATH ACTIVE 22-41626-01-080 93.49$ 50.00$ 31.91$ 175.40$ 00096063-0342176688 CHAD VELTA 17668 FAIRFAX AVE ACTIVE 22-41626-02-020 337.61$ 50.00$ 86.21$ 473.82$ 00111610-0342176803 JENNIFER DONOVAN 17680 FAIRFAX AVE ACTIVE 22-41626-02-030 521.45$ 50.00$ 127.10$ 698.55$ 00072812-0342176944 SALIANA TUCKER 17694 FAIRFAX AVE ACTIVE 22-41626-02-050 1,286.52$ 50.00$ 297.26$ 1,633.78$ 00109660-0336176934 AMY GRAHAM 17693 FIELDCREST AVE ACTIVE 22-41626-04-070 122.71$ 50.00$ 38.41$ 211.12$ 00107889-0640112924 ARNAV DOSHI 11292 KENWORTH LA ACTIVE 22-41651-01-060 267.37$ 50.00$ 70.59$ 387.96$ 00082234-0648162707 TESFU WELDU 16270 KENWORTH CT ACTIVE 22-41651-02-090 1,496.80$ 50.00$ 344.03$ 1,890.83$ 00083777-0163113259 KURT S TURESON 11325 163RD ST W ACTIVE 22-41651-02-100 651.45$ 50.00$ 156.01$ 857.46$ 00090371-0828162204 RACHEL THEEL 16220 KENORA CT ACTIVE 22-41651-02-150 676.76$ 50.00$ 161.64$ 888.40$ 00105694-0639112604 ALI FARAH 11260 KENORA WAY ACTIVE 22-41651-04-020 607.47$ 50.00$ 146.23$ 803.70$ 00111295-0926118141 TMSC OF LAKEVILLE II, LLC 16254 KENYON AVE ACTIVE 22-41685-01-011 32,605.71$ 50.00$ 7,262.99$ 39,918.70$ 00105122-0926107861 TMSC OF LAKEVILLE II, LLC 16258 KENYON AVE ACTIVE 22-41685-01-021 5,698.46$ 50.00$ 1,278.52$ 7,026.98$ 00115758-0344167552 ANGELA ANDERSON 16755 FIRESTONE WAY ACTIVE 22-41750-03-010 309.10$ 50.00$ 79.87$ 438.97$ 00113114-0344168055 OROMIYA TZREFE 16805 FIRESTONE WAY ACTIVE 22-41750-03-060 437.51$ 50.00$ 108.43$ 595.94$ 00109294-0344168899 SUNTRA PHENG 16889 FIRESTONE WAY ACTIVE 22-41750-03-120 189.76$ 50.00$ 53.33$ 293.09$ 00097189-0344167909 MATTHEW LINK 16790 FIRESTONE WAY ACTIVE 22-41750-04-040 201.59$ 50.00$ 55.96$ 307.55$ 00102239-0336167768 MICHAEL LEWIS 16776 FIELDCREST AVE ACTIVE 22-41751-01-010 692.21$ 50.00$ 165.08$ 907.29$ 00088184-0336168337 DEBBIE SCHADE 16833 FIELDCREST AVE ACTIVE 22-41751-04-030 1,516.85$ 50.00$ 348.48$ 1,915.33$ 00086184-0580166120 MARK HADDORFF 16612 KLAMATH TER ACTIVE 22-41860-02-050 579.09$ 50.00$ 139.92$ 769.01$ 00111339-0561164110 ASAD ABDALLE 16411 KINGSWOOD DR ACTIVE 22-41870-02-030 727.65$ 50.00$ 172.96$ 950.61$ 00112929-0926084206 JOSHUA HALVORSON 18803 ORCHARD TR ACTIVE 22-41925-01-020 388.40$ 50.00$ 97.50$ 535.90$ 00109425-0926113101 SAID SAID 17913 EVENTIDE WAY ACTIVE 22-42275-01-010 1,841.72$ 50.00$ 420.74$ 2,312.46$ 00108965-0926112991 KIRK DAGEL 17940 EVENING LA ACTIVE 22-42275-02-070 962.15$ 50.00$ 225.11$ 1,237.26$ 00112401-0926117951 ADAA CHIRI 17962 EVENTIDE WAY ACTIVE 22-42275-03-130 361.42$ 50.00$ 91.50$ 502.92$ 00109961-0926114951 JONATHAN STOVALL 17950 EVENTIDE WAY ACTIVE 22-42275-03-140 380.12$ 50.00$ 95.66$ 525.78$ 00115146-0926122286 Patrick Davis 17833 EVERSHED WAY ACTIVE 22-42276-02-030 467.90$ 50.00$ 115.19$ 633.09$ Page 779 of 899 00118093-0926125691 ROBERT HAGFORS 17944 EXETER CIR ACTIVE 22-42277-01-080 517.31$ 50.00$ 126.18$ 693.49$ 00114288-0926122646 ABDINASIR GAAL 5829 UPPER 179TH ST W ACTIVE 22-42277-02-050 413.74$ 50.00$ 103.14$ 566.88$ 00114243-0926122636 ANSAR GEDI 5801 UPPER 179TH ST W ACTIVE 22-42277-02-070 264.86$ 50.00$ 70.03$ 384.89$ 00118907-0926128171 YASMIN HIRSI 5759 UPPER 179TH ST W ACTIVE 22-42277-02-150 432.90$ 50.00$ 107.40$ 590.30$ 00115552-0926123856 ABDIAZIZ HASSAN 5984 UPPER 179TH ST W ACTIVE 22-42277-03-010 423.22$ 50.00$ 105.25$ 578.47$ 00114356-0926122641 SATIMA ABRAHAM 5802 UPPER 179TH ST W ACTIVE 22-42277-03-140 355.21$ 50.00$ 90.12$ 495.33$ 00101330-0926102031 CHRISTOPHER BOHLMAN 9758 198TH ST W ACTIVE 22-42600-04-020 1,382.70$ 50.00$ 318.65$ 1,751.35$ 00117960-0631206198 DEREK CAROTHERS 20619 JUSTICE PATH ACTIVE 22-44052-02-030 453.82$ 50.00$ 112.06$ 615.88$ 00111828-0626206807 KARLA SNYDER 20680 JASMINE PATH ACTIVE 22-44052-02-160 544.64$ 50.00$ 132.25$ 726.89$ 00105777-0626205924 LUCAS AMUNDSON 20592 JASMINE PATH ACTIVE 22-44052-02-220 137.93$ 50.00$ 41.80$ 229.73$ 00113221-0626206674 RACHAEL WIELAND 20667 JASMINE PATH ACTIVE 22-44052-03-080 275.43$ 50.00$ 72.38$ 397.81$ 00104742-0626207219 EDGAR WHILY GUTIERREZ - DOMINGUZ 20721 JASMINE PATH ACTIVE 22-44052-03-170 213.26$ 50.00$ 58.55$ 321.81$ 00093792-0243171093 JACOB LENANDER 17109 EAGLEVIEW WAY ACTIVE 22-44075-15-007 171.53$ 50.00$ 49.27$ 270.80$ 00000000-2000000572 ELIZABETH ROSS 17093 EAGLEVIEW WAY ACTIVE 22-44075-15-011 189.30$ 50.00$ 53.22$ 292.52$ 00117989-0243170814 DENISE VOLKERT 17081 EAGLEVIEW WAY ACTIVE 22-44075-15-024 418.05$ 50.00$ 104.10$ 572.15$ 00114154-0246170175 ELIZABETH HINSON 17017 EAGLEVIEW LA ACTIVE 22-44075-15-059 200.60$ 50.00$ 55.74$ 306.34$ 00097131-0243170723 CHARLES POTTHIER 17072 EAGLEVIEW WAY ACTIVE 22-44076-15-079 129.53$ 50.00$ 39.93$ 219.46$ 00109482-0243171663 AMANDA BEAULIEU 17166 EAGLEVIEW WAY ACTIVE 22-44076-15-085 377.49$ 50.00$ 95.08$ 522.57$ 00099443-0246170365 MICHAEL ARNESON 17036 EAGLEVIEW LA ACTIVE 22-44076-15-092 288.29$ 50.00$ 75.24$ 413.53$ 00081233-0244170706 JESSE ANDERSON 17070 EASTWOOD AVE ACTIVE 22-44076-15-113 318.16$ 50.00$ 81.88$ 450.04$ 00110803-0244170854 JEFFREY TEMTE 17085 EASTWOOD AVE ACTIVE 22-44076-15-116 346.91$ 50.00$ 88.28$ 485.19$ 00111995-0243171655 WILLIAM MASON 17165 EAGLEVIEW WAY ACTIVE 22-44076-15-118 730.33$ 50.00$ 173.55$ 953.88$ 00109315-0244171597 KIMBERLY ANDROFF 17093 EASTWOOD AVE ACTIVE 22-44076-15-124 177.40$ 50.00$ 50.58$ 277.98$ 00116432-0244171399 KENT M. WILSON 17139 EASTWOOD AVE ACTIVE 22-44076-15-131 146.98$ 50.00$ 43.81$ 240.79$ 00082819-0244171357 TREVOR GORATH 17135 EASTWOOD AVE ACTIVE 22-44076-15-135 889.14$ 50.00$ 208.88$ 1,148.02$ 00110420-0244171621 ROGER HOLLAND 17162 EASTWOOD AVE ACTIVE 22-44078-15-158 292.75$ 50.00$ 76.23$ 418.98$ 00105401-0926088321 DONALD UNGER 17205 EASTWOOD AVE ACTIVE 22-44078-15-178 316.28$ 50.00$ 81.46$ 447.74$ 00101550-0926085846 KATE GRAVES 5223 173RD ST W ACTIVE 22-44078-15-195 306.46$ 50.00$ 79.28$ 435.74$ 00091104-0519190654 SEAN THOMPSON 19065 JORDAN TR ACTIVE 22-44100-01-020 1,425.51$ 50.00$ 328.17$ 1,803.68$ 00090897-0520187863 TIMOTHY PRESTON 18786 JOPLIN AVE ACTIVE 22-44100-04-020 78.29$ 50.00$ 28.53$ 156.82$ 00105265-0520188366 ROCHELLE TILLISON 18836 JOPLIN AVE ACTIVE 22-44100-04-050 585.91$ 50.00$ 141.43$ 777.34$ 00102369-0519189201 MIKE KAPALA 18920 JORDAN TR ACTIVE 22-44100-04-100 190.40$ 50.00$ 53.47$ 293.87$ 00103572-0521191724 NATE LARSON 19172 JEWEL PATH ACTIVE 22-44100-07-040 190.30$ 50.00$ 53.45$ 293.75$ 00059924-0518190648 PAUL BRAKEFIELD 19064 JORDAN CT S ACTIVE 22-44100-09-050 253.41$ 50.00$ 67.48$ 370.89$ 00108387-0801206366 MELISSA PETERSEN 20636 JUPITER AVE ACTIVE 22-44200-01-100 489.65$ 50.00$ 120.02$ 659.67$ 00098398-0802205649 JEFF MAHONEY 20564 JUPITER PATH ACTIVE 22-44200-04-100 128.43$ 50.00$ 39.68$ 218.11$ 00070241-0812206504 DENNIS IVERSON 20650 JUTLAND PL ACTIVE 22-44202-02-080 813.37$ 50.00$ 192.02$ 1,055.39$ 00106086-0540186903 JOHN WHITE 18690 JASMINE WAY ACTIVE 22-44306-02-050 185.02$ 50.00$ 52.27$ 287.29$ 00093836-0565178652 KIRSTEN WRIGHT 17865 KEOKUK AVE ACTIVE 22-44325-03-100 823.08$ 50.00$ 194.18$ 1,067.26$ 00110283-0571177003 PATRICK REYNOLDS 17700 KEYSTONE AVE ACTIVE 22-44325-03-210 1,039.81$ 50.00$ 242.39$ 1,332.20$ 00099270-0571176617 DENISE KAPPELMANN 17661 KEYSTONE AVE ACTIVE 22-44325-04-030 250.88$ 50.00$ 66.92$ 367.80$ 00098605-0571176799 MICHELLE ROBISON 17679 KEYSTONE AVE ACTIVE 22-44325-04-040 411.26$ 50.00$ 102.59$ 563.85$ 00060693-0576177016 GERALD PETERSON 17701 KINGSWAY PATH ACTIVE 22-44326-03-050 184.39$ 50.00$ 52.13$ 286.52$ 00101778-0177117866 VERA KALISTA 11786 177TH ST W ACTIVE 22-44326-04-030 344.91$ 50.00$ 87.83$ 482.74$ 00093647-0576177453 KENNETH SEED 17745 KINGSWAY PATH ACTIVE 22-44328-01-090 532.39$ 50.00$ 129.53$ 711.92$ 00000000-2000000705 BRENDAN FLAHERTY 17650 KETTERING TR ACTIVE 22-44329-01-010 77.26$ 50.00$ 28.30$ 155.56$ 00116223-0572176210 JEFFREY PUTNAM 17621 KETTERING TR ACTIVE 22-44330-03-100 449.07$ 50.00$ 111.00$ 610.07$ 00103037-0939178941 MARSHALL YUNG 17894 179TH TR W ACTIVE 22-44331-01-020 187.23$ 50.00$ 52.76$ 289.99$ 00117430-0926129591 GOODWILL 11578 207TH ST W ACTIVE 22-44343-01-020 1,487.61$ 50.00$ 341.98$ 1,879.59$ 00081720-0164112375 ELIZABETH M CAMPBELL 11237 164TH ST W ACTIVE 22-44350-01-070 460.35$ 50.00$ 113.51$ 623.86$ 00091721-0166110203 KRISSIA ROMAN 11020 166TH ST W ACTIVE 22-44350-02-210 281.23$ 50.00$ 73.67$ 404.90$ 00112900-0412207753 COLE VITTETOE 20775 HOLLINS AVE ACTIVE 22-44450-14-090 471.60$ 50.00$ 116.01$ 637.61$ 00106822-0165106574 C & P PROPERTIES OF BURNSVILLE 10657 165TH ST W ACTIVE 22-44460-01-160 75.38$ 50.00$ 27.89$ 153.27$ 00083201-0165105014 LAKEVILLE TOWN OFFICE PARK 2 10499.5 165TH ST W ACTIVE 22-44461-01-150 1,739.15$ 50.00$ 397.93$ 2,187.08$ 00111895-0926105866 HEBA MOHAMED 19720 HOLDINGFORD WAY ACTIVE 22-44700-02-130 149.35$ 50.00$ 44.34$ 243.69$ 00110197-0926114481 ERIC BAUMGARTNER 19545 HIBBING WAY ACTIVE 22-44701-03-040 128.43$ 50.00$ 39.68$ 218.11$ 00110831-0926116051 BRIAN BAUER 19709 HIGHVIEW AVE ACTIVE 22-44701-05-020 488.75$ 50.00$ 119.82$ 658.57$ Page 780 of 899 00105562-0926107766 JONI MCCORMACK 19710 HENNING AVE ACTIVE 22-44701-06-160 128.43$ 50.00$ 39.68$ 218.11$ 00104735-0505197507 LISA SIMON 19750 JASMINE AVE ACTIVE 22-44900-19-050 170.22$ 50.00$ 48.98$ 269.20$ 00059707-0509197016 STANLEY HOLTER 19701 JERSEY AVE ACTIVE 22-44900-23-210 728.92$ 50.00$ 173.24$ 952.16$ 00106946-0205089210 JOSEPH BERGSTROM 8921 205TH ST W ACTIVE 22-45300-01-012 202.13$ 50.00$ 56.08$ 308.21$ 00106420-0926108776 JORDAN FLEIG 20559 GUNNISON DR ACTIVE 22-45400-03-080 919.93$ 50.00$ 215.72$ 1,185.65$ 00108482-0926112061 BRANDON PEPPER 20787 GREENWOOD AVE ACTIVE 22-45400-03-210 738.31$ 50.00$ 175.33$ 963.64$ 00105164-0926107311 MOLYKA MAO 20504 GUNNISON DR ACTIVE 22-45400-04-010 124.39$ 50.00$ 38.79$ 213.18$ 00117611-0926110116 IAN M ROLLWITZ 20624 GUNNISON DR ACTIVE 22-45400-04-130 453.61$ 50.00$ 112.01$ 615.62$ 00107927-0926111071 YERGALEM GOITOM 20669 GRANVILLE LA ACTIVE 22-45400-04-170 505.80$ 50.00$ 123.62$ 679.42$ 00117705-0926113231 JOSH STEVENS 20641 GRANVILLE LA ACTIVE 22-45400-04-190 489.02$ 50.00$ 119.88$ 658.90$ 00107083-0926110106 DAVID ZIMMERMANN 20572 GRANVILLE LA ACTIVE 22-45400-05-060 843.99$ 50.00$ 198.83$ 1,092.82$ 00109994-0926115046 INDY CHACON 20598 GREENWOOD AVE ACTIVE 22-45400-06-070 795.03$ 50.00$ 187.94$ 1,032.97$ 00061719-0661097489 RICHARD M CLEMENS 9748 OAK SHORE DR ACTIVE 22-45800-04-010 1,362.18$ 50.00$ 314.08$ 1,726.26$ 00118789-0157010111 ORLIN VASQUEZ 1011 157TH ST E ACTIVE 22-45801-04-100 433.10$ 50.00$ 107.45$ 590.55$ 00111666-0157010095 JULIE PINKERMAN 1009 157TH ST W ACTIVE 22-45801-04-110 973.06$ 50.00$ 227.54$ 1,250.60$ 00061599-0157010079 BEVERLY WELCH 1007 157TH ST E ACTIVE 22-45801-04-120 314.98$ 50.00$ 81.18$ 446.16$ 00116056-0661097083 DAN W MALSOM 9708 OAK SHORE DR ACTIVE 22-45801-04-150 116.28$ 50.00$ 36.98$ 203.26$ 00105773-0175122017 TRACI ALSHAALI 12201 175TH ST W ACTIVE 22-46901-04-150 292.95$ 50.00$ 76.28$ 419.23$ 00119264-0175120011 DARBY O'LEARY 12001 175TH ST W ACTIVE 22-46901-17-031 107.28$ 50.00$ 34.98$ 192.26$ 00113129-0592168593 AARON MELBY 16859 ISLAND TER ACTIVE 22-46950-02-080 136.67$ 50.00$ 41.52$ 228.19$ 00109477-0500167852 NELSON LEGACY PROPERTIES LLC 16785 JAGUAR AVE ACTIVE 22-46975-02-110 905.68$ 50.00$ 212.55$ 1,168.23$ 00111525-0170099153 JOSEPH WARREN 9915 170TH ST W ACTIVE 22-46976-01-030 747.93$ 50.00$ 177.47$ 975.40$ 00092821-0170098452 KELLY JAY 9845 170TH ST W ACTIVE 22-46976-02-010 570.28$ 50.00$ 137.96$ 758.24$ 00112554-0170098155 ALEKSANDR VOLNUSHKIN 9815 170TH ST W ACTIVE 22-46976-02-030 169.36$ 50.00$ 48.79$ 268.15$ 00098525-0486168653 TRESTON WOBIG 16865 JALISCO TER W ACTIVE 22-46979-01-040 501.16$ 50.00$ 122.58$ 673.74$ 00106352-0599167873 KEDIR AHMED 16787 JACKPINE TR ACTIVE 22-46980-01-020 1,008.29$ 50.00$ 235.38$ 1,293.67$ 00113810-0598167916 JOHN KRONENWETER 16791 JACKSONVILLE CT ACTIVE 22-46980-01-120 330.51$ 50.00$ 84.63$ 465.14$ 00100308-0600168571 MICHAEL BUCKINGHAM 16857 JACKPINE WAY ACTIVE 22-46980-01-170 202.02$ 50.00$ 56.05$ 308.07$ 00114930-0600168167 BRIAN POWERS 16816 JACKPINE WAY ACTIVE 22-46980-01-240 187.25$ 50.00$ 52.77$ 290.02$ 00107210-0167101858 HOLLY WARD 10185 167TH ST W ACTIVE 22-46981-06-020 140.95$ 50.00$ 42.47$ 233.42$ 00112097-0926086386 JESSICA BRANDENHOFF 16562 JACARANDA WAY ACTIVE 22-46982-02-010 1,447.31$ 50.00$ 333.02$ 1,830.33$ 00078149-0536171869 DOUG YETZER 17186 JASPER TR ACTIVE 22-47000-01-190 88.39$ 50.00$ 30.78$ 169.17$ 00106664-0245167693 SHANE BILDERBECK 16769 EMBERS AVE ACTIVE 22-47050-05-502 518.09$ 50.00$ 126.35$ 694.44$ 00103436-0245167750 DILLON RAMCHARITAR 16775 EMBERS AVE ACTIVE 22-47050-05-508 846.42$ 50.00$ 199.37$ 1,095.79$ 00111154-0245167834 PRABAL NEPAL 16783 EMBERS AVE ACTIVE 22-47050-05-603 215.22$ 50.00$ 58.99$ 324.21$ 00115915-0245167875 MARISHA LINDNER 16787 EMBERS AVE ACTIVE 22-47050-05-607 328.00$ 50.00$ 84.07$ 462.07$ 00103757-0245168436 ALELI TACATA 16843 EMBERS AVE ACTIVE 22-47050-05-903 266.36$ 50.00$ 70.36$ 386.72$ 00100944-0244168999 COLIN RYAN 16899 EMBERS AVE ACTIVE 22-47050-06-101 329.32$ 50.00$ 84.36$ 463.68$ 00096445-0244168973 CHRISTOPHER NERLAND 16897 EMBERS AVE ACTIVE 22-47050-06-103 138.16$ 50.00$ 41.85$ 230.01$ 00091902-0244169195 ANGELA MISGEN 16919 EMBERS AVE ACTIVE 22-47050-06-207 499.98$ 50.00$ 122.32$ 672.30$ 00099358-0249168267 MICHELLE LENNOX 16826 EDINBURG WAY ACTIVE 22-47051-06-403 382.12$ 50.00$ 96.11$ 528.23$ 00093757-0245168881 KATIE MCCORMICK 16888 EMBERS AVE ACTIVE 22-47051-06-502 291.36$ 50.00$ 75.92$ 417.28$ 00113908-0245168626 ILANA NIEMI 16862 EMBERS AVE ACTIVE 22-47051-06-603 658.75$ 50.00$ 157.63$ 866.38$ 00093858-0245168725 NICK TOUSIGNANT 16872 EMBERS AVE ACTIVE 22-47051-06-610 390.93$ 50.00$ 98.07$ 539.00$ 00100732-0245168709 JAMIE MCGARVEY 16870 EMBERS AVE ACTIVE 22-47051-06-702 315.30$ 50.00$ 81.25$ 446.55$ 00105696-0245168683 DAVID UDOFIA 16868 EMBERS AVE ACTIVE 22-47051-06-704 107.61$ 50.00$ 35.05$ 192.66$ 00111451-0245168006 GIANG-SON NGUYEN 16800 EMBERS AVE ACTIVE 22-47051-07-106 314.70$ 50.00$ 81.11$ 445.81$ 00105337-0245167982 ROBSAN MORODA 16798 EMBERS AVE ACTIVE 22-47051-07-108 169.05$ 50.00$ 48.72$ 267.77$ 00080693-0760207447 ERIC SWANSON 20744 HURLEY AVE ACTIVE 22-47475-02-030 837.28$ 50.00$ 197.34$ 1,084.62$ 00118362-0760207702 LAUREN SMITH 20770 HURLEY AVE ACTIVE 22-47475-02-100 430.73$ 50.00$ 106.92$ 587.65$ 00117802-0758209454 MOHAMED HASSAN 20945 HYDRA CT ACTIVE 22-47475-05-010 987.74$ 50.00$ 230.80$ 1,268.54$ 00090590-0758209652 MOHAMED ELGOHARI 20965 HYDRA CT ACTIVE 22-47475-05-060 1,446.41$ 50.00$ 332.82$ 1,829.23$ 00096165-0758209686 SCOTT LARSON 20968 HYDRA CT ACTIVE 22-47475-05-070 128.43$ 50.00$ 39.68$ 218.11$ 00073264-0758209603 BRENDA HIGGINS 20960 HYDRA CT ACTIVE 22-47475-05-090 535.63$ 50.00$ 130.25$ 715.88$ 00112641-0789207410 JOSEPH GREENWOOD 20741 IBEX AVE ACTIVE 22-47475-06-020 274.51$ 50.00$ 72.17$ 396.68$ 00078505-0791207408 ANTHONY NACHREINER 20740 INDEPENDENCE CT ACTIVE 22-47476-02-010 850.34$ 50.00$ 200.25$ 1,100.59$ 00098777-0782207581 CHRIS ANDERSON 20758 IDAHO AVE ACTIVE 22-47476-02-090 124.95$ 50.00$ 38.91$ 213.86$ Page 781 of 899 00074358-0782207458 KURT JUSCZAK 20745 IDAHO AVE ACTIVE 22-47476-03-050 212.78$ 50.00$ 58.45$ 321.23$ 00105613-0771209150 MATTHEW GARDNER 20915 INDEPENDENCE AVE ACTIVE 22-47476-08-030 476.59$ 50.00$ 117.12$ 643.71$ 00074384-0771209515 VATSANA PHOMSAMOUTH 20951 INDEPENDENCE AVE ACTIVE 22-47476-08-120 314.46$ 50.00$ 81.06$ 445.52$ 00099606-0789207097 ERIN NELSON 20709 IBEX AVE ACTIVE 22-47477-01-020 104.02$ 50.00$ 34.26$ 188.28$ 00106169-0516195219 LISA RENEE GRAHAM 19521 JADE LA ACTIVE 22-47526-01-120 572.32$ 50.00$ 138.41$ 760.73$ 00076406-0589204385 JASON SCHAUER 20438 JUPITER WAY ACTIVE 22-47545-03-020 260.02$ 50.00$ 68.95$ 378.97$ 00101559-0588204121 TRACY TUCKER 20412 JUPITER CT ACTIVE 22-47545-03-040 163.33$ 50.00$ 47.45$ 260.78$ 00098342-0644203380 JEREMY FLICEK 20338 KENSINGTON CT ACTIVE 22-47546-04-220 343.73$ 50.00$ 87.57$ 481.30$ 00090558-0202087225 THOMAS LOGAN 8722 202ND ST W ACTIVE 22-47550-00-020 142.76$ 50.00$ 42.87$ 235.63$ 00095362-0926095496 JACOB KEDINGER 18268 IMAGERY LA ACTIVE 22-47625-02-030 144.86$ 50.00$ 43.34$ 238.20$ 00111390-0471203651 EMILY MORRIS 20365 IBERIA AVE ACTIVE 22-47750-01-033 292.03$ 50.00$ 76.07$ 418.10$ 00109273-0926113581 ANN ALWIN 20375 HAMBURG AVE ACTIVE 22-47800-01-072 413.49$ 50.00$ 103.09$ 566.58$ 00110936-0416204830 JEFFREY LUETHJE 20483 HAMBURG AVE ACTIVE 22-47800-01-121 300.77$ 50.00$ 78.02$ 428.79$ 00105846-0335170623 JAMIE ROTHMEIER 17062 FIRTREE PL ACTIVE 22-48100-01-110 4,119.37$ 50.00$ 927.31$ 5,096.68$ 00114802-0333171607 ROBERA TERFA 17160 FIRESTONE PATH ACTIVE 22-48100-02-120 232.42$ 50.00$ 62.81$ 345.23$ 00055202-0337171355 PAUL G AHRENHOLZ 17135 FIELDCREST CT ACTIVE 22-48101-01-080 778.92$ 50.00$ 184.36$ 1,013.28$ 00064832-0337171405 MICHAEL HUDDOCK 17140 FIELDCREST CT ACTIVE 22-48101-01-090 1,965.62$ 50.00$ 448.30$ 2,463.92$ 00115770-0337171306 ALVARO VILLANUEVA 17130 FIELDCREST CT ACTIVE 22-48101-01-100 494.19$ 50.00$ 121.03$ 665.22$ 00077003-0336170002 JIM GOBLIRSCH 17000 FIELDCREST AVE ACTIVE 22-48101-02-010 611.59$ 50.00$ 147.14$ 808.73$ 00108518-0336170606 NICHOLAS HANSON 17060 FIELDCREST AVE ACTIVE 22-48101-02-040 322.99$ 50.00$ 82.96$ 455.95$ 00113243-0333172159 MARQUES WORDS 17215 FIRESTONE PATH ACTIVE 22-48101-03-030 92.09$ 50.00$ 31.60$ 173.69$ 00108605-0336172008 COLTON ANDERSON 17200 FIELDCREST AVE ACTIVE 22-48101-04-010 826.55$ 50.00$ 194.95$ 1,071.50$ 00066467-0336172206 SHELLY OTREMBA 17220 FIELDCREST AVE ACTIVE 22-48101-04-020 396.46$ 50.00$ 99.30$ 545.76$ 00092214-0340173745 MELISSA GORMAN 17374 FARADAY LA ACTIVE 22-48102-02-210 797.44$ 50.00$ 188.48$ 1,035.92$ 00116082-0175062070 PAUL STALOCH 6207 175TH ST W ACTIVE 22-48103-02-060 122.71$ 50.00$ 38.41$ 211.12$ 00070451-0175060215 MATTHEW J STARK 6021 175TH ST W ACTIVE 22-48103-03-060 965.57$ 50.00$ 225.87$ 1,241.44$ 00096664-0176060917 COREY PAXTON 6091 176TH ST W ACTIVE 22-48103-04-150 429.08$ 50.00$ 106.55$ 585.63$ 00075198-0336176587 NASIM SHOUBASH 17658 FIELDCREST AVE ACTIVE 22-48103-05-020 130.45$ 50.00$ 40.13$ 220.58$ 00087637-0934100338 JOSEPH HOBOT 10033 UPPER 205TH ST W ACTIVE 22-48200-01-020 387.72$ 50.00$ 97.35$ 535.07$ 00104954-0934101054 KENNETH BILLINGS 10105 UPPER 205TH ST W ACTIVE 22-48200-01-070 389.07$ 50.00$ 97.65$ 536.72$ 00108531-0535205874 JOSPEH MASTAIN 20587 JADE CIR ACTIVE 22-48200-02-070 153.73$ 50.00$ 45.31$ 249.04$ 00099684-0500206345 JOESPH HODSON 20634 JAGUAR AVE ACTIVE 22-48201-02-040 372.78$ 50.00$ 94.03$ 516.81$ 00068618-0500206808 MARK KARTAK 20680 JAGUAR AVE ACTIVE 22-48201-02-130 250.03$ 50.00$ 66.73$ 366.76$ 00101248-0934102318 LINDSAY EGGE 10231 UPPER 205TH ST W ACTIVE 22-48202-01-020 381.38$ 50.00$ 95.94$ 527.32$ 00108319-0934102003 SARITH BOT 10200 UPPER 205TH ST W ACTIVE 22-48202-03-050 571.55$ 50.00$ 138.24$ 759.79$ 00055318-0500207087 MATT GRUBBS 20708 JAGUAR AVE ACTIVE 22-48203-02-010 339.80$ 50.00$ 86.70$ 476.50$ 00088833-0937100715 BRYAN BODSBERG 10071 205TH CT W ACTIVE 22-48204-01-090 837.18$ 50.00$ 197.32$ 1,084.50$ 00117146-0937100350 LEE PETERSEN 10035 205TH CT W ACTIVE 22-48204-01-120 530.41$ 50.00$ 129.09$ 709.50$ 00108798-0937101002 DEREK PRAX 10100 205TH CT W ACTIVE 22-48204-01-200 545.67$ 50.00$ 132.48$ 728.15$ 00099459-0571205192 APRIL SEALS-MARTIN 20519 KEYSTONE AVE ACTIVE 22-48800-01-050 408.73$ 50.00$ 102.03$ 560.76$ 00107505-0571205424 BREANA BENSHOOF 20542 KEYSTONE AVE ACTIVE 22-48800-02-070 557.69$ 50.00$ 135.16$ 742.85$ 00116280-0926086356 MELANIE SKIME 20599 KEYSTONE AVE ACTIVE 22-48801-01-050 260.66$ 50.00$ 69.09$ 379.75$ 00117674-0926087911 ASHLEY SCHULE 20661 KEYSTONE AVE ACTIVE 22-48801-01-170 625.55$ 50.00$ 150.25$ 825.80$ 00114580-0926102296 BALAKRISHNAN RADHAKRISHNAN 20680 KEYSTONE AVE ACTIVE 22-48801-02-230 367.74$ 50.00$ 92.91$ 510.65$ 00104638-0926102301 JAMIE PAGE 20684 KEYSTONE AVE ACTIVE 22-48801-02-240 244.33$ 50.00$ 65.46$ 359.79$ 00118543-0317067532 KAROLE GRAHAM 6753 FOLIAGE CT ACTIVE 22-51350-01-040 362.55$ 50.00$ 91.76$ 504.31$ 00100551-0317067490 JUDITH HIGGINS 6749 FOLIAGE CT ACTIVE 22-51350-01-060 443.63$ 50.00$ 109.79$ 603.42$ 00083474-0317067292 TIMOTHY SCHULZ 6729 FOLIAGE CT ACTIVE 22-51350-01-160 416.77$ 50.00$ 103.81$ 570.58$ 00107947-0317067151 MICHELLE REITMEIER 6715 FOLIAGE CT ACTIVE 22-51350-01-230 319.28$ 50.00$ 82.13$ 451.41$ 00116877-0317067300 MARIA GARCIA BETHKE 6730 FOLIAGE CT ACTIVE 22-51350-01-430 647.77$ 50.00$ 155.19$ 852.96$ 00103737-0317067367 KOFFI BALIKI 6736 FOLIAGE CT ACTIVE 22-51350-01-460 336.34$ 50.00$ 85.93$ 472.27$ 00116540-0327161093 URIEL DE LA ROSA RODRIGUEZ 16109 FLAGSTAFF CT N ACTIVE 22-51351-01-030 424.55$ 50.00$ 105.55$ 580.10$ 00106906-0328161597 ARIN HANEY 16159 FLAGSTAFF CT S ACTIVE 22-51351-01-260 349.75$ 50.00$ 88.91$ 488.66$ 00113227-0328161696 ROBIN LILLEVOLD 16169 FLAGSTAFF CT S ACTIVE 22-51351-01-310 144.10$ 50.00$ 43.17$ 237.27$ 00078392-0328161795 DEBORAH J LENTSCH 16179 FLAGSTAFF CT S ACTIVE 22-51351-01-360 554.06$ 50.00$ 134.35$ 738.41$ 00117743-0328161951 MITCHAEL CALLAHAN 16195 FLAGSTAFF CT S ACTIVE 22-51351-01-440 92.99$ 50.00$ 31.80$ 174.79$ 00113204-0933066777 DEVIN MEANY 6677 162ND CT W ACTIVE 22-51352-01-123 305.01$ 50.00$ 78.96$ 433.97$ Page 782 of 899 00057756-0933066462 PAMELA MCCLUSKEY 6646 162ND CT W ACTIVE 22-51352-01-513 382.58$ 50.00$ 96.21$ 528.79$ 00069197-0933066587 SPENCER LENZ 6658 162ND CT W ACTIVE 22-51352-01-521 314.27$ 50.00$ 81.02$ 445.29$ 00092688-0933066504 JASON CURTIS 6650 162ND CT W ACTIVE 22-51352-01-524 305.03$ 50.00$ 78.96$ 433.99$ 00095482-0926105456 ANTHONY KUNKEL 9103 179TH ST W ACTIVE 22-51400-01-010 817.84$ 50.00$ 193.02$ 1,060.86$ 00106374-0926108906 KAMRAN AHRAR 9174 179TH ST W ACTIVE 22-51400-03-050 838.87$ 50.00$ 197.69$ 1,086.56$ 00110440-0926114371 ABDIAZIZ HASSAN 17331 ENCINA PATH ACTIVE 22-52080-01-030 493.63$ 50.00$ 120.91$ 664.54$ 00113921-0926114026 YUSSUF SHAFIE 17304 ENCINA PATH ACTIVE 22-52080-02-010 779.37$ 50.00$ 184.46$ 1,013.83$ 00111578-0926116771 KYRSTIE GILLIE 17318 ENCINA PATH ACTIVE 22-52080-02-020 252.74$ 50.00$ 67.33$ 370.07$ 00109736-0926113726 PHUONG NGUYEN 17358 ELY AVE ACTIVE 22-52080-02-090 388.91$ 50.00$ 97.62$ 536.53$ 00109989-0926113771 FARRIS HASSAN 17374 ELY AVE ACTIVE 22-52080-02-110 582.47$ 50.00$ 140.67$ 773.14$ 00111673-0926118376 BARBARA BATT 17455 ELKWOOD AVE ACTIVE 22-52080-02-220 260.05$ 50.00$ 68.96$ 379.01$ 00113008-0926119726 SABA TESFAYE 17470 ELKWOOD AVE ACTIVE 22-52080-05-130 201.59$ 50.00$ 55.96$ 307.55$ 00112992-0926120106 ABIGAIL DITTMAN 5169 175TH ST W ACTIVE 22-52080-05-180 318.50$ 50.00$ 81.96$ 450.46$ 00053615-0176101950 BRYAN SEJNOHA 10195 176TH ST W ACTIVE 22-53500-01-070 374.95$ 50.00$ 94.51$ 519.46$ 00092157-0502177518 ANGELA WARD 17751 JAGUAR PATH ACTIVE 22-53500-02-120 603.37$ 50.00$ 145.32$ 798.69$ 00092228-0502175165 BRANDON STEWART 17516 JAGUAR PATH ACTIVE 22-53500-03-010 488.85$ 50.00$ 119.85$ 658.70$ 00078000-0528179001 BETH MALECHA 17900 JACQUARD PATH ACTIVE 22-53501-01-070 984.80$ 50.00$ 230.15$ 1,264.95$ 00105960-0528179902 JASON ANDERSON 17990 JACQUARD PATH ACTIVE 22-53501-01-110 121.23$ 50.00$ 38.08$ 209.31$ 00108987-0502178615 JEFFREY WULFF 17861 JAGUAR PATH ACTIVE 22-53501-02-030 251.60$ 50.00$ 67.08$ 368.68$ 00096435-0502179050 STEVEN HANSON 17905 JAGUAR PATH ACTIVE 22-53501-02-060 85.39$ 50.00$ 30.11$ 165.50$ 00099060-0515178107 DAWN LIEU 17810 JALISCO WAY ACTIVE 22-53502-01-050 623.28$ 50.00$ 149.74$ 823.02$ 00085896-0932102102 JENNY FORAR 10210 UPPER 178TH ST W ACTIVE 22-53502-02-030 562.91$ 50.00$ 136.32$ 749.23$ 00101290-0522177316 PETER JOHNSON 17731 JALISCO CT ACTIVE 22-53502-03-080 497.47$ 50.00$ 121.76$ 669.23$ 00092716-0513178000 RICK ZAUCHA 17800 JAMAICA CIR ACTIVE 22-53502-03-150 546.90$ 50.00$ 132.76$ 729.66$ 00097115-0513177614 ANTHONY DEBING 17761 JAMAICA CIR ACTIVE 22-53502-03-220 394.69$ 50.00$ 98.90$ 543.59$ 00106419-0553191030 MICHELLE OLMSTED 19103 KENWOOD WAY ACTIVE 22-53600-02-021 493.20$ 50.00$ 120.81$ 664.01$ 00118928-0533177610 ALEX JOHNSON 17761 JASPER CT ACTIVE 22-53650-01-130 142.34$ 50.00$ 42.78$ 235.12$ 00114416-0534177700 TIMOTHY FLUHARTY 17770 JAVELIN CT ACTIVE 22-53650-01-270 630.78$ 50.00$ 151.41$ 832.19$ 00117390-0502179365 JAY HAKE 17936 JAGUAR PATH ACTIVE 22-53650-03-030 411.81$ 50.00$ 102.71$ 564.52$ 00104499-0503179406 ADAM MANTY 17940 JASMINE CT ACTIVE 22-53650-03-050 157.23$ 50.00$ 46.09$ 253.32$ 00084592-0533177917 GETU ASHMY 17791 JASPER CT ACTIVE 22-53651-01-020 422.97$ 50.00$ 105.19$ 578.16$ 00118393-0661160659 DESERT MEDIA GROUP 16065 OAK SHORE DR ACTIVE 22-53701-01-040 157.23$ 50.00$ 46.09$ 253.32$ 00117778-0661160105 JOBS HOUSE 16010 OAK SHORE DR ACTIVE 22-53701-02-010 320.20$ 50.00$ 82.34$ 452.54$ 00109533-0661098289 SOPHEAR MAO 9828 OAK SHORE DR ACTIVE 22-53702-02-110 213.66$ 50.00$ 58.64$ 322.30$ 00117244-0161097955 COLLEEN WOODFORD 9795 161ST ST W ACTIVE 22-53702-02-130 773.91$ 50.00$ 183.25$ 1,007.16$ 00111881-0161098508 MICHAEL BARTH 9850 161ST ST W ACTIVE 22-53702-04-050 661.48$ 50.00$ 158.24$ 869.72$ 00073050-0161100726 JAMES ROEMHILDT 10072 161ST ST W ACTIVE 22-53702-05-040 257.12$ 50.00$ 68.31$ 375.43$ 00095721-0161100122 MONIQUE JULIAN 10012 161ST ST W ACTIVE 22-53702-05-070 338.18$ 50.00$ 86.34$ 474.52$ 00106870-0161100106 TAREN HALL 10010 161ST ST W ACTIVE 22-53702-05-070 631.50$ 50.00$ 151.57$ 833.07$ 00098983-0161099704 RICHARD NORDQUIST 9970 UPPER 161ST ST W ACTIVE 22-53702-05-092 1,280.23$ 50.00$ 295.86$ 1,626.09$ 00113054-0902098924 ADRIAN NUNEZ 9892 UPPER 161ST ST W ACTIVE 22-53702-05-130 452.99$ 50.00$ 111.87$ 614.86$ 00104771-0902098502 KYLE ZIMMERMAN 9850 UPPER 161ST ST W ACTIVE 22-53702-05-152 327.72$ 50.00$ 84.01$ 461.73$ 00100293-0902098106 AMY CLARK 9810 UPPER 161ST ST W ACTIVE 22-53702-05-170 98.34$ 50.00$ 32.99$ 181.33$ 00107902-0520161302 ROB STOKKE 16130 JOPLIN AVE ACTIVE 22-53705-01-040 434.58$ 50.00$ 107.78$ 592.36$ 00106369-0530161458 NOI KEOMALYVAHN PHOTHISH 16145 JOPLIN WAY ACTIVE 22-53705-01-062 439.92$ 50.00$ 108.96$ 598.88$ 00091512-0530161359 JOPLIN WAY LLC 16135 JOPLIN WAY ACTIVE 22-53705-01-080 358.45$ 50.00$ 90.84$ 499.29$ 00111582-0530161060 JERRY THATCHER 16106 JOPLIN WAY ACTIVE 22-53705-02-011 328.08$ 50.00$ 84.09$ 462.17$ 00117810-0530161425 TAMARA LEWIS 16142 JOPLIN WAY ACTIVE 22-53705-02-070 500.80$ 50.00$ 122.50$ 673.30$ 00116922-0520160056 TRIPLE N PROPERTIES INC.16005 JOPLIN AVE W ACTIVE 22-53706-01-010 1,084.57$ 50.00$ 252.34$ 1,386.91$ 00095562-0529161972 STEVEN THOMPSON 16197 JAMAICA AVE ACTIVE 22-53709-01-031 127.06$ 50.00$ 39.38$ 216.44$ 00100983-0862168596 NATHAN OBERST 16859 LIONS CT ACTIVE 22-54200-01-030 805.74$ 50.00$ 190.33$ 1,046.07$ 00076083-0167124500 MATT WOOD 12450 167TH ST W ACTIVE 22-54201-01-050 256.25$ 50.00$ 68.11$ 374.36$ 00102510-0556167607 MATT HOENCK 16760 KLAMATH TR ACTIVE 22-54720-26-321 257.57$ 50.00$ 68.41$ 375.98$ 00100059-0558175053 KEITH RAYMOND 17505 KODIAK AVE ACTIVE 22-54750-01-020 558.36$ 50.00$ 135.31$ 743.67$ 00115202-0612166700 MANNY HALL 16670 LAKEVIEW CT ACTIVE 22-54800-01-100 948.84$ 50.00$ 222.15$ 1,220.99$ 00098837-0852167608 CARLTON MATSON 16760 LAKE HILLS CT ACTIVE 22-54800-01-170 337.90$ 50.00$ 86.27$ 474.17$ 00118548-0838187035 JUDITH WALLBERG 18703 KALMAR CT ACTIVE 22-54826-04-020 359.61$ 50.00$ 91.10$ 500.71$ Page 783 of 899 00069295-0471203404 VALLEY CHRISTIAN CHURCH 20340 IBERIA AVE ACTIVE 22-56000-01-115 259.11$ 50.00$ 68.75$ 377.86$ 00087629-0408203709 KENNETH RUPP 20370 HUGHES AVE ACTIVE 22-56001-01-060 256.86$ 50.00$ 68.25$ 375.11$ 00099483-0774195521 KHALED MAHMUD 19552 IRELAND WAY ACTIVE 22-56200-01-030 806.17$ 50.00$ 190.42$ 1,046.59$ 00099759-0774196933 PAUL DEVINE 19693 IRELAND WAY ACTIVE 22-56200-02-060 683.28$ 50.00$ 163.09$ 896.37$ 00091145-0774195497 TERESA WHEELER 19549 IRELAND WAY ACTIVE 22-56200-03-030 505.33$ 50.00$ 123.51$ 678.84$ 00097187-0207084300 JENNIFER MOHR 8430 207TH ST W ACTIVE 22-56700-03-060 776.55$ 50.00$ 183.83$ 1,010.38$ 00069965-0922084098 FRANK BEISSEL 8409 LOWER 208TH ST W ACTIVE 22-56701-01-010 261.40$ 50.00$ 69.26$ 380.66$ 00103095-0922083991 PAUL KIRCHOFF 8399 LOWER 208TH ST W ACTIVE 22-56701-01-050 595.46$ 50.00$ 143.56$ 789.02$ 00061363-0922084106 WAYNE BEDEAUX 8410 LOWER 208TH ST W ACTIVE 22-56701-03-010 174.57$ 50.00$ 49.95$ 274.52$ 00119327-0208084986 SCOTT W. MAREK 8498 208TH ST W ACTIVE 22-56702-02-020 88.39$ 50.00$ 30.78$ 169.17$ 00058701-0208084887 KREJCE PROPERTIES LLC 8488 208TH ST W ACTIVE 22-56702-02-030 575.58$ 50.00$ 139.14$ 764.72$ 00094025-0208084606 PAUL GEPHART 8460 208TH ST W ACTIVE 22-56702-03-020 913.70$ 50.00$ 214.34$ 1,178.04$ 00097611-0208084200 PACHIA XIONG 8420 208TH ST W ACTIVE 22-56702-03-040 235.26$ 50.00$ 63.44$ 348.70$ 00104877-0926106816 CASEY MEYER 17932 EMBERS AVE ACTIVE 22-57100-05-020 252.74$ 50.00$ 67.33$ 370.07$ 00107734-0926110711 MARK FROEMKE 17962 EQUINOX AVE ACTIVE 22-57101-01-020 577.96$ 50.00$ 139.67$ 767.63$ 00106093-0926108501 NICHOLAS OLSON 17978 EQUINOX AVE ACTIVE 22-57101-01-060 362.51$ 50.00$ 91.75$ 504.26$ 00106321-0926108306 JACOB BERG 17990 EQUINOX AVE ACTIVE 22-57101-01-090 541.52$ 50.00$ 131.56$ 723.08$ 00106690-0926109291 SAMNANG YOU 17875 ELEMENT AVE ACTIVE 22-57102-01-040 827.28$ 50.00$ 195.12$ 1,072.40$ 00109343-0926113126 TRAVIS KRUCKENBERG 17832 ELEMENT AVE ACTIVE 22-57102-02-110 238.13$ 50.00$ 64.08$ 352.21$ 00110792-0926114931 TYLER TOVSEN 17892 ESSEX LA ACTIVE 22-57103-01-070 230.82$ 50.00$ 62.46$ 343.28$ 00108495-0926111561 ZACH WIENEKE 17887 ESSEX LA ACTIVE 22-57103-01-080 136.39$ 50.00$ 41.46$ 227.85$ 00000000-2000000370 KIM NEUMAN 17881 ESSEX LA ACTIVE 22-57103-01-090 601.88$ 50.00$ 144.99$ 796.87$ 00108510-0926111616 KIM NEUMAN 17881 ESSEX LA ACTIVE 22-57103-01-090 151.89$ 50.00$ 44.90$ 246.79$ 00113862-0926118946 KIIN YUSUF 17819 ELDER AVE ACTIVE 22-57104-02-130 1,764.54$ 50.00$ 403.57$ 2,218.11$ 00115599-0926124321 AMY SHAVER 17913 ECLIPSE AVE ACTIVE 22-57104-04-010 216.37$ 50.00$ 59.24$ 325.61$ 00112724-0926119751 PHUONG HUYNH 17907 ECLIPSE AVE ACTIVE 22-57104-04-020 713.82$ 50.00$ 169.88$ 933.70$ 00114096-0926122321 SIMEON DIMITROV 17942 ECLIPSE AVE ACTIVE 22-57104-06-030 268.85$ 50.00$ 70.92$ 389.77$ 00112331-0926118421 ABDULAAHI ALI 17900 ECLIPSE AVE ACTIVE 22-57104-07-020 826.67$ 50.00$ 194.98$ 1,071.65$ 00112124-0926117361 CHRIS LUNDBERG 17852 ECLIPSE AVE ACTIVE 22-57104-07-100 333.29$ 50.00$ 85.25$ 468.54$ 00112722-0926119731 AMINA HAJI 17780 ECLIPSE AVE ACTIVE 22-57104-07-220 660.46$ 50.00$ 158.01$ 868.47$ 00117736-0926128116 IDMAN OMAR 5378 178TH ST W ACTIVE 22-57106-01-010 836.61$ 50.00$ 197.19$ 1,083.80$ 00114667-0873176156 ANDREW MUNSEN 17615 HEIDELBERG WAY ACTIVE 22-57200-02-060 347.90$ 50.00$ 88.50$ 486.40$ 00094911-0926085256 RYAN KETTERLING 17630 HEMLOCK AVE ACTIVE 22-57200-05-080 391.90$ 50.00$ 98.28$ 540.18$ 00106325-0926085241 MANAL SAYES 17511 HEIDELBERG WAY ACTIVE 22-57200-06-080 457.22$ 50.00$ 112.81$ 620.03$ 00086954-0926089056 CHAD LOOSMORE 17510 HAVERHILL CIR ACTIVE 22-57200-07-010 468.11$ 50.00$ 115.23$ 633.34$ 00088082-0926090086 GAIL STROM 17518 HAVERHILL CIR ACTIVE 22-57201-01-020 108.09$ 50.00$ 35.16$ 193.25$ 00090318-0926092166 JESSICA KREMER 17568 HAVERHILL CIR ACTIVE 22-57201-02-080 632.15$ 50.00$ 151.72$ 833.87$ 00109759-0926091311 KIRK LITYNSKI 17580 HAVERHILL CIR ACTIVE 22-57201-02-110 796.30$ 50.00$ 188.23$ 1,034.53$ 00117408-0926091171 JOHN DARBO 17584 HAVERHILL CIR ACTIVE 22-57201-02-120 352.37$ 50.00$ 89.49$ 491.86$ 00118161-0926113621 SUBASH THAPA 18211 HIDEAWAY TR ACTIVE 22-57210-07-030 717.54$ 50.00$ 170.71$ 938.25$ 00118160-0926129891 RAMAKRISHNA SIVA 18219 HIDEAWAY TRL ACTIVE 22-57210-07-050 307.74$ 50.00$ 79.57$ 437.31$ 00111755-0926117461 FADUMO HUSEIN 18287 HIDEAWAY CT ACTIVE 22-57210-07-110 1,623.24$ 50.00$ 372.15$ 2,045.39$ 00111020-0926116356 KAITLIN DEVERAPALLI 18239 HIDEAWAY TR ACTIVE 22-57210-07-180 588.28$ 50.00$ 141.96$ 780.24$ 00112703-0926119156 LISA TINDELL 8105 183RD ST W ACTIVE 22-57210-09-110 290.77$ 50.00$ 75.79$ 416.56$ 00113881-0926120621 HIMANSHU GOYAL 18229 HAMEL DR ACTIVE 22-57212-01-170 194.28$ 50.00$ 54.33$ 298.61$ 00113958-0926120636 ERIC HELLEN 18240 HAMEL DR ACTIVE 22-57212-02-020 115.41$ 50.00$ 36.79$ 202.20$ 00118386-0926119451 MUNIRA OSMAN 18253 HAMEL DR ACTIVE 22-57212-03-050 359.70$ 50.00$ 91.12$ 500.82$ 00115742-0926123301 KRISHNA VENIGALLA 18057 HIDDEN CREEK TR ACTIVE 22-57213-02-030 374.85$ 50.00$ 94.49$ 519.34$ 00117393-0926125761 JEFFREY KOLES 18082 HIDDEN CREEK TR ACTIVE 22-57213-03-080 1,527.92$ 50.00$ 350.95$ 1,928.87$ 00116186-0926124471 MICHAEL J PARKER 18000 HEIRLOOM CT ACTIVE 22-57213-04-140 169.77$ 50.00$ 48.88$ 268.65$ 00115498-0926124136 PEGGY HAUS 18353 HAMBY WAY ACTIVE 22-57213-08-040 209.25$ 50.00$ 57.66$ 316.91$ 00093892-0408205258 RAY HORSCH 20525 HUGHES AVE ACTIVE 22-57750-01-021 452.65$ 50.00$ 111.79$ 614.44$ 00099387-0408206652 MALLORY GUZMAN 20665 HUGHES AVE ACTIVE 22-57750-03-020 342.25$ 50.00$ 87.24$ 479.49$ 00073490-0576180499 STEVE OUJIRI 18049 KINGSWAY PATH ACTIVE 22-58500-03-030 544.20$ 50.00$ 132.16$ 726.36$ 00111091-0853181491 JONATHAN COUSIN 18149 LAMAR LA ACTIVE 22-58500-03-080 745.31$ 50.00$ 176.89$ 972.20$ 00082186-0576181380 STEVE SHAFER 18138 KINGSWAY PATH ACTIVE 22-58500-04-020 1,243.51$ 50.00$ 287.69$ 1,581.20$ 00111034-0666183015 PAUL KIRSCHNER 18301 LANSFORD PATH ACTIVE 22-58500-09-110 106.83$ 50.00$ 34.88$ 191.71$ Page 784 of 899 00116864-0826182857 JULIET AKARUME 18285 KERRVILLE TR ACTIVE 22-58500-20-407 649.97$ 50.00$ 155.68$ 855.65$ 00100905-0826182998 CHAD HOMES 18299 KERRVILLE TR ACTIVE 22-58501-20-502 403.24$ 50.00$ 100.81$ 554.05$ 00103322-0826183053 ROSHONNA SMITH 18305 KERRVILLE TR ACTIVE 22-58501-20-505 466.35$ 50.00$ 114.84$ 631.19$ 00083586-0826183087 JEFF RICHARDS 18308 KERRVILLE TR ACTIVE 22-58501-20-605 179.14$ 50.00$ 50.96$ 280.10$ 00117770-0826183269 JOSH HALLER 18326 KERRVILLE TR ACTIVE 22-58501-20-702 399.48$ 50.00$ 99.97$ 549.45$ 00101535-0826183368 HEATH WARD 18336 KERRVILLE TR ACTIVE 22-58501-20-707 1,506.39$ 50.00$ 346.16$ 1,902.55$ 00086268-0926087306 ANDREW MATTSON 18160 LANSFORD PATH ACTIVE 22-58503-02-010 183.24$ 50.00$ 51.88$ 285.12$ 00107616-0926086586 DAWN KEPLER 18321 KERRVILLE TR ACTIVE 22-58505-01-116 149.72$ 50.00$ 44.42$ 244.14$ 00085731-0926085781 ANN MALWITZ 18287 KEY WEST CT ACTIVE 22-58505-01-216 280.83$ 50.00$ 73.58$ 404.41$ 00096681-0926087061 MICHAEL BLUMER 18350 LAFAYETTE WAY ACTIVE 22-58506-08-217 294.94$ 50.00$ 76.72$ 421.66$ 00094495-0926088706 TRINITY THIOULON 18407 LAFAYETTE WAY ACTIVE 22-58507-02-318 463.28$ 50.00$ 114.16$ 627.44$ 00087903-0926089941 ROBERT FLUTO 18438 LAFAYETTE WAY ACTIVE 22-58507-02-628 221.89$ 50.00$ 60.47$ 332.36$ 00117595-0926088381 CAROL ST GERMAIN 18393 LAFAYETTE WAY ACTIVE 22-58507-03-218 77.70$ 50.00$ 28.40$ 156.10$ 00118983-0926088201 JAMES STONE 18378 LAFAYETTE WAY ACTIVE 22-58507-03-228 255.88$ 50.00$ 68.03$ 373.91$ 00110660-0926088741 JOSEPH ROBINSON 18408 LAFAYETTE WAY ACTIVE 22-58507-04-428 1,080.53$ 50.00$ 251.44$ 1,381.97$ 00101375-0926088826 CLINTON TRAVIS 18434 LAFAYETTE WAY ACTIVE 22-58507-04-528 352.12$ 50.00$ 89.44$ 491.56$ 00086671-0926088396 JON SONTAG 18399 LAFAYETTE WAY ACTIVE 22-58507-06-218 394.44$ 50.00$ 98.85$ 543.29$ 00114815-0926123631 JACK POEHLING 9798 189TH ST W ACTIVE 22-58600-04-1100 975.71$ 50.00$ 228.13$ 1,253.84$ 00114348-0926117501 AMY STEVENS 19005 INNDALE DR ACTIVE 22-58600-05-010 1,375.83$ 50.00$ 317.12$ 1,742.95$ 00095740-0242170427 BARRY RICHARD 17042 EVENTIDE WAY ACTIVE 22-59500-05-020 377.70$ 50.00$ 95.13$ 522.83$ 00053514-0242171003 LAWRENCE GENZLER 17100 EVENTIDE WAY ACTIVE 22-59501-03-110 176.85$ 50.00$ 50.45$ 277.30$ 00086491-0926088461 STEPHEN DUCKWORTH 18164 IREGLEN PATH ACTIVE 22-59600-04-010 585.48$ 50.00$ 141.34$ 776.82$ 00107525-0926093926 CUONG SON 18220 IRONSTONE WAY ACTIVE 22-59601-01-040 595.39$ 50.00$ 143.54$ 788.93$ 00100572-0926092796 BRYAN WINTERS 18175 IRONSTONE WAY ACTIVE 22-59601-02-050 1,058.47$ 50.00$ 246.54$ 1,355.01$ 00103531-0926093096 CRAIG SCHNEIDER 18193 IRONSTONE WAY ACTIVE 22-59601-02-060 135.71$ 50.00$ 41.30$ 227.01$ 00093195-0926093626 AMIR NOMANI 18381 IRONSTONE WAY ACTIVE 22-59602-02-090 931.42$ 50.00$ 218.28$ 1,199.70$ 00109771-0807181209 TAYLOR ABRAM 18120 JARL CT ACTIVE 22-63101-05-030 364.09$ 50.00$ 92.10$ 506.19$ 00118721-0807181340 KIRBY KUBAL 18134 JARL CT ACTIVE 22-63101-05-040 1,667.76$ 50.00$ 382.05$ 2,099.81$ 00118218-0926127746 JUSTIN MORRIS 8278 186TH ST W ACTIVE 22-63200-02-120 85.38$ 50.00$ 30.11$ 165.49$ 00115399-0926123791 NASRA MOHAMED 18564 HAVEN CT ACTIVE 22-63200-03-020 137.32$ 50.00$ 41.66$ 228.98$ 00062990-0181110915 G HEINZ 11091 181ST ST W ACTIVE 22-63300-02-010 106.83$ 50.00$ 34.88$ 191.71$ 00115579-0409205406 KATELYNN REYES 20540 HOWLAND AVE ACTIVE 22-63700-03-061 563.19$ 50.00$ 136.38$ 749.57$ 00110861-0409205604 JACOB VAUPEL 20560 HOWLAND AVE ACTIVE 22-63700-03-070 93.13$ 50.00$ 31.83$ 174.96$ 00098288-0536172859 JESSICA WORMLEY 17285 JASPER TR ACTIVE 22-64100-01-040 432.15$ 50.00$ 107.24$ 589.39$ 00058139-0173100197 LYNNE KENNEDY 10019 173RD ST W ACTIVE 22-64101-01-230 317.27$ 50.00$ 81.68$ 448.95$ 00112285-0502174756 BETELHEM WELEDEMESKEL 17475 JAGUAR PATH ACTIVE 22-64101-03-140 2,110.20$ 50.00$ 480.45$ 2,640.65$ 00097920-0502174665 MELISSA CLAIRE 17466 JAGUAR PATH ACTIVE 22-64101-04-020 174.57$ 50.00$ 49.95$ 274.52$ 00077724-0649169248 RITA RYAN 16924 KINGS CT ACTIVE 22-64250-02-030 236.13$ 50.00$ 63.64$ 349.77$ 00070598-0649170758 JOEL HANKINSON 17075 KINGS CT ACTIVE 22-64251-01-210 219.05$ 50.00$ 59.84$ 328.89$ 00097255-0173096393 MARIE BEYER 9639 173RD ST W ACTIVE 22-64450-01-070 141.36$ 50.00$ 42.56$ 233.92$ 00086348-0173095908 GWENDOLYN JOHNSON 9590 173RD ST W ACTIVE 22-64451-01-020 518.44$ 50.00$ 126.43$ 694.87$ 00116613-0173096245 DEVIN NIGHTINGALE 9624 173RD ST W ACTIVE 22-64451-01-040 150.03$ 50.00$ 44.49$ 244.52$ 00111175-0172096386 DEVIN ANDREWS 9638 172ND ST W ACTIVE 22-64452-01-070 200.00$ 50.00$ 55.60$ 305.60$ 00103254-0172095800 JOSHUA WILKES 9580 172ND ST W ACTIVE 22-64452-01-100 732.97$ 50.00$ 174.14$ 957.11$ 00116397-0172096337 KATIE MATTHEWS 9633 172ND ST W ACTIVE 22-64452-03-060 359.21$ 50.00$ 91.01$ 500.22$ 00060397-0545168054 JAMES JOHNSON 16805 JAVELIN AVE ACTIVE 22-64530-01-070 123.99$ 50.00$ 38.70$ 212.69$ 00081383-0166106193 STEPHEN M STAUPE 10619 166TH ST W ACTIVE 22-64601-01-040 122.18$ 50.00$ 38.29$ 210.47$ 00117990-0537168717 JAY CLARKE 16871 JONQUIL TR ACTIVE 22-64602-02-150 373.40$ 50.00$ 94.17$ 517.57$ 00091039-0170107377 ROXANNE EDWARDS 10737 170TH ST W ACTIVE 22-64602-02-240 92.43$ 50.00$ 31.68$ 174.11$ 00095478-0537169227 JASON WARNKE 16922 JONQUIL TR ACTIVE 22-64602-03-140 654.92$ 50.00$ 156.78$ 861.70$ 00069037-0511170415 BUSINESS OFFICE EMSOCS 17041 JONQUIL AVE ACTIVE 22-64603-02-090 1,188.43$ 50.00$ 275.44$ 1,513.87$ 00079136-0520171792 JAMES BIGALKE 17179 JOPLIN AVE ACTIVE 22-64603-02-300 405.41$ 50.00$ 101.29$ 556.70$ 00111706-0541171201 PAUL SHARP 17120 JORDAN CT ACTIVE 22-64603-03-080 593.00$ 50.00$ 143.01$ 786.01$ 00098580-0169104989 ANDREW ZWACH 10498 169TH ST W ACTIVE 22-64604-01-010 369.53$ 50.00$ 93.31$ 512.84$ 00085106-0646166910 CHARLES RICHARDSON 16691 KENTUCKY AVE ACTIVE 22-64605-01-010 1,074.72$ 50.00$ 250.15$ 1,374.87$ 00116795-0497165458 LIBBY KVASNICKA 16545 JOPLIN PATH ACTIVE 22-64606-01-090 321.07$ 50.00$ 82.53$ 453.60$ 00098650-0511165203 AMI KETCHER 16520 JONQUIL AVE ACTIVE 22-64606-03-020 561.19$ 50.00$ 135.94$ 747.13$ Page 785 of 899 00110341-0509165188 CHRISTOPHER KODET 16518 JERSEY AVE ACTIVE 22-64607-02-010 181.84$ 50.00$ 51.56$ 283.40$ 00110317-0509165686 COLE TODD 16568 JERSEY AVE ACTIVE 22-64607-02-050 395.87$ 50.00$ 99.17$ 545.04$ 00062733-0166103555 CAROL HARA 10355 166TH ST W ACTIVE 22-64607-02-070 650.18$ 50.00$ 155.73$ 855.91$ 00093259-0166103459 BRIAN RISTOW 10345 166TH ST W ACTIVE 22-64607-02-080 159.83$ 50.00$ 46.67$ 256.50$ 00103606-0545165419 BENBIN ZHU 16541 JAVELIN AVE ACTIVE 22-64607-02-130 745.95$ 50.00$ 177.03$ 972.98$ 00084083-0166103962 JEAN LARSON 10396 166TH ST W ACTIVE 22-64607-04-030 83.97$ 50.00$ 29.80$ 163.77$ 00098613-0166103400 NICOLE WILLIAMSON 10340 166TH ST W ACTIVE 22-64607-04-140 265.72$ 50.00$ 70.22$ 385.94$ 00109705-0545166992 GRANT ERICKSON 16699 JAVELIN AVE ACTIVE 22-64607-04-230 360.75$ 50.00$ 91.36$ 502.11$ 00094558-0926100091 BREANN RONCHAK 18023 HYDE PARK AVE ACTIVE 22-64700-05-020 1,035.60$ 50.00$ 241.45$ 1,327.05$ 00105424-0208102457 CHRISTIAN CRUPKO 10245 208TH ST W ACTIVE 22-64810-01-100 821.41$ 50.00$ 193.81$ 1,065.22$ 00100783-0584209660 ANDREW HARGROVE 20966 JAMESTOWN AVE ACTIVE 22-64811-01-100 106.83$ 50.00$ 34.88$ 191.71$ 00060772-0582209134 MITCHELL FENNE 20913 JENKINS WAY ACTIVE 22-64812-01-060 423.66$ 50.00$ 105.35$ 579.01$ 00060775-0582209324 JEFFREY SIMMONS 20932 JENKINS WAY ACTIVE 22-64812-02-060 235.26$ 50.00$ 63.44$ 348.70$ 00109831-0625209596 NANCY FEICHTINGER 20959 JUNE CT ACTIVE 22-64813-02-040 142.83$ 50.00$ 42.89$ 235.72$ 00114344-0476175415 KERRY DEPALMA 17541 IONIA PATH ACTIVE 22-66101-01-060 91.94$ 50.00$ 31.57$ 173.51$ 00090834-0476175514 ACE DILLY 17551 IONIA PATH ACTIVE 22-66101-01-110 369.91$ 50.00$ 93.39$ 513.30$ 00113128-0176094437 MATTHEW PROVOST 9443 176TH ST W ACTIVE 22-66101-01-150 417.70$ 50.00$ 104.02$ 571.72$ 00115067-0195085509 PATRICK GIYAN 8550 195TH ST W ACTIVE 22-66500-01-040 464.39$ 50.00$ 114.41$ 628.80$ 00110999-0195085822 ROBERT SPICER 8582 195TH ST W ACTIVE 22-66500-01-050 78.29$ 50.00$ 28.53$ 156.82$ 00105921-0195087307 MIMA MANCIA CARERES 8730 195TH ST W ACTIVE 22-66500-01-100 686.73$ 50.00$ 163.86$ 900.59$ 00091067-0371170545 MARK JURAN 17054 GLENCOE AVE ACTIVE 22-67500-01-040 106.65$ 50.00$ 34.84$ 191.49$ 00109802-0385170119 NATHAN WHITE 17011 GLENCOE CIR ACTIVE 22-67500-02-010 346.40$ 50.00$ 88.16$ 484.56$ 00100798-0171076652 MARIANO CARREON 7665 171ST ST W ACTIVE 22-67501-01-010 325.66$ 50.00$ 83.55$ 459.21$ 00069521-0172076545 JEFFREY LEIVISKA 7654 172ND ST W ACTIVE 22-67502-05-010 553.43$ 50.00$ 134.21$ 737.64$ 00096984-0371172608 SHIMELIS DADI 17260 GLENCOE AVE ACTIVE 22-67503-01-090 434.40$ 50.00$ 107.74$ 592.14$ 00088167-0172076784 TAMARA WINDSCHITL 7678 172ND ST W ACTIVE 22-67504-03-060 928.54$ 50.00$ 217.64$ 1,196.18$ 00102092-0387172865 JOHN ONGORI 17286 GREENTREE PATH ACTIVE 22-67505-01-020 171.07$ 50.00$ 49.17$ 270.24$ 00097935-0387172949 SHAWN HAUKAAS 17294 GREENTREE PATH ACTIVE 22-67505-01-040 689.99$ 50.00$ 164.58$ 904.57$ 00111795-0261173237 FAIZA HOLMES 17323 GOODHUE AVE ACTIVE 22-67505-03-020 643.78$ 50.00$ 154.30$ 848.08$ 00078401-0371173176 RAUL A HERNANDEZ 17317 GLENCOE AVE ACTIVE 22-67505-05-020 92.06$ 50.00$ 31.60$ 173.66$ 00098171-0371173333 DEBRA JOHNSON 17333 GLENCOE AVE ACTIVE 22-67505-05-030 200.00$ 50.00$ 55.60$ 305.60$ 00114452-0371173622 KURT FOLSTAD 17362 GLENCOE AVE ACTIVE 22-67506-01-010 423.34$ 50.00$ 105.28$ 578.62$ 00106217-0926106541 DENIS BABICH 16685 JUDICIAL RD ACTIVE 22-67790-01-050 274.63$ 50.00$ 72.20$ 396.83$ 00106182-0926102371 JOHN SCHUMANN 16657 JUDICIAL RD ACTIVE 22-67790-01-060 196.40$ 50.00$ 54.80$ 301.20$ 00101758-0204103301 NICK LINDSAY 10330 204TH ST W ACTIVE 22-68000-02-010 293.54$ 50.00$ 76.41$ 419.95$ 00091296-0926092076 DARBY O'LEARY 16958 DYNAMIC DR ACTIVE 22-71300-01-010 516.94$ 50.00$ 126.09$ 693.03$ 00096578-0926096341 JIM CASAZZA 16950 DYNAMIC DR ACTIVE 22-71300-01-020 430.23$ 50.00$ 106.81$ 587.04$ 00103099-0926088001 DANI JIMENEZ SHADRICK 5098 DRAGONETTE ST ACTIVE 22-71300-02-050 391.90$ 50.00$ 98.28$ 540.18$ 00097204-0926097876 TANI KALWEIT 16890 EAGLEVIEW DR ACTIVE 22-71300-03-030 230.82$ 50.00$ 62.46$ 343.28$ 00091564-0926091801 PATRICK TOLLEFSRUD 16838 EAGLEVIEW DR ACTIVE 22-71300-06-020 613.46$ 50.00$ 147.56$ 811.02$ 00102540-0926103941 ERIN VONSEE 16571 EAST LAKE DR ACTIVE 22-71300-13-090 364.01$ 50.00$ 92.08$ 506.09$ 00071129-0926099416 JENNIFER MATTSON 16579 EAST LAKE DRIVE ACTIVE 22-71300-13-100 441.71$ 50.00$ 109.36$ 601.07$ 00097846-0926098496 JILL PATTERSON 16587 EAST LAKE DR ACTIVE 22-71300-13-110 362.51$ 50.00$ 91.75$ 504.26$ 00101947-0926097516 KATHERINE BURLINGAME 5253 167TH ST W ACTIVE 22-71301-02-030 1,022.73$ 50.00$ 238.59$ 1,311.32$ 00090986-0926091806 DANIEL ECKHOLM 16917 EAST LAKE DR ACTIVE 22-71301-07-010 1,191.88$ 50.00$ 276.21$ 1,518.09$ 00094383-0926094426 ERIC BARNUM 16680 EAGLEVIEW PL ACTIVE 22-71305-03-010 86.34$ 50.00$ 30.32$ 166.66$ 00104321-0926095031 MARC PARKER 16688 EAGLEVIEW PL ACTIVE 22-71305-03-030 362.51$ 50.00$ 91.75$ 504.26$ 00095794-0926095841 JARED CHRISTIANSON 4524 168TH ST W ACTIVE 22-71306-02-060 795.83$ 50.00$ 188.12$ 1,033.95$ 00095289-0926095041 PETER BERTHELOT 16830 DIAMONTE PATH ACTIVE 22-71306-02-260 1,175.32$ 50.00$ 272.52$ 1,497.84$ 00095997-0926096551 CHRIS SCHWARTZ 16783 DRAFT HORSE CT ACTIVE 22-71309-01-090 298.09$ 50.00$ 77.42$ 425.51$ 00109671-0926097306 JULIE BEAUDOIN 16774 DIAMONTE PATH ACTIVE 22-71309-03-080 176.85$ 50.00$ 50.45$ 277.30$ 00097764-0926098301 DAN LENMARK 16602 EAGLEVIEW DR ACTIVE 22-71310-02-010 1,207.26$ 50.00$ 279.63$ 1,536.89$ 00102043-0926103546 ERIC LONG 16450 ENVOY WAY ACTIVE 22-71311-02-090 1,056.80$ 50.00$ 246.16$ 1,352.96$ 00109241-0926098801 ARMIN JEWELL 16301 ENVOY WAY ACTIVE 22-71313-01-050 159.70$ 50.00$ 46.64$ 256.34$ 00115025-0926103511 GLENN DOERKSEN 16545 DULUTH TR ACTIVE 22-71314-01-050 1,253.25$ 50.00$ 289.86$ 1,593.11$ 00102324-0926103796 RICHARD FORTMAN 16568 DULUTH TR ACTIVE 22-71314-03-070 230.81$ 50.00$ 62.46$ 343.27$ 00093672-0875186544 MICHELLE KEEFE 18654 IRENIC AVE ACTIVE 22-71326-01-010 142.83$ 50.00$ 42.89$ 235.72$ Page 786 of 899 00106956-0875186429 DANIEL JORGENSEN 18642 IRENIC AVE ACTIVE 22-71326-02-030 141.33$ 50.00$ 42.55$ 233.88$ 00111636-0885188415 TYLER MALLERY 18841 IROQUOIS WAY ACTIVE 22-71326-07-100 644.84$ 50.00$ 154.54$ 849.38$ 00105087-0926105651 SHARON MCDONALD 16259 ELKHORN TR ACTIVE 22-71340-02-180 328.95$ 50.00$ 84.28$ 463.23$ 00104574-0926106686 MELANIE ROBERTSON 16260 EQUESTRIAN TR ACTIVE 22-71340-05-150 1,823.90$ 50.00$ 416.78$ 2,290.68$ 00105879-0926105676 ROBERT BRAATEN 4662 165TH ST W ACTIVE 22-71341-02-100 216.20$ 50.00$ 59.21$ 325.41$ 00106072-0926108531 AMY GILBERT 16201 DRYDEN RD ACTIVE 22-71342-07-010 1,473.31$ 50.00$ 338.80$ 1,862.11$ 00113861-0926112326 ELIZABETH PIPER 16204 DURANGO TR ACTIVE 22-71343-04-010 208.90$ 50.00$ 57.58$ 316.48$ 00109019-0926111206 JILL KOPP 16248 DRAFT HORSE BLVD ACTIVE 22-71344-01-040 1,125.11$ 50.00$ 261.36$ 1,436.47$ 00110789-0926114831 KENNETH HANSON 16305 DRAFT HORSE BLVD ACTIVE 22-71344-02-060 377.29$ 50.00$ 95.03$ 522.32$ 00116802-0926125976 STEPHANIE FORD 5034 161ST ST W ACTIVE 22-71345-03-080 342.13$ 50.00$ 87.21$ 479.34$ 00115371-0926119686 ADNAN AWOW 16388 DULUTH TR ACTIVE 22-71346-04-020 1,051.83$ 50.00$ 245.06$ 1,346.89$ 00116169-0926120291 COREY DENICOLA 16177 DUVANE WAY ACTIVE 22-71347-01-030 395.10$ 50.00$ 99.00$ 544.10$ 00115516-0926123111 RESIDENT 16101 DUVANE WAY ACTIVE 22-71347-01-220 501.96$ 50.00$ 122.76$ 674.72$ 00113652-0926121381 ANDRE RUSH 16154 DUVANE WAY ACTIVE 22-71347-03-020 609.33$ 50.00$ 146.64$ 805.97$ 00118088-0926121676 JAYDON SERBOUSEK 16134 DUVANE WAY ACTIVE 22-71347-04-030 174.12$ 50.00$ 49.85$ 273.97$ 00116170-0926122021 BRAD ELLSWORTH 16106 DUVANE WAY ACTIVE 22-71347-05-020 433.11$ 50.00$ 107.45$ 590.56$ 00079086-0204112310 SPRINGBROOK CONDOMINIUM ASSOCIATION 11231 204TH ST W ACTIVE 22-71390-05-102 345.41$ 50.00$ 87.94$ 483.35$ 00079086-0204112278 SPRINGBROOK CONDOMINIUM ASSOCIATION 11227 204TH ST W ACTIVE 22-71390-05-104 201.44$ 50.00$ 55.92$ 307.36$ 00079086-0204111932 SPRINGBROOK CONDOMINIUM ASSOCIATION 11193 204TH ST W ACTIVE 22-71390-05-201 191.08$ 50.00$ 53.62$ 294.70$ 00079086-0204111916 SPRINGBROOK CONDOMINIUM ASSOCIATION 11191 204TH ST W ACTIVE 22-71390-05-202 257.46$ 50.00$ 68.38$ 375.84$ 00079086-0204111890 SPRINGBROOK CONDOMINIUM ASSOCIATION 11189 204TH ST W ACTIVE 22-71390-05-203 437.80$ 50.00$ 108.49$ 596.29$ 00079086-0204111775 SPRINGBROOK CONDOMINIUM ASSOCIATION 11177 204TH ST W ACTIVE 22-71390-05-207 489.82$ 50.00$ 120.06$ 659.88$ 00079086-0850203652 SPRINGBROOK CONDOMINIUM ASSOCIATION 20365 KENSFIELD TR ACTIVE 22-71390-05-502 230.24$ 50.00$ 62.33$ 342.57$ 00079086-0204111239 SPRINGBROOK CONDOMINIUM ASSOCIATION 11123 204TH ST W ACTIVE 22-71390-05-506 153.98$ 50.00$ 45.37$ 249.35$ 00079086-0204111288 SPRINGBROOK CONDOMINIUM ASSOCIATION 11128 204TH ST W ACTIVE 22-71390-05-601 153.98$ 50.00$ 45.37$ 249.35$ 00079086-0204111262 SPRINGBROOK CONDOMINIUM ASSOCIATION 11126 204TH ST W ACTIVE 22-71390-05-602 153.98$ 50.00$ 45.37$ 249.35$ 00079086-0850204270 SPRINGBROOK CONDOMINIUM ASSOCIATION 20427 KENSFIELD TR ACTIVE 22-71390-05-607 429.61$ 50.00$ 106.67$ 586.28$ 00079086-0850204411 SPRINGBROOK CONDOMINIUM ASSOCIATION 20441 KENSFIELD TR ACTIVE 22-71390-05-701 77.70$ 50.00$ 28.40$ 156.10$ 00000000-2000001885 MICHELLE CHRISTNER 20435 KENSFIELD TR ACTIVE 22-71390-05-704 158.21$ 50.00$ 46.31$ 254.52$ 00079086-0850204478 SPRINGBROOK CONDOMINIUM ASSOCIATION 20447 KENSFIELD TR ACTIVE 22-71390-05-707 263.08$ 50.00$ 69.63$ 382.71$ 00079086-0204111528 SPRINGBROOK CONDOMINIUM ASSOCIATION 11152 204TH ST W ACTIVE 22-71390-05-808 333.76$ 50.00$ 85.35$ 469.11$ 00079086-0204111445 SPRINGBROOK CONDOMINIUM ASSOCIATION 11144 204TH ST W ACTIVE 22-71390-05-812 368.44$ 50.00$ 93.07$ 511.51$ 00079086-0204111940 SPRINGBROOK CONDOMINIUM ASSOCIATION 11194 204TH ST W ACTIVE 22-71390-05-905 183.57$ 50.00$ 51.95$ 285.52$ 00079086-0204112286 SPRINGBROOK CONDOMINIUM ASSOCIATION 11228 204TH ST W ACTIVE 22-71390-06-003 96.68$ 50.00$ 32.62$ 179.30$ 00079086-0204112328 SPRINGBROOK CONDOMINIUM ASSOCIATION 11232 204TH ST W ACTIVE 22-71390-06-005 119.88$ 50.00$ 37.78$ 207.66$ 00079086-0850203587 SPRINGBROOK CONDOMINIUM ASSOCIATION 20358 KENSFIELD TR ACTIVE 22-71390-06-405 227.08$ 50.00$ 61.63$ 338.71$ 00079086-0926085926 SPRINGBROOK CONDOMINIUM ASSOCIATION 20328 KENSFIELD TR ACTIVE 22-71390-06-505 284.68$ 50.00$ 74.44$ 409.12$ 00000000-2000000281 PATRICK MILLER 20326 KENSFIELD TR ACTIVE 22-71390-06-506 153.32$ 50.00$ 45.22$ 248.54$ 00079086-0850203348 SPRINGBROOK CONDOMINIUM ASSOCIATION 20334 KENSFIELD TR ACTIVE 22-71390-06-602 201.44$ 50.00$ 55.92$ 307.36$ 00079086-0850203728 SPRINGBROOK CONDOMINIUM ASSOCIATION 20372 KENSFIELD TR ACTIVE 22-71390-06-704 385.78$ 50.00$ 96.92$ 532.70$ 00079086-0850203983 SPRINGBROOK CONDOMINIUM ASSOCIATION 20398 KENSFIELD TR ACTIVE 22-71390-06-806 161.02$ 50.00$ 46.93$ 257.95$ 00079086-0850204700 SPRINGBROOK CONDOMINIUM ASSOCIATION 20470 KENSFIELD TR ACTIVE 22-71390-07-005 217.42$ 50.00$ 59.48$ 326.90$ 00079086-0850204684 SPRINGBROOK CONDOMINIUM ASSOCIATION 20468 KENSFIELD TR ACTIVE 22-71390-07-006 145.46$ 50.00$ 43.47$ 238.93$ 00100960-0926103701 AMERICAN ACQUISITIONS INC 7898 210TH ST W ACTIVE 22-71400-01-190 169.64$ 50.00$ 48.85$ 268.49$ 00084325-0680205216 SENG KEO PHOTHISANH 20521 GATEWAY CT ACTIVE 22-71450-01-070 344.85$ 50.00$ 87.82$ 482.67$ 00104739-0259205894 LOUIS HERNANDEZ 20589 GATEWAY DR ACTIVE 22-71450-01-120 938.61$ 50.00$ 219.88$ 1,208.49$ 00089426-0926091571 SUSAN ANTKOWIAK 20740 GEMINI TR ACTIVE 22-71451-02-090 500.82$ 50.00$ 122.51$ 673.33$ 00112498-0926089621 SHANNON JOHNSON 20744 GEMINI TR ACTIVE 22-71451-02-100 678.07$ 50.00$ 161.93$ 890.00$ 00097609-0926088151 RYAN WENNER 20749 FURY CT ACTIVE 22-71451-03-040 603.07$ 50.00$ 145.25$ 798.32$ 00105055-0926089831 KISSANAK THONGRATSAMY 20775 GEMINI TR ACTIVE 22-71451-03-170 762.43$ 50.00$ 180.69$ 993.12$ 00098060-0926089241 ETYANA AYANA 20787 GEMINI TR ACTIVE 22-71451-03-200 455.77$ 50.00$ 112.49$ 618.26$ 00091099-0926092806 KRYSIA MOE 20678 FROST CT ACTIVE 22-71452-01-200 556.23$ 50.00$ 134.83$ 741.06$ 00096609-0926095531 PAMELA KLING 20722 FROST CT ACTIVE 22-71452-01-310 258.43$ 50.00$ 68.60$ 377.03$ 00111023-0926093081 ABDIRIZAK DIRIA 20794 GEMINI TR ACTIVE 22-71452-01-330 1,099.28$ 50.00$ 255.61$ 1,404.89$ 00104946-0926096191 BENJAMIN TAPIA 20815 GEMINI TR ACTIVE 22-71452-01-390 468.73$ 50.00$ 115.37$ 634.10$ 00114649-0839206081 MACKENZIE STREIFEL 20608 KAFTAN CT ACTIVE 22-71500-01-080 394.20$ 50.00$ 98.79$ 542.99$ 00110839-0849206071 STEVEN ALLEN 20607 KEARNEY PATH ACTIVE 22-71500-03-060 323.52$ 50.00$ 83.07$ 456.59$ Page 787 of 899 00106514-0837205192 RESIDENT 20519 KALMEADOW CT ACTIVE 22-71500-05-100 234.28$ 50.00$ 63.23$ 347.51$ 00097647-0849206394 RICHARD NEGAARD 20639 KEARNEY PATH ACTIVE 22-71501-03-010 235.57$ 50.00$ 63.51$ 349.08$ 00111533-0849206154 WILLIAM SVOBODA 20615 KEARNEY PATH ACTIVE 22-71501-03-060 192.89$ 50.00$ 54.02$ 296.91$ 00110136-0926085676 MICHELLE RASKOVICH 21318 HYTRAIL CIR ACTIVE 22-72500-01-090 718.78$ 50.00$ 170.99$ 939.77$ 00112049-0926085631 MATTHEW DALHAUSER 21301 HYTRAIL CIR ACTIVE 22-72500-02-010 493.81$ 50.00$ 120.95$ 664.76$ 00104527-0926088841 RYAN STENE 21370 HYTRAIL CIR ACTIVE 22-72501-04-150 1,474.80$ 50.00$ 339.13$ 1,863.93$ 00111663-0926086906 CHRISTOPHER BURDGE 21382 HYTRAIL CIR ACTIVE 22-72501-04-210 1,102.04$ 50.00$ 256.23$ 1,408.27$ 00115186-0926085616 DENIS NDE ANDONGUYUNG 21336 HYTRAIL CIR ACTIVE 22-72501-05-030 482.84$ 50.00$ 118.51$ 651.35$ 00095979-0926096211 ANDREA SKIBA 21328 HYALITE DR ACTIVE 22-72504-01-010 1,481.10$ 50.00$ 340.53$ 1,871.63$ 00096551-0926096961 CHRISTOPHER KORKOWSKI 21404 HYALITE DR ACTIVE 22-72504-01-060 551.98$ 50.00$ 133.89$ 735.87$ 00099366-0926099791 ARUNKUMAR RAMASUBRAMANIAN 18861 JAVELIN WAY ACTIVE 22-72575-04-030 415.96$ 50.00$ 103.63$ 569.59$ 00092517-0841160813 ADAM THOMPSON 16081 KENNARD CT ACTIVE 22-72800-02-020 180.67$ 50.00$ 51.30$ 281.97$ 00105035-0841161019 SONYA KORNSAENG 16101 KENNARD CT ACTIVE 22-72800-02-050 1,440.99$ 50.00$ 331.61$ 1,822.60$ 00111616-0844158566 ISIAKA AGBOOLA 15856 KENDALE DR ACTIVE 22-72800-03-090 242.54$ 50.00$ 65.06$ 357.60$ 00114983-0926097961 BENJAMIN PEDERSON 19333 HUNTINGTON AVE ACTIVE 22-73350-03-140 485.31$ 50.00$ 119.06$ 654.37$ 00114669-0926098361 ZIAD MOHAMED 19358 HUNTINGTON AVE ACTIVE 22-73350-04-070 157.23$ 50.00$ 46.09$ 253.32$ 00110579-0926097971 CHRISTOPHER RUSH 19322 HUNTINGTON AVE ACTIVE 22-73350-05-040 256.86$ 50.00$ 68.25$ 375.11$ 00101651-0926099191 JAMES HULTGREN 19355 INDORA TR ACTIVE 22-73351-01-080 1,118.78$ 50.00$ 259.95$ 1,428.73$ 00111951-0926107101 MATTHEW KIRSCH 19254 HUXLEY AVE ACTIVE 22-73352-02-020 207.16$ 50.00$ 57.20$ 314.36$ 00105478-0926107301 RAHUL BISWAS 19250 INDORA TR ACTIVE 22-73353-01-040 798.21$ 50.00$ 188.65$ 1,036.86$ 00109949-0926114156 ZACHARIAH HADDY 19179 HUXLEY AVE ACTIVE 22-73354-02-030 238.31$ 50.00$ 64.12$ 352.43$ 00110247-0926113331 CAITLIN LUNDEEN 19145 INDORA TR ACTIVE 22-73355-01-020 425.24$ 50.00$ 105.70$ 580.94$ 00106544-0926108881 KRISTEN BOETTCHER 19185 INDORA TR ACTIVE 22-73355-01-060 334.05$ 50.00$ 85.42$ 469.47$ 00108722-0926112216 JOHN ISAACSON 19215 INDORA TR ACTIVE 22-73355-01-090 1,872.75$ 50.00$ 427.64$ 2,350.39$ 00110374-0926115301 KRISTA SOLLIN 19032 IDEN AVE ACTIVE 22-73357-02-030 205.07$ 50.00$ 56.73$ 311.80$ 00113787-0926119931 GURJEET KAUR 19080 IDEN AVE ACTIVE 22-73357-02-070 908.52$ 50.00$ 213.19$ 1,171.71$ 00113298-0926119556 ADITHYA PAILLA 19120 INDORA TR ACTIVE 22-73357-03-020 499.15$ 50.00$ 122.14$ 671.29$ 00116064-0926115126 ALEX BOLINE 19171 IMPALA AVE ACTIVE 22-73357-04-010 180.50$ 50.00$ 51.27$ 281.77$ 00113595-0926117526 SAMIA BARSUG 19162 HUNTINGTON AVE ACTIVE 22-73358-01-020 362.72$ 50.00$ 91.79$ 504.51$ 00114598-0926120731 HASSAN ALI 19278 HILLCREST AVE ACTIVE 22-73358-03-090 1,864.02$ 50.00$ 425.70$ 2,339.72$ 00115285-0926116801 NAJMA AWOW 17909 HAYES AVE ACTIVE 22-73370-01-020 450.00$ 50.00$ 111.21$ 611.21$ 00113708-0926121776 DYLAN WONDRA 17917 HAYES AVE ACTIVE 22-73370-01-030 168.06$ 50.00$ 48.50$ 266.56$ 00112559-0926117296 CORY KYES 17906 HAWKSBILL DR ACTIVE 22-73370-02-020 393.45$ 50.00$ 98.63$ 542.08$ 00113793-0926121441 FIRAOLI FOGA USHA 17942 HAWKSBILL DR ACTIVE 22-73370-02-110 1,079.82$ 50.00$ 251.28$ 1,381.10$ 00111932-0926116806 VENKATESH GORUR KRISHNA LYENGAR 17915 HAWKSBILL DR ACTIVE 22-73370-03-040 142.72$ 50.00$ 42.86$ 235.58$ 00000000-2000000957 WACONIA HOMES 17936 GRESFORD LA ACTIVE 22-73370-08-010 79.69$ 50.00$ 28.84$ 158.53$ 00000000-2000000202 JOHN RAICHE 17916 GREENWICH WAY ACTIVE 22-73370-09-040 149.86$ 50.00$ 44.45$ 244.31$ 00115532-0926124326 MOHAMED A MOHAMUD 17925 HAYES AVE ACTIVE 22-73371-01-010 606.78$ 50.00$ 146.08$ 802.86$ 00115475-0926123236 HODAN ABDULLAHI 17933 HAYES AVE ACTIVE 22-73371-01-020 247.26$ 50.00$ 66.11$ 363.37$ 00114936-0926122331 ABHISHEK MOHAN 17957 HAYES AVE ACTIVE 22-73371-01-050 726.94$ 50.00$ 172.80$ 949.74$ 00000000-2000000244 MULKI KULMIE 17928 GREENWICH WAY ACTIVE 22-73371-05-020 265.21$ 50.00$ 70.11$ 385.32$ 00113575-0926088911 RYAN WHEELER 16069 FLAGSTAFF AVE ACTIVE 22-73400-01-010 157.08$ 50.00$ 46.06$ 253.14$ 00119057-0507175451 VICTORINO DOMINGUEZ PLIEGO 17545 JAVA CT S ACTIVE 22-74800-01-090 321.18$ 50.00$ 82.55$ 453.73$ 00087950-0271165967 CHRISTOPHER SLATER 16596 GUNFLINT TR ACTIVE 22-75100-04-090 216.37$ 50.00$ 59.24$ 325.61$ 00088412-0881191454 SAVI HENRY 19145 ISMAY CIR ACTIVE 22-75825-01-010 1,503.24$ 50.00$ 345.46$ 1,898.70$ 00080016-0798191951 SADNA HENRY 19195 ISMAY PATH ACTIVE 22-75825-01-110 1,483.62$ 50.00$ 341.09$ 1,874.71$ 00098515-0799190499 STEPHEN BURSON 19049 IRETON WAY ACTIVE 22-75825-04-040 917.46$ 50.00$ 215.17$ 1,182.63$ 00109314-0799190929 TIMOTHY PIISPANEN 19092 IRETON WAY ACTIVE 22-75825-06-030 826.23$ 50.00$ 194.88$ 1,071.11$ 00116277-0889191555 HORACIO ARIZA 19155 ITTABENA WAY ACTIVE 22-75826-01-020 435.84$ 50.00$ 108.06$ 593.90$ 00106796-0461191718 ADAM KURTH 19171 ITERI AVE ACTIVE 22-75826-02-100 375.15$ 50.00$ 94.56$ 519.71$ 00108913-0889191381 DOWLATRAM HAROLD 19138 ITTABENA WAY ACTIVE 22-75827-02-010 650.78$ 50.00$ 155.86$ 856.64$ 00082899-0461191395 TERESA NGUYEN 19139 ITERI AVE ACTIVE 22-75827-02-040 429.76$ 50.00$ 106.70$ 586.46$ 00085050-0461191288 RICK MCKINLEY 19128 ITERI AVE ACTIVE 22-75827-04-030 487.80$ 50.00$ 119.61$ 657.41$ 00102006-0208098697 MARIELA MAVARRO 9869 208TH ST W ACTIVE 22-75850-01-080 627.91$ 50.00$ 150.77$ 828.68$ 00096499-0208096816 CHERYL HANSON-WHITTLE 9681 208TH ST W ACTIVE 22-75850-02-080 1,717.07$ 50.00$ 393.02$ 2,160.09$ 00097906-0206098913 DANIELLE HELGESON 9891 206TH ST W ACTIVE 22-75852-01-070 275.50$ 50.00$ 72.39$ 397.89$ 00103669-0517206601 SARAH COLE 20660 JACQUARD AVE ACTIVE 22-75852-02-010 541.70$ 50.00$ 131.60$ 723.30$ Page 788 of 899 00058489-0206099689 GREGORY W HAGERTY 9968 206TH ST W ACTIVE 22-75852-02-040 617.95$ 50.00$ 148.56$ 816.51$ 00113140-0206099200 RYAN JOHN ROBERT MACLEAN 9920 206TH ST W ACTIVE 22-75852-02-070 599.99$ 50.00$ 144.56$ 794.55$ 00108168-0934098854 MELISSA GEPHART 9885 UPPER 205TH ST W ACTIVE 22-75853-01-080 128.30$ 50.00$ 39.66$ 217.96$ 00111700-0456206018 KIARA MARTILLA 20601 ITALY AVE ACTIVE 22-75854-01-020 542.50$ 50.00$ 131.78$ 724.28$ 00110152-0206097410 ARIANNA SIGUEREDO 9741 206TH ST W ACTIVE 22-75855-02-070 838.81$ 50.00$ 197.68$ 1,086.49$ 00068648-0206096636 BRADLEY GAINOR 9663 206TH ST W ACTIVE 22-75855-02-120 424.42$ 50.00$ 105.52$ 579.94$ 00068967-0206096123 SAMOTH OUK 9612 206TH ST W ACTIVE 22-75855-03-100 794.59$ 50.00$ 187.85$ 1,032.44$ 00107421-0934095850 JOSE RUBIO TELLEZ 9585 UPPER 205TH ST W ACTIVE 22-75856-01-030 226.80$ 50.00$ 61.56$ 338.36$ 00093486-0440206801 KARLA PETERSON 20680 INDIA AVE ACTIVE 22-75856-01-120 554.46$ 50.00$ 134.44$ 738.90$ 00103219-0934095769 MELISSA PFEIFER 9576 UPPER 205TH ST W ACTIVE 22-75856-02-040 99.63$ 50.00$ 33.28$ 182.91$ 00076285-0206095505 RENEE OCHS 9550 206TH ST W ACTIVE 22-75856-03-040 222.03$ 50.00$ 60.50$ 332.53$ 00089932-0440208500 ERIC ZIMMERMAN 20850 INDIA AVE ACTIVE 22-75857-01-040 386.34$ 50.00$ 97.05$ 533.39$ 00072676-0440209102 JOHN WULFF 20910 INDIA AVE ACTIVE 22-75857-02-010 121.23$ 50.00$ 38.08$ 209.31$ 00077420-0209095809 BARB BJUGAN 9580 209TH ST W ACTIVE 22-75857-03-060 557.30$ 50.00$ 135.07$ 742.37$ 00082163-0846177622 MIKA RAVEALA 17762 KETCHIKAN TR ACTIVE 22-75890-02-060 92.43$ 50.00$ 31.68$ 174.11$ 00115855-0847177837 MELISSA PENDINO 17783 KETCHIKAN CT ACTIVE 22-75890-02-110 600.83$ 50.00$ 144.75$ 795.58$ 00112637-0316160809 REBECCA MERKEL 16080 FOLIAGE AVE ACTIVE 22-75900-01-010 186.65$ 50.00$ 52.63$ 289.28$ 00086718-0316161021 LISA BURGESS 16102 FOLIAGE AVE ACTIVE 22-75900-03-020 563.94$ 50.00$ 136.55$ 750.49$ 00054647-0316160965 RICK HOWELL 16096 FOLIAGE AVE ACTIVE 22-75900-03-050 149.86$ 50.00$ 44.45$ 244.31$ 00082140-0316161187 ROBBIN FORTE 16118 FOLIAGE AVE ACTIVE 22-75900-05-030 122.23$ 50.00$ 38.31$ 210.54$ 00110370-0316161146 KAYLA SILVERNESS 16114 FOLIAGE AVE ACTIVE 22-75900-05-050 222.48$ 50.00$ 60.60$ 333.08$ 00117946-0316161286 KEVIN VANDENBERG 16128 FOLIAGE AVE ACTIVE 22-75900-07-010 418.21$ 50.00$ 104.14$ 572.35$ 00112816-0316161443 MARTHA CADENAS 16144 FOLIAGE AVE ACTIVE 22-75900-08-030 952.28$ 50.00$ 222.92$ 1,225.20$ 00116690-0413206606 TAMBRE BUETOW 20660 HOLIDAY AVE ACTIVE 22-76500-01-010 379.29$ 50.00$ 95.48$ 524.77$ 00110347-0413207604 LEEANN ERICKSEN 20760 HOLIDAY AVE ACTIVE 22-76500-02-030 385.19$ 50.00$ 96.79$ 531.98$ 00096441-0170104705 ROBERT HAIDER 10470 170TH ST W ACTIVE 22-76600-02-240 784.96$ 50.00$ 185.70$ 1,020.66$ 00109551-0170104754 KIMBERLY YOUNG 10475 170TH ST W ACTIVE 22-76600-04-160 817.46$ 50.00$ 192.93$ 1,060.39$ 00118399-0629171768 JASMINE KUIPERS 17176 JEFFERSON CT ACTIVE 22-76620-03-050 361.34$ 50.00$ 91.49$ 502.83$ 00119032-0629171651 WESTON MACKINNON 17165 JEFFERSON CT ACTIVE 22-76620-03-090 135.77$ 50.00$ 41.32$ 227.09$ 00095815-0210096564 HEIDI BROOKE 9656 210TH ST W ACTIVE 22-76900-00-020 993.90$ 50.00$ 232.17$ 1,276.07$ 00108641-0809163619 PHILIP HANSON 16361 JATOS CIR ACTIVE 22-77150-02-010 219.05$ 50.00$ 59.84$ 328.89$ 00109871-0809163551 ZACH PARADIS 16355 JATOS CIR ACTIVE 22-77150-02-020 294.83$ 50.00$ 76.69$ 421.52$ 00093841-0809162991 CUONG TRAN 16299 JATOS CIR ACTIVE 22-77151-01-050 882.10$ 50.00$ 207.31$ 1,139.41$ 00090741-0809162876 MELISSA MADISON 16287 JATOS CIR ACTIVE 22-77151-01-080 306.68$ 50.00$ 79.33$ 436.01$ 00090418-0809162678 DEBRA AHLERS 16267 JATOS CIR ACTIVE 22-77151-02-050 156.82$ 50.00$ 46.00$ 252.82$ 00115076-0809162314 MARSA ISRAEIL 16231 JATOS CIR ACTIVE 22-77151-02-140 420.46$ 50.00$ 104.64$ 575.10$ 00112440-0809162231 CHANCE DEGROFF 16223 JATOS CIR ACTIVE 22-77151-02-160 456.69$ 50.00$ 112.69$ 619.38$ 00090350-0819164664 SUSAN PARRANTO 16466 JARRETT CIR ACTIVE 22-77152-01-080 320.68$ 50.00$ 82.44$ 453.12$ 00099135-0819164706 BARBARA GIRTEN 16470 JARRETT CIR ACTIVE 22-77152-01-090 223.23$ 50.00$ 60.77$ 334.00$ 00116808-0819164748 SALLY LEARY 16474 JARRETT CIR ACTIVE 22-77152-01-100 324.14$ 50.00$ 83.21$ 457.35$ 00113192-0818164558 NICOLE MANES 16455 JARREAU CT ACTIVE 22-77152-02-050 227.08$ 50.00$ 61.63$ 338.71$ 00105690-0817163478 JENNI ANDERSON 16347 JAMISON PATH ACTIVE 22-77152-03-140 360.43$ 50.00$ 91.28$ 501.71$ 00082373-0163088000 PAUL G HUGHES 8800 163RD ST W ACTIVE 22-77400-04-010 527.00$ 50.00$ 128.33$ 705.33$ 00101407-0163088885 THOMAS CRAMPTON 8888 163RD ST W ACTIVE 22-77400-04-060 1,030.15$ 50.00$ 240.24$ 1,320.39$ 00094992-0163088356 ROUNG CHEUNG 8835 163RD ST W ACTIVE 22-77400-05-170 265.38$ 50.00$ 70.14$ 385.52$ 00062173-0429161450 MARK PASVOGEL 16145 HURON PATH ACTIVE 22-77400-06-060 423.33$ 50.00$ 105.27$ 578.60$ 00115755-0427161080 JESSE PETERSON 16108 HURON CIR ACTIVE 22-77401-01-060 156.65$ 50.00$ 45.96$ 252.61$ 00107465-0427161122 MIKAEL JOHNSON 16112 HURON CIR ACTIVE 22-77401-01-080 303.60$ 50.00$ 78.64$ 432.24$ 00087737-0426162329 TRACY WORKMAN 16232 HUDSON AVE ACTIVE 22-77401-02-040 514.42$ 50.00$ 125.53$ 689.95$ 00096286-0926096406 DAWN SCHUMACHER 16834 ENFIELD WAY ACTIVE 22-78500-02-020 108.10$ 50.00$ 35.16$ 193.26$ 00095730-0926095746 SANDEEP RACHERVLA 16802 ENFIELD WAY ACTIVE 22-78500-02-060 388.90$ 50.00$ 97.62$ 536.52$ 00095611-0926095431 SREENIVASA REDDY 16955 ENFIELD WAY ACTIVE 22-78500-04-170 497.44$ 50.00$ 121.76$ 669.20$ 00099209-0926098831 DINH TRAN 16553 ENGLISH PATH ACTIVE 22-78501-01-040 352.37$ 50.00$ 89.49$ 491.86$ 00103829-0926105076 CHRIS TIPTON 16510 ENDEAVOR LA ACTIVE 22-78502-02-010 230.82$ 50.00$ 62.46$ 343.28$ 00097314-0926098021 NASRAT NAZARI 16632 ENGLISH PATH ACTIVE 22-78502-03-020 494.51$ 50.00$ 121.10$ 665.61$ 00102028-0926101721 DAVID BENSON 16550 ELM CREEK CT ACTIVE 22-78503-01-120 1,188.92$ 50.00$ 275.55$ 1,514.47$ 00104164-0926106211 UBAH HASSAN 16824 ENCHANTED CT ACTIVE 22-78503-04-110 704.18$ 50.00$ 167.74$ 921.92$ Page 789 of 899 00086828-0737163699 GARY ZIEHR 16369 HOLBROOK AVE ACTIVE 22-81750-02-030 715.75$ 50.00$ 170.31$ 936.06$ 00073304-0737163830 KAO XIONG 16383 HOLBROOK AVE ACTIVE 22-81750-02-050 296.78$ 50.00$ 77.13$ 423.91$ 00102538-0737164911 JASON BAKER 16491 HOLBROOK AVE ACTIVE 22-81750-03-070 1,367.41$ 50.00$ 315.25$ 1,732.66$ 00079902-0737163863 VICTOR TAPIA 16386 HOLBROOK AVE ACTIVE 22-81750-04-030 91.29$ 50.00$ 31.42$ 172.71$ 00104736-0737164341 JENNIFER HAHN 16434 HOLBROOK AVE ACTIVE 22-81750-04-070 712.77$ 50.00$ 169.65$ 932.42$ 00110356-0731164750 JAMAL HASSAN 16475 HILLSIDE CT ACTIVE 22-81750-04-140 2,510.32$ 50.00$ 569.44$ 3,129.76$ 00111232-0767162363 CODY DOLL 16236 HOMINY PATH ACTIVE 22-81750-05-060 128.43$ 50.00$ 39.68$ 218.11$ 00103345-0769161363 KATE KIEHL 16136 HOMINY CT ACTIVE 22-81750-08-100 545.91$ 50.00$ 132.54$ 728.45$ 00104074-0738162757 MOHAMED OMAR 16275 HOLBROOK CT ACTIVE 22-81751-02-020 1,867.57$ 50.00$ 426.49$ 2,344.06$ 00112738-0767162876 LERRENA EVERETT 16287 HOMINY PATH ACTIVE 22-81752-02-020 1,480.50$ 50.00$ 340.40$ 1,870.90$ 00073853-0477200032 SHAWN WILTZ 20003 IDEAL WAY ACTIVE 22-81953-01-010 333.62$ 50.00$ 85.32$ 468.94$ 00087317-0477200297 INSUN WOODS 20029 IDEAL WAY ACTIVE 22-81953-01-100 290.16$ 50.00$ 75.66$ 415.82$ 00116085-0770207106 JOSE T. SANISACA QUITO 20710 HELENA LA ACTIVE 22-82050-03-010 584.94$ 50.00$ 141.22$ 776.16$ 00076687-0770207189 WENDY PETERSON 20718 HELENA LA ACTIVE 22-82050-03-020 135.23$ 50.00$ 41.20$ 226.43$ 00108833-0770207411 SHAFQAT IQBAL 20741 HELENA LA ACTIVE 22-82050-04-030 345.53$ 50.00$ 87.97$ 483.50$ 00079059-0734205808 ROBERT VAUGHAN 20580 HAZELWOOD TR ACTIVE 22-82051-03-030 968.91$ 50.00$ 226.62$ 1,245.53$ 00072682-0770206983 JODY PLUCINAK 20698 HELENA LA ACTIVE 22-82051-04-060 1,351.97$ 50.00$ 311.81$ 1,713.78$ 00111419-0739207023 HOUSTON SPOONER 20702 HARTFORD WAY ACTIVE 22-82051-06-070 129.60$ 50.00$ 39.95$ 219.55$ 00114946-0734206996 TROY FORTE 20699 HAZELWOOD TR ACTIVE 22-82051-06-160 918.33$ 50.00$ 215.37$ 1,183.70$ 00117580-0735205807 PETER THOMAS & ELLEN DEVRIES 20580 HAMPSHIRE WAY ACTIVE 22-82052-01-090 120.74$ 50.00$ 37.97$ 208.71$ 00097449-0735206599 NATHAN HOISINGTON 20659 HAMPSHIRE WAY ACTIVE 22-82052-02-120 176.68$ 50.00$ 50.42$ 277.10$ 00098336-0736207349 KRISTIN NELSON 20734 HAMPSHIRE CIR ACTIVE 22-82052-02-170 185.12$ 50.00$ 52.29$ 287.41$ 00094365-0735206458 JASON FREEMAN 20645 HAMPSHIRE WAY ACTIVE 22-82052-02-460 309.13$ 50.00$ 79.87$ 439.00$ 00101324-0735205674 STEPHANY GORDON 20567 HAMPSHIRE WAY ACTIVE 22-82052-02-810 397.02$ 50.00$ 99.42$ 546.44$ 00098753-0926098416 ANGELIQUE ZIGAN 20508 HARTFORD WAY ACTIVE 22-82053-01-010 90.76$ 50.00$ 31.31$ 172.07$ 00000000-2000000368 CHARLES FAUDREE 7345 183RD ST W ACTIVE 22-82240-01-010 138.97$ 50.00$ 42.03$ 231.00$ 00000000-2000000473 RAHMO NOOR 7265 183RD ST W ACTIVE 22-82240-01-110 255.29$ 50.00$ 67.90$ 373.19$ 00107926-0435166386 OKOKON UDO 16638 IMPERIAL WAY ACTIVE 22-83300-02-040 116.31$ 50.00$ 36.99$ 203.30$ 00093891-0434167625 STEVE RIDDLE 16762 IDES CIR ACTIVE 22-83300-05-030 1,066.25$ 50.00$ 248.27$ 1,364.52$ 00112830-0212093387 KASSAHUN RADY 9338 212TH ST W ACTIVE 22-84100-02-050 177.10$ 50.00$ 50.51$ 277.61$ 00111281-0771212709 FATHI MOHAMUD 21270 INDEPENDENCE AVE ACTIVE 22-84100-02-200 1,014.74$ 50.00$ 236.81$ 1,301.55$ 00110276-0887093332 HECTOR MILLAN ALVARADO 9333 IMBLER TR ACTIVE 22-84100-02-340 126.39$ 50.00$ 39.23$ 215.62$ 00118004-0886212552 JOHN STERLING SORVAAG 21255 ILAVISTA WAY ACTIVE 22-84100-02-470 409.83$ 50.00$ 102.27$ 562.10$ 00109134-0886212271 ALEZAI AKHAPHONG 21227 ILAVISTA WAY ACTIVE 22-84100-02-540 278.93$ 50.00$ 73.16$ 402.09$ 00094890-0782212300 VERONICA AGUILAR-ERICKSON 21230 IDAHO AVE ACTIVE 22-84100-05-020 92.49$ 50.00$ 31.69$ 174.18$ 00107163-0782213571 KEVIN FINCH 21357 IDAHO AVE ACTIVE 22-84100-07-170 409.06$ 50.00$ 102.10$ 561.16$ 00108349-0926111946 BRIAN WENSMANN 17405 EASTWOOD AVE ACTIVE 22-84150-02-140 568.63$ 50.00$ 137.59$ 756.22$ 00078229-0821209671 ANN NELSON 20967 JURY CT ACTIVE 22-84275-01-170 1,676.18$ 50.00$ 383.92$ 2,110.10$ 00087303-0172084002 STEVE JOHNSON 8400 172ND ST W ACTIVE 22-84600-04-050 367.06$ 50.00$ 92.76$ 509.82$ 00115229-0926090801 CARRIE GRACE 18123 KINDRED CT ACTIVE 22-84650-01-020 231.80$ 50.00$ 62.68$ 344.48$ 00104756-0926090771 SERGIO CORDOVA 18091 KINDRED CIR ACTIVE 22-84650-01-170 127.94$ 50.00$ 39.58$ 217.52$ 00101404-0926090931 TAMMY FLYNN 18072 KINDRED CT ACTIVE 22-84650-01-470 253.87$ 50.00$ 67.58$ 371.45$ 00107906-0926089416 NJAGA JALLOW 18086 KINDRED CT ACTIVE 22-84650-01-520 580.44$ 50.00$ 140.22$ 770.66$ 00057311-0512183250 GREG SIEJA 18325 JAMAICA PATH ACTIVE 22-84700-02-070 157.23$ 50.00$ 46.09$ 253.32$ 00083492-0543184004 STEVE WECKMAN 18400 JAVA TR ACTIVE 22-84702-01-080 358.69$ 50.00$ 90.90$ 499.59$ 00112827-0543184590 MATTHEW BISTODEAU 18459 JAVA TR ACTIVE 22-84702-03-020 665.56$ 50.00$ 159.15$ 874.71$ 00107479-0410207516 LAKEVILLE BURGER LLC 20751 HOLYOKE AVE ACTIVE 22-85100-01-041 2,642.13$ 50.00$ 598.76$ 3,290.89$ 00078096-0528181843 JEFFREY BAKER 18184 JACQUARD PATH ACTIVE 22-87500-03-080 82.55$ 50.00$ 29.48$ 162.03$ 00101653-0528182700 ZAHID HAMEED 18270 JACQUARD PATH ACTIVE 22-87500-03-110 459.09$ 50.00$ 113.23$ 622.32$ 00103048-0413208347 NEIL HIRTE 20834 HOLIDAY AVE ACTIVE 22-88300-01-020 509.25$ 50.00$ 124.38$ 683.63$ 00105125-0208085256 CHERYL MYERS 8525 208TH ST W ACTIVE 22-88300-01-061 548.56$ 50.00$ 133.13$ 731.69$ 00059070-0413208552 DANA MCELWAIN 20855 HOLIDAY AVE ACTIVE 22-88300-02-040 315.60$ 50.00$ 81.31$ 446.91$ 00104621-0208085553 TANNER JENSEN 8555 208TH ST W ACTIVE 22-88300-02-050 539.18$ 50.00$ 131.04$ 720.22$ 00068387-0740175795 DAVID STEFONOWICZ 17579 HYACINTH WAY ACTIVE 22-88500-01-080 223.50$ 50.00$ 60.83$ 334.33$ 00107763-0740176496 TONY JOSEPH 17649 HYACINTH WAY ACTIVE 22-88500-03-010 785.58$ 50.00$ 185.84$ 1,021.42$ 00069985-0750175669 MICHAEL BURTON 17566 HYDE PARK AVE ACTIVE 22-88500-04-020 585.74$ 50.00$ 141.40$ 777.14$ 00111986-0750175743 ROBERT HANSON 17574 HYDE PARK AVE ACTIVE 22-88500-04-030 279.86$ 50.00$ 73.36$ 403.22$ Page 790 of 899 00115180-0176086599 MOHAMED BALQIIS A HERSI 8659 176TH ST W ACTIVE 22-88501-02-070 1,329.35$ 50.00$ 306.78$ 1,686.13$ 00109673-0752177200 MOHAMMED NINCHE 17720 HOLLYBROOK TR ACTIVE 22-88501-07-060 453.18$ 50.00$ 111.91$ 615.09$ 00087673-0740176371 JOHN URAM 17637 HYACINTH WAY ACTIVE 22-88502-01-110 101.21$ 50.00$ 33.63$ 184.84$ 00092811-0740176264 ALI, MASLAH 17626 HYACINTH WAY ACTIVE 22-88502-02-020 1,345.05$ 50.00$ 310.27$ 1,705.32$ 00113255-0750177095 GRANT SATHER 17709 HYDE PARK AVE ACTIVE 22-88504-02-070 364.51$ 50.00$ 92.19$ 506.70$ 00073671-0752177994 ADNAN SARWAR 17799 HOLLYBROOK TR ACTIVE 22-88505-01-050 612.63$ 50.00$ 147.38$ 810.01$ 00084136-0752177796 JOHN BRING 17779 HOLLYBROOK TR ACTIVE 22-88505-01-100 316.42$ 50.00$ 81.50$ 447.92$ 00084286-0752177861 RICK SCHWARTZ 17786 HOLLYBROOK TR ACTIVE 22-88505-02-020 1,037.24$ 50.00$ 241.81$ 1,329.05$ 00066712-0752178141 ROYAL JAROS 17814 HOLLYBROOK TR ACTIVE 22-88505-02-070 719.63$ 50.00$ 171.17$ 940.80$ 00117320-0757177072 MICHAEL ZWIRGZDAS 17707 HILLWOOD AVE ACTIVE 22-88507-01-020 125.97$ 50.00$ 39.14$ 215.11$ 00075055-0766177741 ELIAS ELIZONDO 17774 HICKORY TR ACTIVE 22-88507-04-010 817.02$ 50.00$ 192.83$ 1,059.85$ 00087701-0766178020 KRISTIN NELSON 17802 HICKORY TR ACTIVE 22-88508-02-010 478.16$ 50.00$ 117.47$ 645.63$ 00090274-0176086011 ANTHONY MRNAK 8601 176TH ST W ACTIVE 22-88509-01-010 481.49$ 50.00$ 118.21$ 649.70$ 00114767-0311166355 GOMAS VIJAYANATHAN 16635 FLAGSTAFF AVE ACTIVE 22-21176-02-150 95.33$ 50.00$ 32.32$ 177.65$ 00108698-0764201784 MIND OF KLEIN, LLC 20178 HERITAGE DR ACTIVE 22-32025-01-010 215.48$ 50.00$ 59.05$ 324.53$ 00116232-0923088502 TCMLS, LLC 8850 UPPER 209TH ST W ACTIVE 22-44450-04-060 317.19$ 50.00$ 81.67$ 448.86$ 00109777-0902098122 JIMMY SEANG 9812 UPPER 161ST ST W ACTIVE 22-53702-05-170 188.27$ 50.00$ 52.99$ 291.26$ 00115757-0926108616 VICTOR PEREZ GONZALEZ 17989 EQUINOX AVE ACTIVE 22-57101-02-100 2,716.51$ 50.00$ 615.30$ 3,381.81$ 00082914-0413206853 JENNIFER ISRAEL 20685 HOLIDAY AVE ACTIVE 22-66000-01-050 171.40$ 50.00$ 49.24$ 270.64$ 00116322-0413206754 DEREK LARSON 20675 HOLIDAY AVE ACTIVE 22-66000-01-060 456.59$ 50.00$ 112.67$ 619.26$ 00117945-0926097101 JAMES PEDERSON 16483 EAST LAKE DR ACTIVE 22-71300-12-010 216.37$ 50.00$ 59.24$ 325.61$ 00079086-0204112195 SPRINGBROOK CONDOMINIUM ASSOCIATION 11219 204TH ST W ACTIVE 22-71390-05-108 113.54$ 50.00$ 36.37$ 199.91$ 00079086-0204111874 SPRINGBROOK CONDOMINIUM ASSOCIATION 11187 204TH ST W ACTIVE 22-71390-05-204 218.90$ 50.00$ 59.81$ 328.71$ 00079086-0204111791 SPRINGBROOK CONDOMINIUM ASSOCIATION 11179 204TH ST W ACTIVE 22-71390-05-208 91.94$ 50.00$ 31.57$ 173.51$ 00079086-0204111452 SPRINGBROOK CONDOMINIUM ASSOCIATION 11145 204TH ST W ACTIVE 22-71390-05-306 70.60$ 50.00$ 26.82$ 147.42$ 00079086-0204111494 SPRINGBROOK CONDOMINIUM ASSOCIATION 11149 204TH ST W ACTIVE 22-71390-05-308 135.14$ 50.00$ 41.18$ 226.32$ 00079086-0204111510 SPRINGBROOK CONDOMINIUM ASSOCIATION 11151 204TH ST W ACTIVE 22-71390-05-309 158.21$ 50.00$ 46.31$ 254.52$ 00079086-0204111742 SPRINGBROOK CONDOMINIUM ASSOCIATION 11174 204TH ST W ACTIVE 22-71390-05-912 70.60$ 50.00$ 26.82$ 147.42$ 00079086-0926085916 SPRINGBROOK CONDOMINIUM ASSOCIATION 20324 KENSFIELD TR ACTIVE 22-71390-06-503 72.02$ 50.00$ 27.14$ 149.16$ 00079086-0850203629 SPRINGBROOK CONDOMINIUM ASSOCIATION 20362 KENSFIELD TR ACTIVE 22-71390-06-701 192.89$ 50.00$ 54.02$ 296.91$ 00107115-0456206802 BROOKE WERMAGER 20680 ITALY AVE ACTIVE 22-75851-04-010 225.69$ 50.00$ 61.32$ 337.01$ 00101724-0757177148 FEDERAL HOME LOAN MORTGAGE CORP 17714 HILLWOOD AVE ACTIVE 22-88507-02-040 711.78$ 50.00$ 169.43$ 931.21$ 00000000-2000001928 DRP BOOKBINDER MULTISTATE LLC 7483 200TH ST W ACTIVE 22-02200-54-020 61.52$ 50.00$ 24.80$ 136.32$ 00000000-2000001930 DRP BOOKBINDER MULTISTATE LLC 19740 CEDAR AVE ACTIVE 22-02200-52-020 61.52$ 50.00$ 24.80$ 136.32$ 00052875-0616165624 MICHAEL L JACKSON 16562 LINCH PATH ACTIVE 22-44300-00-020 125.68$ 50.00$ 39.07$ 214.75$ 00058440-0205120154 SCOTT CHANDRADAT 12015 205TH ST W ACTIVE 22-02600-25-016 123.68$ 50.00$ 38.63$ 212.31$ 00058772-0215104305 JEFFREY ANHALT 10430 215TH ST W ACTIVE 22-03100-51-013 123.68$ 50.00$ 38.63$ 212.31$ 00063002-0185122402 STEVEN BLOOM 12240 185TH ST W ACTIVE 22-01400-77-014 61.52$ 50.00$ 24.80$ 136.32$ 00063006-0190082294 BJORN VOGEN 8229 190TH ST W ACTIVE 22-01600-60-010 123.68$ 50.00$ 38.63$ 212.31$ 00063093-0215092054 FRANK BEISSEL 9205 215TH ST W ACTIVE 22-15200-01-090 61.52$ 50.00$ 24.80$ 136.32$ 00063218-0532198014 GENE RECHTZIGEL 19799 JUNO TR ACTIVE 22-02400-77-010 123.68$ 50.00$ 38.63$ 212.31$ 00063230-0557118251 GEORGE THALER 11825 KNOLLS PATH ACTIVE 22-13600-00-180 61.52$ 50.00$ 24.80$ 136.32$ 00063736-0532197990 FRANK RECHTZIGEL 19799 JUNO TRL W ACTIVE 22-02400-77-010 123.68$ 50.00$ 38.63$ 212.31$ 00067915-0162123357 LISA RYAN 12335 162ND ST W ACTIVE 22-13600-00-110 62.52$ 50.00$ 25.03$ 137.55$ 00074271-0456181806 JULIA ZHOU 18180 ITALY AVE ACTIVE 22-73000-00-120 57.68$ 50.00$ 23.95$ 131.63$ 00076234-0200079538 JON E DEVARY 7953 200TH ST W ACTIVE 22-02100-76-014 123.68$ 50.00$ 38.63$ 212.31$ 00095227-0456184230 WARREN MOE 18423 ITALY AVE ACTIVE 22-73000-00-270 64.52$ 50.00$ 25.47$ 139.99$ 00098358-0215092450 KELVIN BORCHARDT 9245 215TH ST W ACTIVE 22-15200-01-110 123.68$ 50.00$ 38.63$ 212.31$ 00102573-0215092856 ROBERT C CARTER 9285 215TH ST W ACTIVE 22-15200-01-130 123.68$ 50.00$ 38.63$ 212.31$ 00109763-0569161729 CHRISTOPHER KULUS 16172 KEYSTONE CT ACTIVE 22-30700-01-050 123.68$ 50.00$ 38.63$ 212.31$ 00110053-0195115560 CAROL FILLMORE 11556 195TH ST W ACTIVE 22-02300-75-012 61.52$ 50.00$ 24.80$ 136.32$ 00110552-0531163704 CHANTEL PETERSON 16370 JUDICIAL RD ACTIVE 22-13600-00-460 123.68$ 50.00$ 38.63$ 212.31$ 00115198-0163124057 BRYCE HANSON 12405 163RD ST W ACTIVE 22-13600-00-300 61.52$ 50.00$ 24.80$ 136.32$ 00115753-0613209409 BRIAN HAAN 20940 LAREDO PATH ACTIVE 22-84200-01-070 61.52$ 50.00$ 24.80$ 136.32$ 00116570-0162119801 BRANDON MEYER 11980 162ND ST W ACTIVE 22-13600-00-372 123.84$ 50.00$ 38.66$ 212.50$ 00115115-0926085196 TERESA HOGAN 17212 EMBERS AVE ACTIVE 22-18103-05-506 164.85$ 51.00$ 48.01$ 263.86$ 00105116-0388161016 BRANDEN QUEEN 16101 HARMONY PATH ACTIVE 22-32905-04-030 345.14$ 52.00$ 88.33$ 485.47$ Page 791 of 899 00089803-0926086336 KRIS LARSON 20607 KEYSTONE AVE ACTIVE 22-48801-01-010 401.90$ 53.00$ 101.17$ 556.07$ 00117681-0163122408 DAVID STALSBERG 12240 163RD ST W ACTIVE 22-13600-00-350 61.52$ 50.00$ 24.80$ 136.32$ 00104397-0245170416 VICKY TAYLOR 17041 EMBERS AVE FINAL 22-18102-07-403 36.77$ 50.00$ 19.30$ 106.07$ 00116617-0926124001 BRITNEE FISHER 16470 JAFFNA PL FINAL 22-18670-01-480 82.76$ 50.00$ 29.53$ 162.29$ 00097932-0173064136 BRYAN HERRON 6413 173RD ST W FINAL 22-20876-02-060 35.90$ 50.00$ 19.11$ 105.01$ 00052944-0167072178 PETER M LAING 7217 167TH CT W FINAL 22-21101-04-370 46.18$ 50.00$ 21.39$ 117.57$ 00119297-0161060757 ROBERT BLOCH 6075 161ST ST W FINAL 22-21177-14-210 320.95$ 50.00$ 82.50$ 453.45$ 00113110-0161062704 PETER DENG 6270 161ST ST W FINAL 22-21177-17-020 36.74$ 50.00$ 19.29$ 106.03$ 00103475-0507174546 BRANDON ULMEN 17454 JAVA CT N FINAL 22-27500-02-240 95.41$ 50.00$ 32.34$ 177.75$ 00091940-0742212259 CHAD BODE 21225 HYACINTH AVE FINAL 22-30800-02-020 277.31$ 50.00$ 72.80$ 400.11$ 00114151-0764200604 JOSH LINDQUIST 20060 HERITAGE DR FINAL 22-32175-04-280 99.62$ 50.00$ 33.28$ 182.90$ 00057197-0484172701 NATALIE CURWICK 17270 IDLEWOOD WAY FINAL 22-33302-03-060 95.59$ 50.00$ 32.38$ 177.97$ 00114820-0741174771 JASON CANNON 17477 HYACINTH CT FINAL 22-33312-02-050 91.91$ 50.00$ 31.56$ 173.47$ 00118891-0430163545 WANG WU 16354 HYLAND AVE FINAL 22-34600-01-030 67.57$ 50.00$ 26.15$ 143.72$ 00111535-0926117076 GONFA KEBEDE 5710 UPPER 179TH ST W FINAL 22-42275-04-310 120.13$ 50.00$ 37.84$ 207.97$ 00117755-0926117076 GONFA KEBEDE 5710 UPPER 179TH ST W FINAL 22-42275-04-310 83.09$ 50.00$ 29.60$ 162.69$ 00108367-0805205653 DANIEL DOLSKY 20565 JURA TR FINAL 22-44201-02-050 50.03$ 50.00$ 22.25$ 122.28$ 00058060-0168120721 RP RENTALS LLC 12072 168TH ST W FINAL 22-44500-02-010 60.95$ 50.00$ 24.68$ 135.63$ 00112344-0571205580 KONNIE GUETSCHOFF 20558 KEYSTONE AVE FINAL 22-48800-02-140 73.66$ 50.00$ 27.50$ 151.16$ 00116054-0529161840 MITCH BRUNETTE 16184 JAMAICA AVE FINAL 22-53702-05-011 104.17$ 50.00$ 34.29$ 188.46$ 00000000-2000000569 AMY CLARK 9812 UPPER 161ST ST W FINAL 22-53702-05-170 239.39$ 50.00$ 64.36$ 353.75$ 00069818-0902098106 AMY CLARK 9810 UPPER 161ST ST W FINAL 22-53702-05-170 56.07$ 50.00$ 23.59$ 129.66$ 00110896-0926088771 JOHN REYNOLDS 18420 LAFAYETTE WAY FINAL 22-58507-06-428 224.02$ 50.00$ 60.95$ 334.97$ 00099752-0926100961 RYAN SULLIVAN 17967 HYDE PARK AVE FINAL 22-64700-02-050 23.57$ 50.00$ 16.36$ 89.93$ 00116615-0926126901 JACKSON WIETECHA 5017 161ST ST W FINAL 22-71345-01-050 33.54$ 50.00$ 18.58$ 102.12$ 00113414-0926120561 ANDREAS CAN 16165 DUVANE WAY FINAL 22-71347-01-060 54.79$ 50.00$ 23.31$ 128.10$ 00100960-0926105831 AMERICAN ACQUISITIONS INC 7958 210TH ST W FINAL 22-71400-01-100 38.89$ 50.00$ 19.77$ 108.66$ 00107504-0316161302 CHARLES COMMERFORD 16130 FOLIAGE AVE FINAL 22-75900-07-020 122.54$ 50.00$ 38.37$ 210.91$ 00101804-0926102751 DENISE TATE 16800 ENCHANTED CT FINAL 22-78503-04-130 12.68$ 50.00$ 13.94$ 76.62$ 00000000-2000000718 BRADLEY KITTLESON 20621 HAMPSHIRE WAY FINAL 22-82052-02-560 28.58$ 50.00$ 17.48$ 96.06$ Total 767,629.55$ 78,206.00$ 188,123.03$ 1,033,958.58$ Page 792 of 899 PID #INVOICE DATES SERVICE NAME SERVICE ADDRESS INSPECTION FEE(S) ADMIN FEE TOTAL FEES INTEREST THRU 2026 TOTAL AMOUNT TO BE CERTIFIED 22-64607-04-140 05/01/2025 NICOLE WILLIAMSON 10340 166TH ST W $100.00 $50.00 $150.00 $33.36 $183.36 22-21170-03-090 11/25/2024 JOHN P BRUEHLING 16201 GLADIOLA AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-41685-01-021 04/10/2025 TMSC OF LAKEVILLE LLC 16258 KENYON AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-21177-03-130 10/30/2024 PETER N RALSTON 16330 FLAGSTAFF AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-21177-10-150 02/04/2025 AIMEE LOUISE PETER 16343 FANTASIA AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-32903-01-050 04/09/2025 LESLEY J & SONIA A WACHENDORF 16390 HARVARD DR $100.00 $50.00 $150.00 $33.36 $183.36 22-71314-01-070 01/08/2025 BRADLEY J POGALZ 16561 DULUTH TRL $100.00 $50.00 $150.00 $33.36 $183.36 22-21173-01-190 05/05/2025 MICHAEL W THOMAS 16586 FLORIN AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-21100-06-210 02/05/2025 CHILTON V TSTE VORHIS 16665 GERDINE PATH $100.00 $50.00 $150.00 $33.36 $183.36 22-21172-09-170 01/09/2025 RAYMOND J TUTEWOHL 16685 FOLIAGE AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-64601-04-200 03/25/2025 KAO & MAI H THOR XIONG 16767 JOPLIN WAY $100.00 $50.00 $150.00 $33.36 $183.36 22-27600-05-070 03/04/2025 KEITH M JOHNSON 16855 GREENLAND PATH $100.00 $50.00 $150.00 $33.36 $183.36 22-59500-02-050 01/24/2025 BONNIE M MECHURA 17091 FAIRHILL AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-17201-02-030 05/29/2025 STEVEN & DANA SNYDER 18756 HUXLEY AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-02900-09-010 05/21/2025 JERRY LEE TSTE TONGEN 20275 HOLYOKE AVE $100.00 $50.00 $150.00 $33.36 $183.36 22-21101-04-210 05/13/2025 JULIO MANDUJANO PEREZ 7095 168TH ST W $100.00 $50.00 $150.00 $33.36 $183.36 22-16700-01-150 05/20/2025 TERRY R CUSHMAN 7465 170TH ST W $100.00 $50.00 $150.00 $33.36 $183.36 22-17100-05-060 02/03/2025 LAURIE A SANDO 7952 174TH ST W $100.00 $50.00 $150.00 $33.36 $183.36 22-88300-02-050 05/07/2025 TANNER JENSEN 8555 208TH ST W $100.00 $50.00 $150.00 $33.36 $183.36 $1,900.00 $950.00 $2,850.00 $633.84 $3,483.84 CITY OF LAKEVILLE ASSESSMENT SUMMARY - NUISANCE ABATEMENT OCTOBER 6, 2025 EXHIBIT B Page 793 of 899 PID #INVOICE DATE SERVICE NAME SERVICE ADDRESS ALARM CHARGE LATE FEES INVOICE TOTAL ADMIN FEE TOTAL FEES INTEREST THRU 2026 TOTAL AMOUNT TO BE CERTIFIED 224434301010 12/31/2024 ALDI #107 FAR 11542 207TH ST W 35.00$ 2.12$ 37.12$ 50.00$ 87.12$ 19.38$ 106.50$ 221188601010 1/30/2025 & 7/21/2025 BMO HARRIS BANK NA 17636 KENWOOD TRL 120.00$ 1.59$ 121.59$ 50.00$ 171.59$ 38.16$ 209.75$ 227139701010 5/16/2025 SPRINGS AT LAKEVILLE 17400 GLACIER WAY 35.00$ 0.53$ 35.53$ 50.00$ 85.53$ 19.02$ 104.55$ 224168501011 3/5/2025 & 3/30/2025 TMSC OF LAKEVILLE II, LLC 16254 KENYON AVE 70.00$ 3.18$ 73.18$ 50.00$ 123.18$ 27.40$ 150.58$ 260.00$ 7.42$ 267.42$ 200.00$ 467.42$ 103.96$ 571.38$ CITY OF LAKEVILLE ASSESSMENT SUMMARY - FALSE ALARMS OCTOBER 6, 2025 EXHIBIT C Page 794 of 899 PID #INVOICE DATES SERVICE NAME SERVICE ADDRESS CHARGE INVOICE LATE FEES TOTAL ADMIN FEE TOTAL FEES TOTAL AMOUNT TO BE CERTIFIED TERM 225350101070 4/21/2025 Elizabeth Eleanor Malecha 17900 Jacquard Path $950.00 $28.50 $978.50 $50.00 $1,028.50 $1,028.50 3 years 222085004050 4/1/2025 Roger Rios & Heidi Westrum 17124 Gage Ave $1,200.00 $54.00 $1,254.00 $50.00 $1,304.00 $1,304.00 3 years 226750102020 4/23/2025 Jeremy Rodahl 17012 Glenwood Ave $1,500.00 $22.50 $1,522.50 $50.00 $1,572.50 $1,572.50 3 years 221450004120 5/29/2025 Melissa L & Dylan W Kounce 16145 Inglewood Dr $950.00 $14.25 $964.25 $50.00 $1,014.25 $1,014.25 3 years $4,600.00 $119.25 $4,719.25 $200.00 $4,919.25 $4,919.25 CITY OF LAKEVILLE ASSESSMENT SUMMARY- TREE REMOVAL CHARGES OCTOBER 6, 2025 EXHIBIT D Page 795 of 899 Date: 10/6/2025 Chart House Conditional Use Permit Amendment and Variance Proposed Action Staff recommends adoption of the following motion: Move to approve: 1) conditional use permit amendment to exceed 25% impervious surface and the findings of fact and 2) variance from the minimum setback requirement from Kingsley Lake and the findings of fact for 11287 Klamath Trail Overview George Maverick, owner of the Chart House restaurant and banquet facility, is proposing to demolish the existing detached bar building and construct a new 2,660 square foot structure. The new building requires a variance from the minimum setback requirements from Kingsley Lake and a conditional use permit (CUP) amendment to exceed 25% impervious surface, while remaining below the 50% maximum allowed on a natural environment lake. A CUP was approved in 1997 to exceed the 25% impervious surface area. The plans have been reviewed by Community Development, Environmental Resources, and Engineering as well as the DNR. A stormwater maintenance agreement is required to address stormwater treatment facilities. This requirement ensures that these improvements will be constructed to the satisfaction of the City. The Planning Commission held a public hearing on September 18, 2025, to consider the requests and no public comments were received. The Planning Commission unanimously recommended approval of the conditional use permit and variance subject to the stipulations in the resolutions. Supporting Information 1. CUP and Variance Forms and Findings 2. Stormwater Maintenance Agreement 3. PC Minutes - Draft 4. Chart House Planning and Engineering Report 9-9-25 5. Exhibits Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Diversified Economic Development Report Completed by: Heather Botten, Senior Planner Page 796 of 899 1 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA CONDITIONAL USE PERMIT AMENDMENT NO. 25-_____ 1. Permit. Subject to the terms and conditions set forth herein, the City of Lakeville hereby approves a Conditional Use Permit Amendment for Chart House to allow impervious surface greater than 25% but less than 50% on the property located at 11287 Klamath Trail: 2. Property. The permit is for the following described property in the City of Lakeville, Dakota County, Minnesota: That part of the South Half of the Southwest Quarter of Section 1, Township 114, Range 21, Dakota County, Minnesota, lying north of the centerline of Dakota County Road No. 44 according to Dakota County Road Right of Way Map No. 86 (A.K.A. Klamath Trail, A.K.A. 169th Street West, A.K.A. Orchard Lake Road) and lying westerly of a line described as commencing at the northeast corner of said South Half of the Southwest Quarter of Section 1; thence on an assumed bearing of South 89 degrees 42 minutes 15 seconds West, along the north line of said South Half of the Southwest Quarter of Section 1, a distance of 1,070.52 feet to the point of beginning of said line to be described; thence South 30 degrees 54 minutes 53 seconds West a distance of 809.52 feet; thence South 22 degrees 19 minutes 01 seconds East a distance of 396.98 feet to the centerline of said County Road No. 44 and said line there terminating. 3. Conditions. This conditional use permit is issued subject to the following conditions: Page 797 of 899 2 a. The site shall be developed in substantial conformance with plan set on file with the Community Development Department except as may be modified by the conditions below. b. The City Code Enforcement Officer, or other designee, shall be granted right of access to the property at all reasonable times to ensure compliance with the conditions of this permit. c. A stormwater maintenance agreement is required to address site improvements and stormwater treatment facilities. d. The developer shall meet the conditions outlined in the City Engineering review memo dated September 9, 2025 and any subsequent correspondence. e. Final site, grading, stormwater management, and erosion control plans shall be approved by the City Engineer. f. Resolution No. 97-18 shall become null and void and shall be replaced by the terms of this Conditional Use Permit. 4. Revocation. The City may revoke the conditional use permit for cause upon determination that the conditional use permit is not in conformance with the conditions of the permit or is in continued violation of the city code or other applicable regulations. 5. Expiration. This conditional use permit shall expire unless the applicant commences the authorized use within one year of the date of this conditional use permit unless an extension is approved by the Zoning Administrator. DATED: October 6, 2025 CITY OF LAKEVILLE BY: _____________________________ Luke M. Hellier, Mayor SEAL BY: _____________________________ Ann Orlofsky, City Clerk Page 798 of 899 3 STATE OF MINNESOTA ) ( COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this 6th day of October 2025 by Luke M. Hellier, Mayor and by Ann Orlofsky, City Clerk of the City of Lakeville, a Minnesota municipal corporation, on behalf of the corporation. ____________________________ Notary Public DRAFTED BY: City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Page 799 of 899 1 CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA CONDITIONAL USE PERMIT AMENDMENT CHART HOUSE – 11287 KLAMATH TRAIL FINDINGS OF FACT DECISION On September 18, 2025 the Lakeville Planning Commission met at their regularly scheduled meeting to consider the request of George Maverick – Chart House for a conditional use permit amendment to exceed 25% impervious surface in the shoreland overlay district at 11287 Klamath Trail. The Planning Commission conducted a public hearing on the proposed conditional use permit preceded by published and mailed notice. The applicant was present and the Planning Commission heard testimony from all interested persons wishing to speak. The City Council hereby adopts the following: FINDINGS OF FACT 1. The property is located in Comprehensive Planning District 1, which guides the property for Commercial. 2. The subject site is zoned C-3, General Commercial. 3. Legal description of the property is: That part of the South Half of the Southwest Quarter of Section 1, Township 114, Range 21, Dakota County, Minnesota, lying north of the centerline of Dakota County Road No. 44 according to Dakota County Road Right of Way Map No. 86 (A.K.A. Klamath Trail, A.K.A. 169th Street West, A.K.A. Orchard Lake Road) and lying westerly of a line described as commencing at the northeast corner of said South Half of the Southwest Quarter of Section 1; thence on an assumed bearing of South 89 degrees 42 minutes 15 seconds West, along the north line of said South Half of the Southwest Quarter of Section 1, a distance of 1,070.52 feet to the point of beginning of said line to be described; thence South 30 degrees 54 minutes 53 seconds West a distance of 809.52 feet; thence South 22 degrees 19 minutes 01 seconds East a distance of 396.98 feet to the centerline of said County Road No. 44 and said line there terminating. Page 800 of 899 2 4. Section 11-4-3E of the City of Lakeville Zoning Ordinance provides that a conditional use permit may not be issued unless certain criteria are satisfied. The criteria and our findings regarding them are: a) The proposed action has been considered in relation to the specific policies and provisions of and has been found to be consistent with the Official City Comprehensive Plan. Finding: The proposed expansion to the restaurant is consistent with the policies and provisions of Planning District 1 of the 2040 Comprehensive Land Use Plan. b) The proposed use is or will be compatible with future land uses of the area. Finding: The proposed use is compatible with surrounding uses provided compliance with the stipulations of the conditional use permit. c) The proposed use conforms with all performance standards contained in the Zoning Ordinance and the City Code. Finding: The proposed building conforms to the performance standards set forth in the Zoning Ordinance given compliance with the stipulations of the conditional use permit. d) The proposed use can be accommodated with existing public services and will not overburden the City’s service capacity. Finding: The proposed site improvements will not overburden the City’s sanitary sewer and water systems and can be served with existing public services. e) Traffic generation by the proposed use is within capabilities of streets serving the property. Finding: Traffic generation from the commercial use can be accommodated with the existing streets serving the property. 5. The report dated September 9, 2025, prepared by Heather Botten, Senior Planner is incorporated herein. DECISION The City Council approves the conditional use permit in the form attached hereto. DATED: October 6, 2025 CITY OF LAKEVILLE BY: ________________________ Page 801 of 899 3 Luke M. Hellier, Mayor SEAL BY: ________________________ Ann Orlofsky, City Clerk Page 802 of 899 1 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA VARIANCE NO. 25- ___ 1. Permit. Subject to the terms and conditions set forth herein, the City of Lakeville grants a variance to allow a setback less than the 150-foot required from the ordinary high-water level of Kingsley Lake; 2. Property. The variance is for the following described property in the City of Lakeville, Dakota County, Minnesota: That part of the South Half of the Southwest Quarter of Section 1, Township 114, Range 21, Dakota County, Minnesota, lying north of the centerline of Dakota County Road No. 44 according to Dakota County Road Right of Way Map No. 86 (A.K.A. Klamath Trail, A.K.A. 169th Street West, A.K.A. Orchard Lake Road) and lying westerly of a line described as commencing at the northeast corner of said South Half of the Southwest Quarter of Section 1; thence on an assumed bearing of South 89 degrees 42 minutes 15 seconds West, along the north line of said South Half of the Southwest Quarter of Section 1, a distance of 1,070.52 feet to the point of beginning of said line to be described; thence South 30 degrees 54 minutes 53 seconds West a distance of 809.52 feet; thence South 22 degrees 19 minutes 01 seconds East a distance of 396.98 feet to the centerline of said County Road No. 44 and said line there terminating. Page 803 of 899 2 3. Conditions. This variance is issued subject to the following conditions: a. The site shall be developed in substantial conformance with plan set on file with the Community Development Department except as may be modified by the conditions below. b. The City Code Enforcement Officer, or other designee, shall be granted right of access to the property at all reasonable times to ensure compliance with the conditions of this permit. c. A stormwater maintenance agreement is required to address site improvements and stormwater treatment facilities. d. The developer shall meet the conditions outlined in the City Engineering and Planning memos dated September 9, 2025 and any subsequent correspondence. e. Final site, grading, stormwater management, and erosion control plans shall be approved by the City Engineer. The City Clerk is directed to file a certified copy of this resolution with the Dakota County Recorder. Dated: October 6, 2025 CITY OF LAKEVILLE BY: ________________________ Luke M. Hellier, Mayor SEAL BY: ________________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) ( COUNTY OF DAKOTA ) Page 804 of 899 3 The foregoing instrument was acknowledged before me this 6thday of October 2025, by Luke M. Hellier, Mayor and by Ann Orlofsky, City Clerk of the City of Lakeville, a Minnesota municipal corporation, on behalf of the corporation. _______________________ Notary Public Drafted by: City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Page 805 of 899 1 CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA VARIANCE CHART HOUSE – 11287 KLAMATH TRAIL FINDINGS OF FACT DECISION The Lakeville Planning Commission met at its regularly scheduled meeting on September 18, 2025 to consider the application of George Maverick – Chart House for a variance to allow a reduced setback from the ordinary high-water level at 11287 Klamath Trail. The Planning Commission conducted a public hearing on the variance application preceded by published and mailed notice. The applicant was present, and the Planning Commission heard testimony from all interested persons wishing to speak. The City Council hereby adopts the following: FINDINGS OF FACT 1. The property is located in Comprehensive Planning District 1, which guides the property for Commercial. 2. The subject site is zoned C-3, General Commercial. 3. Legal description of the property is: That part of the South Half of the Southwest Quarter of Section 1, Township 114, Range 21, Dakota County, Minnesota, lying north of the centerline of Dakota County Road No. 44 according to Dakota County Road Right of Way Map No. 86 (A.K.A. Klamath Trail, A.K.A. 169th Street West, A.K.A. Orchard Lake Road) and lying westerly of a line described as commencing at the northeast corner of said South Half of the Southwest Quarter of Section 1; thence on an assumed bearing of South 89 degrees 42 minutes 15 seconds West, along the north line of said South Half of the Southwest Quarter of Section 1, a distance of 1,070.52 feet to the point of beginning of said line to be described; thence South 30 degrees 54 minutes 53 seconds West a distance of 809.52 feet; thence South 22 degrees 19 minutes 01 seconds East a distance of 396.98 feet to the centerline of said County Road No. 44 and said line there terminating. Page 806 of 899 2 4. Chapter 6 of the City of Lakeville Zoning Ordinance provides that a variance shall not be approved unless failure to grant the variance will result in practical difficulties. The criteria and our findings regarding them are: a. That the variance would be consistent with the comprehensive plan. Finding: The proposed building is consistent with the policies and provisions of Planning District 1 of the 2040 Comprehensive Land Use Plan. b. That the variance would be in harmony with the general purposes and intent of this Title. Finding: The property is a legal non-conforming site. The proposed location of the building is in the most reasonable location on the property therefore is in harmony with the general purposes and intent of this title. c. That the plight of the landowner is due to circumstances unique to the property not created by the landowner. Finding: The site is legal non-conforming with the site originally developed prior to the existence of a shoreland ordinance. Setbacks from a natural environment lake are not able to be met. The proposed building does comply with the minimum setbacks for a recreational development lake. d. That the purpose of the variance is not exclusively economic considerations. Finding: The request is to improve and extend the seasonal use and protection from weather conditions for both restaurant and banquet patrons. e. That the granting of the variance will not alter the essential character of the neighborhood in which the parcel of land is located. Finding: The proposed building is compatible with the commercial restaurant/banquet use of the property and therefore will not alter the essential character of the neighborhood. f. That the requested variance is the minimum action required to eliminate the practical difficulty. Finding: The proposed location of the building is the most reasonable location with the least amount of environmental impacts. The property improvements will improve stormwater treatment on the property by installing a raingarden that treats more impervious area than the additional size of the structure. g. Variances may not be approved for any use that is not allowed under this section for property in the zone where the affected person’s land is located. Finding: Not applicable; a restaurant is a permitted use in the C-3, General Commercial zoning district. Page 807 of 899 3 5. The report dated September 9, 2025, prepared by Heather Botten, Senior Planner is incorporated herein. DECISION The City Council approves the variance in the form attached. DATED: October 6, 2025 CITY OF LAKEVILLE BY: __________________________ Luke M. Hellier, Mayor BY: __________________________ Ann Orlofsky, City Clerk Page 808 of 899 1 237355v2 STORMWATER MAINTENANCE AGREEMENT/ BEST MANAGEMENT PRACTICE FACILITIES AND LICENSE AGREEMENT THIS AGREEMENT is made and entered into as of the ______ day of _____________, 2025, by and between ROSE MOUNTAIN LLC, a Minnesota limited liability company, (the “Owner”) and the CITY OF LAKEVILLE, a Minnesota municipal corporation (the “City”). A. The Owner is the owner of certain real property located in Dakota County, Minnesota legally described in Exhibit A attached hereto ("Property"); and B. The Owner is proceeding to develop the Property, and has requested approval of the site plan for the proposed development; and C. The final site plans for the Property, hereinafter called the "Plans", which are expressly made a part hereof, as approved or to be approved by the City, provides for detention/retention of stormwater within the confines of the Property; and D. The City and the Owner agree that the health, safety, and welfare of the residents of the City of Lakeville, Minnesota, require that on-site stormwater management/BMP facilities be constructed and maintained on the Property; and E. The City requires that on-site stormwater management/BMP facilities (“Stormwater Facilities”) as shown on the Plans be constructed and adequately maintained by the Owner as a condition of final site plan approval; and F. As a condition of conditional use permit and variance approval the Owner is required to enter into this Agreement and grant to the City an easement for access, drainage and utility over portions of the Property (the “Easement Areas”) legally described and depicted on Exhibit B attached hereto to comply with work required under the terms of this Agreement. NOW, THEREFORE, in consideration of mutual covenants of the parties set forth herein and other valuable consideration, the receipt and sufficiency of which are hereby acknowledged, the parties agree as follows: Page 809 of 899 2 237355v2 1. Construction of Stormwater Improvements. Owner shall construct the Stormwater Facilities in accordance with the plans and specifications identified in the Plans. 2. Maintenance of Stormwater Improvements. A. The Owner shall adequately maintain the Stormwater Facilities in accordance with the Stormwater Maintenance Plan and the City engineering standards for stormwater treatment facilities attached hereto as Exhibit C. This includes all pipes, channels, and other conveyances built to convey stormwater to the facility, as well as all structures, improvements, and vegetation provided to control the quantity and quality of the stormwater. Adequate maintenance is herein defined as good working condition so that these facilities are performing their design functions. B. The Owner will perform the work necessary to keep these Stormwater Facilities in good working order as appropriate. In the event a maintenance schedule for the Stormwater Facilities (including sediment removal) is outlined on the approved plans, the schedule will be followed and comply with all federal, state, and local regulations relating to the disposal of material. 3. Inspection and Reporting. The Owner shall cause the Stormwater Facilities to be inspected and submit an inspection report annually and shall be responsible for the payment of any associated costs. The purpose of the inspection is to assure safe and proper functioning of the facilities. The inspection shall cover the entire facilities, berms, outlet structure, pond areas, access roads, buffers, etc. Deficiencies shall be noted in the inspection report. A storage treatment basin will be considered inadequate if it is not compliant with all requirements of the approved Plan and City engineering standards set forth in Exhibit C. 4. City Access and Maintenance Rights. A. The Owner hereby grants the City a license, its authorized agents and employees, to enter upon the Property and to inspect the stormwater management/BMP facilities whenever the City deems necessary. The City shall provide the Owner, its successors and assigns, copies of the inspection findings and a directive to commence with the repairs if necessary (“Inspection Report”). B. In the event the Owner, its successors and assigns, fails to maintain the Stormwater Facilities in good working condition acceptable to the City and such failure continues for 60 days after the City gives the Owner written notice of such failure, the City may enter upon the Property and take whatever steps necessary, including excavation and the storage of materials and equipment, to correct deficiencies identified in the Inspection Report. The City's notice shall specifically state which maintenance tasks are to be performed. The City may charge the costs, including assessing the City’s costs to the Owner’s property taxes of such repairs, to the Owner, its successors and assigns. This provision shall not be construed to allow the City to erect any structure of permanent nature on the land of the Owner outside of the Easement Area for the Stormwater Facilities. It is expressly understood and agreed that the City is under no obligation to routinely maintain or repair said Stormwater Facilities, and in no event shall this Agreement be construed to impose any such obligation on the City. In addition, Owner agrees that it is, and will be, solely responsible to address complaints and legal claims brought by any third party with regard Page 810 of 899 3 237355v2 to the maintenance and operation and the consequences there from the Stormwater Facilities. The Owner expressly agrees to defend and hold the City harmless from any such third-party claim. 5. Grant of Easement. Owner hereby grants to the City, its successors and assigns, a permanent non-exclusive easement for access to the Stormwater Facilities over, on and across the Property and for the purpose of accessing and maintaining the Stormwater Facilities pursuant to the terms of this Agreement over, on, across, under and through the Easement Area. The easement shall include the rights, but not the obligation, of the City, its contractors, agents, servants, and assigns, to enter upon the Easement to construct, reconstruct, inspect, repair, and maintain said private Stormwater Facilities together with the right to grade, level, fill, drain, pave, and excavate the Easement Area, and the further right to remove trees, bushes, undergrowth, and other obstructions interfering with the location, construction, and maintenance of said private Stormwater Facilities systems. 6. Reimbursement of Costs. The Owner agrees to reimburse the City for all costs incurred by the City in the enforcement of this Agreement, or any portion thereof, including court costs and reasonable attorneys' fees. 7. Indemnification. This Agreement imposes no liability of any kind whatsoever on the City. The Owner hereby agrees to indemnify and hold harmless the City and its agents and employees against any and all claims, demands, losses, damages, and expenses (including reasonable attorneys' fees) arising out of or resulting from the Owner or the Owner’s agents or employee's negligent or intentional acts, or any violation of any safety law, regulation or code in the performance of this Agreement, without regard to any inspection or review made or not made by the City, its agents or employees or failure by the City, its agents or employees to take any other prudent precautions. In the event the City, upon the failure of the Owner to comply with any conditions of this Agreement, performs said conditions pursuant to its authority in this Agreement, the Owner shall indemnify and hold harmless the City, its employees, agents and representatives for its own negligent acts in the performance of the Owner’s required work under this Agreement, but this indemnification shall not extend to intentional or grossly negligent acts. 8. Notice. All notices required under this Agreement shall either be personally delivered or be sent by certified or registered mail and addressed as follows: To the Owner: Rose Mountain LLC 12790 Dodd Boulevard Rosemount, MN 55068 To the City: City of Lakeville 20195 Holyoke Avenue Lakeville, Minnesota 55044 Attn: City Administrator or to such other party at such other address as such party, by ten (10) days prior written notice given as provided, shall designate. All notices given hereunder shall be deemed given when personally delivered or two business days after being placed in the mail properly addressed as provided herein. Page 811 of 899 4 237355v2 9. Successors/Covenants Run with Property. All duties and obligations of Owner under this Agreement shall also be duties and obligations of Owner’s successors and assigns. The terms and conditions of this Agreement shall run with the Property. [Remainder of page is intentionally left blank. Signature pages follow.] Page 812 of 899 5 237355v2 OWNER: ROSE MOUNTAIN LLC By: ____ ___________________________ [print name] Its: STATE OF ______________ ) )ss. COUNTY OF ____________ ) The foregoing instrument was acknowledged before me this ___________________ day of ___________________________, 2025, by ___________________________________________, the ______________________________ of ROSE MOUNTAIN LLC, a Minnesota limited liability corporation, on behalf of said entity. ___________________________________ Notary Public DRAFTED BY: CAMPBELL, KNUTSON Professional Association Grand Oak Office Center I 860 Blue Gentian Road, Suite 290 Eagan, MN 55121 Telephone: 651-452-5000 AMP/ais Page 813 of 899 6 237355v2 CITY OF LAKEVILLE By: Luke M. Hellier, Mayor (SEAL) And: Ann Orlofsky, City Clerk STATE OF MINNESOTA ) )ss. COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this ________ day of ______________, 2025, by Luke M. Hellier and by Ann Orlofsky, the Mayor and City Clerk of the City of Lakeville, a Minnesota municipal corporation, on behalf of the corporation and pursuant to the authority granted by its City Council. Notary Public THIS INSTRUMENT WAS DRAFTED BY: CAMPBELL KNUTSON Professional Association Grand Oak Office Center I 860 Blue Gentian Road, Suite 290 Eagan, Minnesota 55121 Telephone: (651) 452-5000 AMP/ais Page 814 of 899 7 237355v2 EXHIBIT A TO STORMWATER MAINTENANCE AGREEMENT Legal Description of the Owner Property That part of the South Half of the Southwest Quarter of Section 1, Township 114, Range 21, Dakota County, Minnesota, lying north of the centerline of Dakota County Road No. 44 according to Dakota County Road Right of Way Map No. 86 (A.K.A. Klamath Trail, A.K.A. 169th Street West, A.K.A. Orchard Lake Road) and lying westerly of a line described as commencing at the northeast corner of said South Half of the Southwest Quarter of Section 1; thence on an assumed bearing of South 89 degrees 42 minutes 15 seconds West, along the north line of said South Half of the Southwest Quarter of Section 1, a distance of 1,070.52 feet to the point of beginning of said line to be described; thence South 30 degrees 54 minutes 53 seconds West a distance of 809.52 feet; thence South 22 degrees 19 minutes 01 seconds East a distance of 396.98 feet to the centerline of said County Road No. 44 and said line there terminating. Page 815 of 899 8 237355v2 EXHIBIT B TO STORMWATER MAINTENANCE AGREEMENT Legal Description of the Easement An easement for rain garden purposes over, under, and across that part of the South Half of the Southwest Quarter of Section 1, Township 114, Range 21, Dakota County, Minnesota, described as follows: Commencing at the northeast corner of said South Half of the Southwest Quarter of Section 1; thence on an assumed bearing of North 89 degrees 35 minutes 29 seconds West, along the north line of said South Half of the Southwest Quarter of Section 1, a distance of 2014.96 feet; thence South 0 degrees 24 minutes 32 Seconds West, a distance of 290.61 feet to the beginning of the easement to be described; thence North 75 degrees 43 minutes 22 seconds East, a distance of 32.00 feet; thence South 14 degrees 16 minutes 38 seconds East, a distance of 40.00 feet; thence South 75 degrees 43 minutes 22 seconds West, a distance of 32.00 feet; thence North 14 degrees 16 minutes 38 seconds West, a distance of 40.00 to the point of beginning. Page 816 of 899 9 237355v2 EXHIBIT C CITY OF LAKEVILLE ENGINEERING STANDARDS FOR STORM WATER TREATMENT FACILITIES Pond Maintenance Requirements 1. Annual inspection, maintenance reporting and certification by a professional engineer (Provided by Owner). Information must be submitted to the City annually. 2. Excavate pond to original design capacity when one half (1/2) of the wet volume of the pond is lost due to sediment deposition. 3. Remove floatable debris in and around the pond area including, but not limited to: oils, gases, debris and other pollutants. 4. Maintain landscape adjacent to the facility per original design, including but not limited to: maintenance of the buffer strip and other plant materials as per original plan design. 5. Maintenance of all erosion control measures including but not limited to: rip rap storm sewer outlets, catch basin inlets, etc. Infiltration/Rain Garden Maintenance Requirements 1. Inlet and Overflow Spillway – Remove any sediment build-up or blockage and correct any erosion. 2. Vegetation a. Maintain at least 80% surface area coverage of plants approved per plan. b. Removal of invasive plants and undesirable woody vegetation. c. Removal of dried, dead and diseased vegetation. d. Re-mulch void or disturbed/exposed areas. 3. Annual inspection and maintenance efforts must be documented and submitted to the City. Underground Infiltration System 1. Inspection of street or parking surface must be inspected for evidence of potholes, sinkholes, sediment build up, or surface ponding annually. 2. Annual inspections must be completed of pipe symmetry, pipe joint connections, and outlet structures to look for cracks, defects, misalignment, or seepage. 3. Inspection for accumulation of sediment must be done annually, maintenance should be performed when sediment accumulation occurs. 4. Visual inspection for trash and debris must be conducted monthly and following rain events of 1 inch or greater in 24 hours. 5. Inspections must be performed annually to look for oil accumulation in device or immediately after a spill occurs. Maintenance must be done when a layer of oil/gasoline develops on the surface. Page 817 of 899 10 237355v2 Environmental Manhole Maintenance Requirements 1. Annual inspections, maintenance reporting and certification must be completed by a professional engineer licensed in the State of Minnesota at Owner’s expense. Information must be submitted to the City annually. 2. Maintenance must be performed once the sediment or oil depth exceeds the established requirements recommended by the manufacturer. 3. Maintenance must occur immediately after a spill takes place. Appropriate regulatory agencies must also be notified in the event of a spill. 4. Disposal of materials shall be in accordance with local, state and federal requirements as applicable. Page 818 of 899 11 237355v2 MORTGAGE CONSENT TO STORMWATER MAINTENANCE AGREEMENT MINNWEST BANK, a Minnesota state banking corporation, which holds a mortgage executed by Rose Mountain LLC, a Minnesota limited liability company, Dreamerick LLC, a Minnesota limited liability company, and Cliff Road Castle LLC, a Minnesota limited liability company, in favor of Minnwest Bank, dated October 4, 2024, filed October 8, 2024, in the Office of the County Recorder, Dakota County, Minnesota, as Document No. 3648404 the development of which is governed by the foregoing Stormwater Maintenance Agreement, agrees that the Stormwater Maintenance Agreement shall remain in full force and effect even if it forecloses on its mortgage. Dated this _____ day of ____________, 2025. MINNWEST BANK By: Its: STATE OF MINNESOTA ) )ss. COUNTY OF __________ ) The foregoing instrument was acknowledged before me this ________ day of _______________________, 2025, by ____________________________________________ the ___________________________________ of MINNWEST BANK, a Minnesota state banking corporation, on behalf of said corporation. DRAFTED BY: CAMPBELL KNUTSON Professional Association Grand Oak Office Center I 860 Blue Gentian Road, Suite 290 Eagan, Minnesota 55121 651-452-5000 AMP/smt Page 819 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 2 • Commissioner Swenson noted he is a MN DOT employee, but his position does not have decision making authority regarding these projects, therefore there is no conflict of interest. • Commissioner Traffas inquired about the process to determine when new wells and expansion of the water treatment facility are needed. Mr. Johnson stated a model is used to project growth and demand to make those determinations. Motion was made by Kaluza, seconded by Swenson to recommend to City Council approval of the 2026-2030 Capital Improvement Plan as presented, finding that it is consistent with the City’s 2040 Comprehensive Plan. Ayes – Traffas, Kaluza, Zimmer, Duckworth, Swenson, Tinsley Nays: 0 6a. North Creek Second Addition Chair Zimmer requested a motion be made to table this item to the October 2, 2025 Planning Commission meeting. Motion was made by Swenson, seconded by Tinsley to recommend to table the North Creek Second Addition preliminary plat of 47 single family residential lots to the October 2, 2025 Planning Commission meeting. Ayes: Unanimous Nays: 0 6b. Chart House Chair Zimmer opened the public hearing to consider the application of George Maverick of the Chart House for a conditional use permit to exceed 25% impervious surface in the shoreland overlay district and a variance from the required setback from Kingsley Lake. George Maverick, owner of the Chart House, introduced the project and stated they would like to expand the patio bar. Senior Planner Heather Botten presented the staff report. The Chart House restaurant and banquet facility is proposing to demolish the existing detached bar building and construct a new 2,660 square foot structure. The new building requires a variance from the minimum setback requirements from Kingsley Lake. Additionally, the proposed site improvements require a conditional use permit (CUP) amendment to exceed 25% impervious surface on a natural environment lake. A CUP was approved in 1997 to exceed the 25% impervious surface area. Even though the proposed revisions on site will reduce the amount of impervious surface area to an amount that is less than what was approved with the original CUP, the 1997 approvals were tied to a site plan that is now being modified, thus the CUP amendment. The plans have been reviewed by staff from Community Development, Environmental Resources, and Engineering as well as the DNR. A site improvement agreement and stormwater maintenance Page 820 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 3 agreement are required to address site improvements and stormwater treatment facilities. This requirement ensures that these improvements will be constructed to the satisfaction of the City. Chair Zimmer opened the hearing to the public for comment. There was no public comment. Motion was made by Kaluza, seconded by Swenson to close the public hearing at 6:24 p.m. Voice vote was taken on the motion. Ayes – unanimous Chair Zimmer asked for comments from the Planning Commission. • Commissioners Swenson and Kaluza and Chair Zimmer expressed support for the project. Motion was made by Swenson, seconded by Kaluza to recommend to City Council approval of the Chart House conditional use permit amendment to exceed impervious surface and variance from shoreland setbacks and approval of the findings of fact dated September 18, 2025, subject to the following stipulations: 1. The site shall be developed in substantial conformance with the plat and plan set on file with the Community Development Department except as may be modified by the conditions below. 2. The City Code Enforcement Officer, or other designee, shall be granted right of access to the property at all reasonable times to ensure compliance with the conditions of this permit. 3. A site improvement agreement and stormwater agreement are required to address site improvements and stormwater treatment facilities. 4. The developer shall meet the conditions outlined in the City Engineering review memo dated September 9, 2025 and any subsequent correspondence. 5. Final site, grading, stormwater management, and erosion control plans shall be approved by the City Engineer. 6. Revised building elevations that are in compliance with City Code shall be submitted and approved prior to City Council consideration of the request. 7. Resolution No. 97-18 shall become null and void and shall be replaced by the terms of this Conditional Use Permit. Ayes: Kaluza, Zimmer, Duckworth, Swenson, Tinsley, Traffas Nays: 0 Page 821 of 899 CCity of Lakeville Communit y D eve l opme nt Memorandum To: Planning Commission From: Heather Botten, Senior Planner Date: September 9, 2025 Subject: Packet Material for the September 18, 2025 Planning Commission Meeting Ag en da It em: Chart House Restaurant Conditional Use Permit and Variance Act ion De a dline : November 18, 2025 (120-days) BA CKGROUND George Maverick, owner the Chart House restaurant and banquet facility is proposing to demolish the existing detached bar building and construct a new 2,660 square foot structure. The new building would require a variance from the minimum setback requirements from Kingsley Lake. Additionally, the proposed site improvements require a conditional use permit (CUP) amendment to exceed 25% impervious surface, while remaining below the 50% maximum, on a natural environment lake. A CUP was approved in 1997 to exceed the 25% impervious surface area. Even though the proposed revisions on site will reduce the amount of impervious surface area to an amount that is less than what was approved with the original CUP, the 1997 approvals were tied to a site plan that is now being modified, thus the CUP amendment. The property is located at 11287 Klamath Trail. The property is zoned C-3, General Commercial District and in a Shoreland Overlay District for Kingsley Lake. The plans have been reviewed by staff from Community Development, Environmental Resources, and Engineering as well as the DNR. A site improvement agreement and stormwater maintenance agreement are required to address site improvements and stormwater treatment facilities. This requirement ensures that these improvements will be constructed to the satisfaction of the City. Page 822 of 899 2 EE XHIBITS A. Location Map B. Zoning Map C. Site Plan D. Rain Garden Detail E. Impervious Surface Plan F. Elevations G. DNR Email Response P RO PERTY A NALY SIS Surround in g L a nd U ses . The property abuts the following existing or planned land uses: Direction Existing Use Land Use Plan Zoning North Kingsley Lake Water Water South Townhomes/Multi-family MDR, Medium Density Res. PUD East Kingsley Shore Senior Living HDR, High Density Res. PUD West Vacant land/Kingsley Lake RD, Restricted Development Public Open Space Mr. Maverick proposes to demo the existing detached bar building and construct a new building behind the main restaurant, on the north side of the patio. The Chart House property is roughly 24.13 acres in size with about 4.5 acres of property above the Ordinary High Water Level (OHWL). Kingsley Lake is classified as a natural environment lake that has the most restrictive shoreland regulations. The Chart House property was developed and the main building constructed in 1962 as a private restaurant/club that included a swimming pool and concrete shade canopy, which remains. The restaurant has been in business during those 63 years with few significant modifications since that time. Shoreland zoning regulations in Minnesota have their origins from legislative statutes dating back to the mid-1970s, requiring all cities and counties in Minnesota to apply certain standards for development and Zoning Ordinance enforcement. Standards for the consideration of variances also fall partly under these requirements. The minimum building setbacks on Kingsley Lake (classified as a Natural Environment Lake) is 150 feet from the OHWL. No part of the property complies with the setback requirements and is therefore legal non-conforming. Any new construction or expansion requires a setback variance. A conditional use permit was approved in 1997, allowing an impervious surface area greater than 25% with an expansion of the parking lot and to construct stormwater improvements on site. The new site improvements are still within the impervious surface maximum of the 1997 CUP Page 823 of 899 3 but will be amended to reflect the new civil plan set and stormwater treatment. GG rad in g, D rain a ge and U ti li tie s. City sanitary sewer and water is currently available to the site. Grading, drainage, erosion control, and utility issues are addressed in the engineering review memo prepared by Jon Nelson, Assistant City Engineer and Mac Cafferty, Environmental Resources Manager dated September 9, 2025. A copy of the engineering report is attached for your review. The Engineering Division recommends approval of the request subject to the stipulations outlined in the engineering report. T re e Prese rvat ion . There are no significant trees proposed to be removed with the site improvements. Any removal of significant trees shall require a tree preservation plan in accordance with City Code Section 11-21-11. Pa rki ng /Acces s. Access to the site is not changing; there is one access from Klamath Trail. Restaurant parking requires one stall per 90 square feet of floor area. Based on the building size of 2,660 square feet (minus 10% floor area as allowed by the Zoning Ordinance), 27 parking spaces are required for the proposed building. Per Dakota County property records, the main building is 14,399 square feet, requiring 143 parking spaces for a total of 170 required parking spaces for the site. Per the 1997 CUP, there are 202 parking spaces for the site. The off-street parking complies with the zoning ordinance. Exte ri or Building Materials. Section 11-17-9.D of the Zoning Ordinance requires that the exterior building finish of commercial buildings be constructed of at least three Grade A materials, except that buildings may be constructed primarily of one specific Grade A material provided the design is obviously superior to the general intent of the Zoning Ordinance. The exterior building finish shall be composed of at least 65% grade A materials; not more than 35% Grade B or Grade C material and not more than 10% Grade D materials. The primary exterior materials are stone veneer and grey shingles siding. The grey shingles are vinyl, which is Grade F, and not permitted on commercial structures. A revised building elevation shall be submitted and approved prior to City Council consideration. Se tb a ck s. The applicant is requesting a variance from minimum setback requirements from Kingsley Lake, which is reviewed further below. All other setback requirements have been met for the proposed structure. D NR Re view . The plans have been sent to the DNR for review and comment. Emailed comments have been received (Exhibit G) and shared with the applicant for consideration. C ONDIT IONAL USE PERM IT AMENDMENT AND S HORELAND IMPACT P LAN CRITERIA The 1997 CUP allowed 48% impervious surface and was tied to a site plan dated September 9, 1997. The applicant has submitted a site plan demonstrating the proposed impervious surface on Page 824 of 899 4 the property being 46%, within the 1997 approval but with a new detailed site plan. Section 11-4-3E and 11-102-25 of the City of Lakeville Zoning Ordinance provides that a conditional use permit may not be issued unless certain criteria are satisfied. The criteria and our findings regarding them are: aa ) T he propose d a cti on has b een cons ide red i n re lat ion t o t he spe cifi c poli cie s a nd provis ions of an d has be en f ound t o be con sis ten t wit h the Of f ici a l C it y Com pre he nsi ve Plan . Finding: The proposed expansion to the restaurant is consistent with the policies and provisions of Planning District 1 of the 2040 Comprehensive Land Use Plan. b) The propose d use i s or w ill be compat ib le wit h f ut ure la nd us es of t he area. Finding: The proposed site improvements are compatible with a restaurant use and is consistent with the uses envisioned in the C-3, General Commercial District. c) T he propose d use conforms wi th all perf orman ce stan dards con ta in ed in the Zon in g Ordi nan ce an d t he Cit y Code . Finding: The proposed building conforms to the performance standards set forth in the Zoning Ordinance given compliance with the stipulations of the conditional use permit and variance. d) The propos ed us e can be accommodated with existing public se rvi ces and wi ll n ot ove rb urde n t he Ci ty ’s servi ce ca pa cit y . Finding: The proposed site improvements will not overburden the City’s sanitary sewer and water systems and can be served with existing public services. e) T raff ic g ene rati on b y the propose d use is w it hi n capab iliti es of s treets se rvin g t he property. Finding: Traffic generation from the site improvements to the commercial use can be accommodated with the existing streets serving the property. Conditional use allowable within shoreland areas are subject to the following additional evaluation criteria and conditions: A. Evaluation Criteria: A thorough evaluation of the water body and the topographic, vegetation, and soils conditions on the site must be made to ensure: 1. The prevention of soil erosion or other possible pollution of public waters, both during and after construction. 2. The visibility of structures and other facilities as viewed from public waters is limited. 3. The site is adequate for water supply and on-site sewage treatment. Page 825 of 899 5 Findings: The proposed site improvements will not overburden the City’s sanitary sewer and water systems and can be served with existing public services. The structure is one story, similar to the building that will be removed. The applicant is working with City Engineering on final approval of grading, drainage, and erosion control plans to prevent possible pollution of public waters during and after construction. All structures and practices are in place for the treatment of stormwater runoff for the proposed building. A stormwater maintenance agreement will be recorded against the property to help ensure the conditional use permit stipulations, also referred to as a shoreland impact plan, are in place and maintained. VV ARIA NCE REVIE W C RI TERIA Section 11-6-5 and 11-102-15 of the Zoning Ordinance states that the board of adjustment (City Council) shall not approve any variance request unless they find failure to grant the variance will result in practical difficulties. “Practical difficulties” means that the property owner proposes to use the property in a reasonable manner not permitted by the Zoning Ordinance and that economic considerations alone do not constitute practical difficulties. The following review criteria must also be met: Se cti on 11-6-5 (All Varian ces ) an d 11-102-15 (Shore lan d D ist ri ct Variance s) The Zoning Ordinance for variances requires that seven criteria be addressed by the applicant and presented to the Planning Commission and City Council as part of the consideration for variance approval. The seven criteria noted below are consistent with State of Minnesota Statute and the Zoning Ordinance. The Shoreland Overlay District variance criteria pertain primarily to environmental considerations which would be addressed specifically with the processing of a variance. Public hearing notification to the Department of Natural Resources is required for variances proposed within Shoreland Overlay District areas. A. That the variance would be consistent with the comprehensive plan The comprehensive plan guides the property for commercial land use. The property is located in Comprehensive Plan Neighborhood Planning District No. 1. The comprehensive plan allows for commercial property improvements. B. The variance would be in harmony with the general purposes and intent of the Zoning Ordinance. The proposed site improvements are consistent with the uses permitted in the C-3, General Commercial District. The property is a legal non-conforming property, with any site improvements requiring a variance. One of the functions of setback requirements is to Page 826 of 899 6 maintain consistency of structure placement and aesthetic qualities from street, lake, and neighboring views. The proposed location of the new structure has been selected as the most suitable area on the lot, replacing an existing structure, minimizing the environmental impact. C. That the plight of the landowner is due to circumstances unique to the property not created by the applicant. The property is a legal non-conforming lot that was developed prior to the shoreland setbacks. Any site improvement/modification requires a variance. D. That the purpose of the variance is not exclusively economic considerations. The request is to improve and extend the seasonal use and protection from weather conditions for both restaurant and banquet patrons. E. That the granting of the variance will not alter the essential character of the neighborhood in which the parcel of land is located. The proposed structure does not appear to alter the essential character of the neighborhood. The building is one story with a pitched roof. The proposed building is replacing an existing structure. The proposed building is compatible with the commercial restaurant/banquet use of the property. Minimum grading work will be done with the exception of installing the raingarden. F. That the requested variance is the minimum action required to eliminate the practical difficulty. The proposed location of the structure is the most reasonable with the least amount of environmental impacts. The property improvements will improve stormwater treatment on the property by installing a raingarden that treats more impervious area than the additional size of the structure. G. Variances may not be approved for any use that is not allowed by the Zoning Ordinance for property in the zone where the affected person’s land is located. The property is zoned C-3, General Commercial District and the restaurant use is a permitted use in that district. RRECO MMENDA TI O N Community Development Department staff recommends approval of the conditional use permit amendment to exceed impervious surface and variance from shoreland setbacks, subject to the following stipulations: Page 827 of 899 7 1. The site shall be developed in substantial conformance with the plat and plan set on file with the Community Development Department except as may be modified by the conditions below. 2. The City Code Enforcement Officer, or other designee, shall be granted right of access to the property at all reasonable times to ensure compliance with the conditions of this permit. 3. A site improvement agreement and stormwater agreement are required to address site improvements and stormwater treatment facilities. 4. The developer shall meet the conditions outlined in the City Engineering review memo dated September 9, 2025 and any subsequent correspondence. 5. Final site, grading, stormwater management, and erosion control plans shall be approved by the City Engineer. 6. Revised building elevations that are in compliance with City Code shall be submitted and approved prior to City Council consideration of the request. 7. Resolution No. 97-18 shall become null and void and shall be replaced by the terms of this Conditional Use Permit. Findings of Fact for approval of the conditional use permit and variance request are attached. Page 828 of 899 CCity of Lakeville P ub lic Wo rks – En gine er i ng Division M e m o r a n d u m To: Heather Botten, Senior Planner From: Jon Nelson, Assistant City Engineer McKenzie L. Cafferty, Environmental Resources Manager Joe Masiarchin, Parks and Recreation Director Copy: Zach Johnson, City Engineer Tina Goodroad, Community Development Director Julie Stahl, Finance Director Dave Mathews, Building Official Date: September 9, 2025 Subject: Chart House – Conditional Use Permit x Site Plan Review x Grading and Erosion Control Plan Review BACKG R OU ND George Maverick has submitted a conditional use permit application and grading, drainage and erosion control plans to construct a building addition. The property is located adjacent to Kingsley Lake and north of and adjacent to Klamath Trail. The parent parcel consists of a metes and bounds parcel (220011052030) is zoned C-3, General Commercial District. The proposed site will be completed by: Applicant: George Maverick Engineer: Stonebrooke SSIITTEE CCOO NN DDIITTIIOO NN SS Chart House consists of an existing commercial building and parking lot. SSIITTEE PPLLAANN RREEVV II EEWW The site proposes to construct a building addition on the north end of the existing building. The site proposes to construct a rain garden on the west end of the site. Page 829 of 899 CCCHHAARRTT HHOOUUSSEE –– CCOONNDD IITTIIOONNAALL UUSSEE PPEERRMMIITT SSEEPPTTEEMMBBEERR 99,, 22002255 PPAAGGEE 22 OOFF 33 UUTTIILLII TT II EESS SSAANNIITTAARRYY SSEE WWEERR The site does not include construction of sanitary sewer. WWAATTEERRMMAAIINN The site does not include construction of watermain. DDRRAAII NN AAGG EE AANNDD GG RR AADDIINN GG The parent parcel is located within subdistrict OL-083 of the Orchard Lake Stormwater District, as identified in the City’s Water Resources Management Plan. The parent parcel has an existing stormwater basin on the site. The applicant will construct a rain garden west of the proposed building addition to treat the runoff from the added impervious surface area with the site improvements. The rain garden will outlet to Kingsley Lake. The applicant shall sign a private stormwater maintenance agreement for the rain garden prior to City Council approval of the site plan. The applicant shall submit plan revisions showing the entirety of the grading plan for the site for review and approval by city staff. The site improvements contains less than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. FFEEMMAA FFLLOOOO DDPPLLAAII NN AANN AALLYYSSII SS The site is shown on the Flood Insurance Rate Map (Map No. 27037C0183E; Eff. Date 12/2/2011) as Zone X by the Federal Emergency Management Agency (FEMA). Based on this designation, there are no areas impacted located within a Special Flood Hazard Area (SFHA), as determined by FEMA. Kingsley Lake is within Zone A. SSTTOO RR MM SSEEWW EERR The site does not include construction of storm sewer. WWEETT LLAANN DDSS There are no wetlands within the project area. There are not impacts proposed to the Kingsley Lake with the site improvements. Page 830 of 899 CCCHHAARRTT HHOOUUSSEE –– CCOONNDD IITTIIOONNAALL UUSSEE PPEERRMMIITT SSEEPPTTEEMMBBEERR 99,, 22002255 PPAAGGEE 33 OOFF 33 TT RR EEEE PPRR EESSEERRVVAATT II OONN A tree preservation plan was not prepared with the site improvements. No trees are proposed to be removed with the site improvements. EERROO SSIIOO NN CCOO NN TT RR OOLL The Applicant is responsible for ensuring that erosion and sediment control plan is followed throughout the construction process. Any changes made to the plan must be tracked and documented. Additional erosion control measures may be required during construction as deemed necessary by City staff. Any additional measures required shall be installed and maintained by the Applicant. RR EECCOO MMMMEENNDD AATTIIOO NN Engineering recommends approval of the Chart House Conditional Use Permit, grading and erosion control plan, subject to the requirements and stipulations within this report. Page 831 of 899 Dakota County, Maxar City of Lakeville Location Map Chart House CUP & Variance EXHIBIT A Site Location KENWOOD TR (CSAH 5) KLAMATH TRL UPPER 167TH ST KING S C TKingsley Lake ± Page 832 of 899 P/OS P/OS PUD RS-1 RS-3 RS-3 RA C-3 P/OS C-3 PUD City of Lakeville Zoning Map Chart House CUP & Variance EXHIBIT B Site Location KENWOOD TR (CSAH 5) KLAMATH TRL UPPER 167TH ST KING S C TKingsley Lake ± Page 833 of 899 Page 834 of 899 1 12" TYPE 3 (NON- WOVEN) GEOTEXTILE FILTER GRADING PLAN NOTES CLEANOUT PVC DRAIN TILE 4" PERFORATED PVC DRAIN TILE 4" PERFORATED FILTRATION MEDIA 1 :4 1:4 18" ELEV=984.50 RAIN GARDEN BOTTOM DRAIN TILE 4" SOLID PVC HARDWOOD MULCH 4" DOUBLE SHREDDED 12" CROSS SECTION DRAIN TILE 4" AGGREGATE COARSE FILTER 12" RAIN GARDEN PRIOR TO CONTINUING CONSTRUCTION. IMMEDIATELY FOLLOWING EXCAVATION, THIS MATERIAL SHALL BE REMOVED FROM THE 5. IN THE EVENT THAT SEDIMENT IS INTRODUCED INTO THE RAIN GARDEN DURING OR 4. FINAL GRADE AND MULCHING SHALL BE DONE BY HAND. AGGREGATE SHALL BE ROUND RIVER ROCK, WASHED AND FREE OF FINE PARTICLES. 3. COARSE FILTER AGGREGATE GRADATION SHALL FOLLOW MNDOT SPEC 3149.2.H FOR GRADATION. 3. FILTRATION MEDIA SHALL NOT BE COMPACTED DURING OR AFTER INSTALLATION. - 30% COMPOST GRADE 2 (PER MNDOT SPEC 3890.2.B) - 70% SAND (PER MNDOT SPEC 3126.2.C) 2. FILTRATION MEDIA SHALL CONSIST OF: FROST RIPPING TOOTH OR OTHER APPROVED METHOD. 1. THE BOTTOM OF THE EXCAVATION SHALL BE SCARCIFIED TO A 2' DEPTH WITH A DRAFT 1 RAIN GARDEN DESIGN DETAIL 980.59 81.0981.5982.0982.5982.59 8 3.0 9 8 3. 5 9 8 4. 0 984.5984.5985.09 8 5. 0 985.0985.5986.0986.0986.59 8 6. 5 9 8 7. 0987.5987.5 987.5 987.5987.5988.0 988.0988.0988.5988.5989.0989.5990.0990.0990.0990.5 991.0991.0 984.5985.0985.59 8 6. 0 9 8 5. 5 9 8 5. 09 8 4. 5986.0PROPOSED BAR saefty lights x 99 0. 4 990.2x x989.0x 988.3x 988.4x 988.2x 988.2x x 987.6 987.6 x988.4x988.7x988.7 988.5 987.4 x x 987.4x 988.4x 988.8 x x990.0 x 990 .1 x991.0 x991.0 x990.8 x990.9x990.8x991.2 x991.0x990.9x989.0 x989.2 x989.2 x989.2 x 989.4 x989.6x xx x 989.4 989.5 989.4 x988.39 8 7. 8 x988.2 x988.5 x x 988.2 988.1 988.1 1 STORY FRAME BUILDING OHWx990.3 989.8x 990.0x 990.2x 989.7x989.0x 9 8 9.0 x RI P RAPOUTLET CANOPYTRELLIS WOOD WALL CONC. RETAINING RETAINING WALL KEYSTONE FIRE TABLE OUTLET=985.5 PVC DRAIN TILE 4" PERFORATED CLEANOUT PVC DRAIN TILE 4" SOLID TO SOLID PVC PERFORATED TRANSITION FROM BTM=984.5 RAIN GARDEN 1:41:41:4AGGREGATE COARSE FILTER 1 STORY FRAME BUILDING RI P RAPCANOPYTRELLIS WOOD FIRE TABLE SHEET OF DESIGNED DRAWN CHECKED UNDER THE LAWS OF THE STATE OF MINNESOTA. UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR DATELIC. NO.NAME REV. NO.DATE BY CHK DESCRIPTION PLOT DRIVER: USER: MODEL: PLOT DATE:jgriffinDefault4:47:53 PM8/8/2025pdf_bw_11x17only.pltcfgFEETSCALE 20100PEN TABLE: FILE:S:\PROJECTS\CIVIL\George Maverick\02158_Chart House\Sheets\Chart House Bar_gp.dgnT-02022_planset.tblJLG59503JESSICA L. GRIFFIN CAN CAN GRADING PLAN AND RAIN GARDEN DESIGN CHART HOUSE BAR LEGEND DRAINAGE FLOW ARROW EXISTING CONTOUR PROPOSED CONTOUR CLEANOUT 4" PVC DRAIN TILE XXXX XXXX Page 835 of 899 BUILDING13,519 SQ. FT. BIT. PARKING 89,800 SQ. FT. BIT. & CONC. PATH981 SQ. FT. BLOCK WALL 129 SQ. FT. BLOCK WALL 17 SQ. FT. CONC.532 SQ. FT. CONC. 16 SQ. FT. CONC.917 SQ. FT.BUILDING189 SQ. FT.DECKING/BASE134 SQ. FT.GAZEBO119 SQ. FT. BUILDING 2,660 SQ. FT. STEPS=36 SQ. FT.WALL=17 SQ. FT. WATER FEATURE522 SQ. FT. PAVER PATH773 SQ. FT.PLATFORM101 SQ. FT.CONC. & PAVERS6,817 SQ . FT . LANDSCAPING 85 SQ. FT. LANDSCAPING 125 SQ. FT. LANDSCAPING536 SQ. FT. GRAVEL 302 SQ. FT. LANDSCAPING 78 SQ. FT. LANDSCAPING 357 SQ. FT. LANDSCAPING738 SQ. FT. LANDSCAPING 35 SQ. FT. BLOCK WALL 14 SQ. FT. CONC. 268 SQ. FT. CONC.10 SQ. FT. LIGHTHOUSE28 SQ. FT. CONC. 174 SQ. FT. LIFT STATION80 SQ. FT. GRAVEL 821 SQ. FT.LANDSCAPING164 SQ . FT . WALLS 95 SQ. FT. BRIDGE26 SQ. FT.CONC.148 SQ. FT. CONC41 SQ. FT. CONC 1,105 SQ. FT. NOTE: THE SHADED LANDSCAPING CONTAINS IMPERVIOUS UNDERLAYMENTAND WILL REMOVED OR BE REPLACED WITH A PERMEABLE UNDERLAYMENT 10 7 95TURFPROPOSED IMPERVIOUS SURFACE DETAIL SCALE IN FEET 0 N 60 120 180 BUILDING = 16,368 Square Feet BITUMINOUS PARKING = 89,800 Square Feet MAIN CONC. & PAVER PATIO = 6,817 Square Feet CONCRETE = 3,211 Square Feet CONC & BITUMINOUS PATH = 981 Square Feet LIFT STATION = 80 Square Feet DECKING BASE = 134 Square Feet GAZEBO = 119 Square Feet BRIDGE = 26 Square Feet PLATFORM = 101 Square Feet PAVER PATH = 773 Square Feet STEPS = 36 Square Feet WALLS = 272 Square Feet WATER FEATURE = 522 Square Feet GRAVEL = 1,123 Square Feet LANDSCAPING = 0 Square Feet LIGHTHOUSE = 28 Square Feet TOTAL IMPERVIOUS = 120,391 SQUARE FEET 12% IMPERVIOUS (OF TOTAL PROPERTY) 42.5% IMPERVIOUS (OF PROPERTY LYING ABOVE THE ORDINARY HIGHWATER LINE) IMPERVIOUS SURFACE CALCULATON Page 836 of 899 Page 837 of 899 Page 838 of 899 1 Botten, Heather From:DePaz, David (DNR) <david.depaz@state.mn.us> Sent:Monday, September 8, 2025 8:55 AM To:Botten, Heather Subject:RE: CUP and Variance - Lakeville Heather, Applicant should be mindful of the DNR OHWL for Lake Kingsley. Speciﬁcally for the raingarden, the PVC drain tile outlet should stay above the OHWL to avoid needing a public water permit. It would also be helpful if the raingarden location was shown on the overall site plan sheets. David De Paz (Dah-veed) Watershed Specialist | Temporary South Metro Area Hydrologist Ecological and Water Resources Division Minnesota Department of Natural Resources 1200 Warner Road St. Paul, MN 55106 Phone: 651-259-5775 Email: david.depaz@state.mn.us From: Botten, Heather <hbotten@lakevillemn.gov> Sent: Thursday, September 4, 2025 4:02 PM To: DePaz, David (DNR) <david.depaz@state.mn.us> Subject: CUP and Variance - Lakeville Hi David, Please see the attached letter and plans regarding the property located at 11287 Klamath Trail, Lakeville. If you have any questions or would like additional information, please reach out. Thanks, This message may be from an external email source. Do not select links or open attachments unless verified. Report all suspicious emails to Minnesota IT Services Security Operations Center. Page 839 of 899 2 Heather Botten Senior Planner , City of Lakeville 952-985-4423 |www.lakevillemn.gov 20195 Holyoke Avenue, Lakeville, MN , 55044 Page 840 of 899 Date: 10/6/2025 Launch Park Fourth Addition Preliminary and Final Plat Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution approving the preliminary and final plat of Launch Park Fourth Addition. Overview Lakeville Flexspace, LLC has submitted a preliminary and final plat for Launch Park Fourth Addition. The proposed plat includes one lot and one outlot on a 20-acre parcel. Lot 1 is eight acres and the outlot is 12 acres. Lakeville Flexspace is proposing to construct a garage condo development on Lot 1. The proposed storage development is a permitted use in the I-2, General Industrial District. The complex would include three garage condo buildings, each roughly 375’ x 90’ in size and one building about 375’ x 40’. The outlot is planned for future industrial development. The Planning Commission held a public hearing on the preliminary plat at their September 18, 2025 meeting. There was no public comment. Community Development, Fire Marshal, Engineering and Parks and Recreation staff have reviewed the plans. Final plat approval is subject to the execution of the Development Contract for the parcel. The developer and property owner are working with City staff on the details of the agreement. Once finalized, it will be brought forward to City Council for approval. Supporting Information 1. Plat Resolution 2. Draft Planning Commission Minutes 3. Planning Report 09-08-25 and Engineering Report 09-26-25 4. Combined Exhibits Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Diversified Economic Development Report Completed by: Heather Botten, Senior Planner Page 841 of 899 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 25-_____ RESOLUTION APPROVING THE PRELIMINARY AND FINAL PLAT OF LAUNCH PARK FOURTH ADDITION WHEREAS, the owner of the plat described as Launch Park Fourth Addition has requested preliminary and final plat approval; and WHEREAS, the preliminary plat was reviewed by the Planning Commission and recommended for approval on September 18, 2025; and WHEREAS, the preliminary and final plat meets Subdivision Ordinance requirements; NOW, THEREFORE, BE IT RESOLVED by the Lakeville City Council: 1. The Launch Park Fourth Addition preliminary and final plats are hereby approved subject to City Council approval of a Development Contract and any other agreements related thereto. 2. The Mayor and City Clerk are hereby authorized to the final plat mylars and the development contract. 3. The City Clerk is directed to file a certified copy of this resolution with the Dakota County Recorder. ADOPTED by the Lakeville City Council this 6thday of October 2025. Page 842 of 899 CITY OF LAKEVILLE BY: _______________________ Luke M. Hellier, Mayor ATTEST: ________________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) ( CITY OF LAKEVILLE ) I hereby certify that the foregoing Resolution No. 25-____ is a true and correct copy of the resolution presented to and adopted by the City Council of the City of Lakeville at a duly authorized meeting thereof held on the 6th day of October 2025 as shown by the minutes of said meeting in my possession. ________________________ Ann Orlofsky, City Clerk (SEAL) Page 843 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 4 6c. Launch Park Fourth Addition Chair Zimmer opened the public hearing to consider the application of Lakeville Flexspace, LLC for a preliminary plat and development plan for a one lot, one outlot subdivision. Jim French, Lakeville Flexspace, LLC, introduced the project. Mr. French stated he is a developer of small bay industrial space. A Common Interest Community (CIC) plat would be created, which allows individual ownership of the spaces as well as provides declarations, covenants and restrictions for the use of the units. Ms. Botten presented the staff report. The proposed plat includes one lot and one outlot on a 20- acre parcel. Lot 1 is eight acres and the outlot is 12 acres. Lakeville Flexspace is proposing to construct a garage condo development on Lot 1. The proposed storage development is a permitted use in the I-2, General Industrial District. The complex would include three garage condo buildings, each roughly 33,750 square feet (375’ x 90’) in size and one building about 16,875 square feet (375’ x 40’). Each building consists of multiple units, and each unit has access to water and sewer. The property is located east of Cedar Avenue (CSAH 23) and south of future 222nd Street. The preliminary plat plans have been reviewed by the Engineering Division, Fire Marshal, and Parks and Recreation Department. Chair Zimmer opened the hearing to the public for comment. There was no public comment. Motion was made by Kaluza, seconded by Swenson to close the public hearing at 6:35 p.m. Voice vote was taken on the motion. Ayes – unanimous Chair Zimmer asked for comments from the Planning Commission. • Chair Zimmer asked for details on how the CIC is used and what restrictions would be in place. Mr. French stated the CIC is to ensure that the community is in compliance with the permitted uses. He stated some of the restrictions and covenants in the CIC include no excessive noise- producing activities, no excessive smell-producing activities, and no overnight parking. The CIC is enforced and maintained through a commercial property management company that enforces the covenants in addition to maintaining the exteriors of the structures and contract for snow removal. He also stated as these are industrial spaces; the owners are not permitted to live or stay overnight in the spaces. • Commissioner Duckworth asked how many units will be in the project, what the price point is and how they are typically utilized and by whom. Mr. French stated there will be 98 units and be about $185,000 for 1,200 square feet. Mr. French said there are a wide range of uses, including retirees, people who have a lot of toys, workshops, and small business owners. Page 844 of 899 Planning Commission Meeting Minutes, September 18, 2025 Page 5 • Commissioner Traffas asked where can the owner park if they drive to the unit. Mr. French stated the owner can park directly in front of the unit that they own. The units are wide enough to accommodate three spaces in front of each unit. • Commissioner Duckworth asked if owners have the ability to sublease. Mr. French stated it is permitted to rent the unit after obtaining permission through the property management company. • Commissioner Kaluza asked about numbering or lettering on each door for emergency service response, as well as if there are crime or drug free requirements. Mr. French stated each unit has a number on the door and there are crime and drug free requirements listed in the CIC. Security cameras will also be included on site. Motion was made by Tinsley, seconded by Traffas to recommend to City Council approval of the Launch Park Fourth Addition preliminary plat, subject to the following stipulations: 1. Implementation of the recommendations listed in the engineering report dated September 8, 2025 and any subsequent correspondence. 2. The final plat shall be in substantial conformance with the preliminary plans on file with the Community Development Department except as may be modified by the conditions herein. 3. A development contract and related agreements shall be approved by the City Council with the approval of the final plat. 4. The site and building shall be developed in accordance with the plans approved by the City Council. 5. Landscaping shall be installed consistent with a landscape plan approved by the City Forester. A financial security shall be submitted with the development contract to guarantee installation of the approved landscaping. All landscaped areas within and adjacent to the building and parking lot shall be irrigated. Trees and shrubs shall not be planted in road right-of-way. 6. The park dedication fee must be paid with the final plat. 7. Site lighting shall not exceed one foot candle at the property line adjacent to public right-of- way. All exterior light fixtures shall be down-cast design so as not to glare onto public right-of- way. 8. Section 11-19-13 of City Code requires 3 parking spaces, plus 1 space per 100 storage units. A revised site plan demonstrating the required parking spaces is required prior to final plat approval. 9. An onsite hydrant about midpoint of the property shall be required on the east side of the development as required by the Fire Marshal. Ayes: Zimmer, Duckworth, Swenson, Tinsley, Traffas, Kaluza Nays: 0 There being no further business, the meeting was adjourned at 6:44 p.m. Page 845 of 899 1 City of Lakeville Community Development Memorandum To: Planning Commission From: Heather Botten, Senior Planner Date: September 8, 2025 Subject: Packet Material for the September 18, 2025 Planning Commission Meeting Agenda Item: Launch Park Fourth Addition Preliminary Plat Action Deadline: November 27, 2025 BACKGROUND Lakeville Flexspace, LLC has submitted a preliminary plat for Launch Park Fourth Addition. The proposed plat includes one lot and one outlot on a 20-acre parcel. Lot 1 is eight acres and the outlot is 12 acres. Lakeville Flexspace is proposing to construct a garage condo development on Lot 1. The proposed storage development is a permitted use in the I-2, General Industrial District. The complex would include three garage condo buildings, each roughly 33,750 square feet (375’ x 90’) in size and one building about 16,875 square feet (375’ x 40’). Each building consists of multiple units, and each unit has access to water and sewer. The property is located east of Cedar Avenue (CSAH 23) and south of future 222nd Street. The preliminary plat plans have been reviewed by the Engineering Division, Fire Marshal, and Parks and Recreation Department. The following exhibits are attached for your information: EXHIBITS A. Location Map B. Zoning Map C. Preliminary Plat D. Site Plan Page 846 of 899 2 E. Grading Plan F. Utility Plan G. Landscape Plan H. Photometric Plan I. Building Elevations Zoning and Surrounding Uses. The property is zoned I-2, General Industrial District. The proposed project is surrounded by the following existing or planned land uses: Direction Existing Use Land Use Plan Zoning North Vacant Property Industrial I-2, General Industrial South Metropolitan Airports Commission Property Outside City Limits. Eureka Township Comprehensive Plan guides for agricultural use Agriculture per Eureka Township Zoning Map East Dakota Electric Assoc. – Site under construction Industrial I-2, General Industrial West Industrial Building Industrial I-2, General Industrial PLANNING A NALYSIS P RELIMINARY PLAT Zoning and Comprehensive Plan consistency. The property is currently guided Industrial and located in Planning District No. 6 of the Comprehensive Land Use Plan. The property is in the Metropolitan Urban Service Area (MUSA) which means that City municipal services, including sanitary sewer service, are available to serve the property. The property is zoned I- 2, General Industrial District. The proposed lot and outlot meet the minimum lot size and width requirements for future development in the I-2 district. The proposed preliminary plat meets the recommended goals and objectives of the zoning code and comprehensive plan. Existing Site Conditions. The site is currently undeveloped; historically used for agricultural production of row crops. Lot/Block/Outlot. The parent parcel is platted as Outlot A, Launch Park First Addition. This was platted as an outlot with the intent of future industrial development. The preliminary plat of Launch Park Fourth Addition consists of one lot and one outlot. The lots proposed with the Page 847 of 899 3 preliminary plat exceed the minimum lot area and lot width requirements for the I-2, General Industrial District. Preliminary Plat Lots Lot Area and Lot Width Requirements Lot 1 Outlot A Minimum 1-Acre 7.98 acres 12.04 acres Minimum 100-feet 515 feet 762 feet Streets. Right-of-way dedication for 222nd Street was done with previous plats and no additional right-of-way is needed. 222nd Street is a local rural industrial street constructed as a 40-foot-wide paved section within an 80-foot right of way. Grading, Drainage and Utilities. City sanitary sewer and water is currently available to the site. The existing and planned future City sanitary sewer and water systems available to serve the area of the preliminary plat are adequate to accommodate the build-out of future industrial building(s) within the preliminary plat area. Proposed grading, drainage, erosion control, and utility plans for Launch Park Fourth Addition are shown on the attached civil plans. Grading, drainage, erosion control, and utility issues are addressed in the engineering review memo prepared by Jon Nelson, Assistant City Engineer and Mac Cafferty, Environmental Resources Manager dated September 8, 2025. A copy of the engineering report is attached for your review. The Engineering Division recommends approval of Launch Park Fourth Addition preliminary plat subject to the stipulations outlined in the engineering report. Fire Marshal. The Fire Marshal reviewed the plans and stated an onsite hydrant about midpoint of the property would be required on the east side of the development. Wetlands. There are no wetlands on the site. Tree Preservation. There are no significant trees identified within the preliminary plat. Park Dedication, Trails and Sidewalks. The City’s Comprehensive Parks, Trails, and Open Space Plan does not identify any future park needs in the area of the plat and no public trails or sidewalks are being constructed with this plat. Park dedication will be satisfied by a cash fee in lieu of land dedication, which is $5,615 per acre for industrial zoned property. Lot 1, Block 1 is 7.98 acres and must pay $44,807.70 for park dedication with Launch Park Fourth Addition final plat. The park dedication requirement for Outlot A will be paid when platted into lots and blocks. Page 848 of 899 4 SITE PLAN REVIEW The site plan proposes three 33,750 square foot (375’ x 90’) garage condo buildings and one 16,875 square foot (375’ x 40’) building. Site improvements also include access drive aisles, utilities, and stormwater management facilities. The proposed stormwater treatment involves an infiltration pond on the east side of the site. Building Setbacks. The I-2, Industrial District requires the following setback requirements: Front Yard West Side Yard East Side Yard Rear Yard Minimum 40 feet 10 feet 10 feet 30 feet Proposed 120 feet 35 feet 126 feet 30 feet Building Height. The maximum height of a building in the I-2 zoning district is 50 feet. The proposed buildings are single level with a mezzanine. The tallest point of the buildings is 31 feet, complying with code requirements. Building Design. The buildings are designed with LP Smartside LAP siding (engineered wood) with accent panels on the corners. On walls that are public-facing, three feet of stone veneer is added to the bottom of the building. The proposed materials are in compliance with the requirements for industrial buildings. Parking Lot and Drive Setbacks. There is one access point on 222nd Street. The access complies with spacing guidelines in the City Code. There is no separate guest parking area proposed. Section 11-19-13 of City Code requires 3 parking spaces, plus 1 space per 100 storage units. A revised site plan demonstrating the required parking spaces is required prior to final plat approval. Landscaping. Landscaping on the site includes deciduous and coniferous trees planted along the front property line. Financial security will be required with the final plat to guarantee installation of the approved landscaping. A revised landscaping plan is required to identify the tree species and the quantity of each to be planted and must be reviewed and approved by the City Forester. Trash Enclosure. If trash will be kept outdoors in an enclosure, the structure must meet the requirements of Section 11-18-11, including exterior materials, location, and screening. All outdoor trash enclosures must be screened with a structure that is a minimum of six feet in height or one foot taller than the containers and must be constructed of materials that match the architecture of the principal building. Site Lighting. The submitted lighting plan shows that the proposed lighting on site meets the Zoning Ordinance requirement of light levels not exceeding one foot candle at the property line along right-of-way. At this time, there are no parking lot lights, only wall mounted lights that are downward facing LED wall packs. Page 849 of 899 5 Signs. All signs shall comply with the Zoning Ordinance requirements for the I-2 District. A sign permit shall be issued prior to the installation of any signs. Mechanical Equipment. Primary mechanical equipment will be contained within the building. Any exterior equipment shall follow the screening requirements in Section 11-21-13 of city code. RECOMMENDATION Community Development staff recommend approval of Launch Park Fourth Addition preliminary plat subject to the following stipulations: 1. Implementation of the recommendations listed in the engineering report dated September 8, 2025 and any subsequent correspondence. 2. The final plat shall be in substantial conformance with the preliminary plans on file with the Community Development Department except as may be modified by the conditions herein. 3. A development contract and related agreements shall be approved by the City Council with the approval of the final plat. 4. The site and building shall be developed in accordance with the plans approved by the City Council. 5. Landscaping shall be installed consistent with a landscape plan approved by the City Forester. A financial security shall be submitted with the development contract to guarantee installation of the approved landscaping. All landscaped areas within and adjacent to the building and parking lot shall be irrigated. Trees and shrubs shall not be planted in road right-of-way. 6. The park dedication fee must be paid with the final plat. 7. Site lighting shall not exceed one foot candle at the property line adjacent to public right- of-way. All exterior light fixtures shall be down-cast design so as not to glare onto public right-of-way. 8. Section 11-19-13 of City Code requires 3 parking spaces, plus 1 space per 100 storage units. A revised site plan demonstrating the required parking spaces is required prior to final plat approval. 9. An onsite hydrant about midpoint of the property shall be required on the east side of the development as required by the Fire Marshal. Page 850 of 899 City of Lakeville Public Works – Engineering Division Memorandum To: Heather Botten, Senior Planner From: Jon Nelson, Assistant City Engineer McKenzie L. Cafferty, Environmental Resources Manager Joe Masiarchin, Parks & Recreation Director Copy: Zach Johnson, City Engineer Julie Stahl, Finance Director Dave Mathews, Building Official Tina Goodroad, Community Development Director Date: September 26, 2025 Subject: Launch Park Fourth Addition • Final Plat Review • Grading and Erosion Control Plan Review • Landscaping Plan Review • Utility Plan Review BBAACCKKGGRROOUUNNDD Lakeville Flexspace, LLC representatives have submitted a final plat application named Launch Park Fourth Addition along with plans to construct a garage condo complex on one (1) block with one (1) outlot on 20.02 acres. The parent parcel (Outlot A, Launch Park First Addition) is zoned I-2, General Industrial District. The proposed development is located east of Cedar Avenue (CSAH 23), south of and adjacent to 222nd Street, north of 225th Street and Eureka Township, and west of Flagstaff Avenue. The parent parcel consists of Outlot A, Launch Park. Page 851 of 899 LLAAUUNNCCHH PPAARRKK FFOOUURRTTHH AADDDDIITTIIOONN –– FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 2266,, 22002255 PPAAGGEE 22 OOFF 77 The outlots created with the final plat shall have the following use: Outlot A: Future Development; retained by Developer (12.04 acres) The proposed development will be completed by: Developer: Hat Trick Investments, Inc. Engineer/Surveyor: Auth Consulting & Associates SSIITTEE CCOONNDDIITTIIOONNSS The existing parcel consists of Outlot A, Launch Park First Addition. The site consists of undeveloped agricultural land. The site is located within the South Creek Stormwater District with the site generally draining west to east. The northwest of the site is being used for stockpiling. Security shall be held for removal and reestablishment of the active stockpile area on the site. SSTTRREEEETT AANNDD SSUUBBDDIIVVII SSIIOO NN LLAAYYOO UUTT 222nd Street Launch Park Fourth Addition is located south of and adjacent to the extension of 222nd Street from its existing terminus at the intersection of 222nd Street and Garvey Lane through the western plat boundary. The roadway is a 40-foot-wide rural roadway terminating in a cul-de- sac and is actively under construction in association with Airlake DEA final plat. CCOONNSSTTRRUUCCTTIIOO NN AACCCCEESSSS Construction traffic access and egress for grading, utility, and street construction shall be limited to a single access from 222nd Street. PPAARRKKSS,, TTRRAAIILLSS AANNDD SSIIDD EEWWAALLKKSS The Park Dedication requirement has not been collected on the parent parcels and will be satisfied through a cash contribution to be paid with the final plat, calculated as follows: Park Dedication Summary Gross Area of Launch Park 4th Addition 20.02 ac. Less Area of Outlot A (Future Development) (-) 12.04 ac. Total Park Dedication Area = 7.98 ac. Page 852 of 899 LLAAUUNNCCHH PPAARRKK FFOOUURRTTHH AADDDDIITTIIOONN –– FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 2266,, 22002255 PPAAGGEE 33 OOFF 77 7.98 acres x $5,615.00 = $44,807.70 Total Acreage Launch Park 4th Addition Lot 1, Block 1 2025 Unit Rate (Industrial) Park Dedication Fee Launch Park 4th Addition The Developer shall satisfy the park dedication requirement for Outlot A with subsequent phases of the Launch Park preliminary plat at the time they are final platted into lots and blocks through a cash contribution at the rate in effect at the time of final plat approval. UUTTIILLIITTIIEESS SSAANNIITTAARRYY SSEEWWEERR Launch Park Fourth Addition is located within the South Creek sanitary sewer district as identified in the City’s Comprehensive Sanitary Sewer Plan. Wastewater will be conveyed via existing sanitary sewer to the Empire Treatment Facility via the MCES Elko/New Market Interceptor monitored by meter M646. Launch Park Fourth Addition includes the construction of privately owned and maintained sanitary sewer. 8-inch sanitary sewer will be connected to the public sanitary sewer stub located at the property line south of 222nd Street. The Sanitary Sewer Availability Charge has not been collected on the parent parcel and must be paid with the building permit application. The Sanitary Sewer Availability Charge for Outlot A will be collected with subsequent phases of the Launch Park preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. WWAATTEERRMMAAIINN Development of Launch Park Fourth Addition includes the construction of privately owned and maintained watermain. 6-inch watermain will be connected to the public sanitary sewer stub located at the property line south of 222nd Street. DDRRAAIINNAAGGEE AANNDD GGRRAADDIINNGG Launch Park Fourth Addition is located within the South Creek stormwater district as identified in the City’s Water Resources Management Plan. Page 853 of 899 LLAAUUNNCCHH PPAARRKK FFOOUURRTTHH AADDDDIITTIIOONN –– FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 2266,, 22002255 PPAAGGEE 44 OOFF 77 Development of Launch Park Fourth Addition includes the construction of a privately owned and maintained stormwater management infiltration basin to collect and treat the stormwater runoff generated from the site. The Developer shall enter into a private stormwater maintenance agreement with the final plat for the private basins. The stormwater management design is consistent with City Ordinance requirements. Following completion of the site improvements and restoration, the Developer shall conduct a double ring infiltrometer test in the location of the filtration basin to demonstrate that the design infiltration rates have been achieved. The Developer shall provide a $5,000 security with the final plat to ensure that this testing is completed. The final grading plan shall identify all fill lots in which the building footings will be placed on fill material. The grading specifications shall also indicate that all embankments meet FHA/HUD 79G specifications. The Developer shall certify to the City that all lots with footings placed on fill material are appropriately constructed. Building Certificate of Occupancies will not be issued until a soils report and an as-built certified grading plan have been submitted and approved by City staff. Launch Park Fourth Addition contains more than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. A copy of the Notice of Stormwater Permit Coverage must be submitted to the City upon receipt from the MPCA. SSTTOORRMM SSEEWWEERR Development of Launch Park Fourth Addition includes the construction of a privately owned and maintained storm sewer system. Storm sewer will be installed within the subdivision to collect and convey stormwater runoff to the privately owned and maintained infiltration basin. Storm Sewer Charge Summary Gross Area of Launch Park 4th Addition 872,071.00 s.f. Less Area of Outlot A (Future Development) (-) 524,462.00 s.f. Total Storm Sewer Charge Area (Commercial and Industrial) = 347,609.00 s.f. 347,609.00 s.f. x $0.250/s.f. = $86,902.25 Net Area Launch Park 4th Addition 2025 Unit Rate (Commercial and Industrial) Storm Sewer Charge Launch Park 4th Addition Page 854 of 899 LLAAUUNNCCHH PPAARRKK FFOOUURRTTHH AADDDDIITTIIOONN –– FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 2266,, 22002255 PPAAGGEE 55 OOFF 77 Final locations and sizes of all storm sewer facilities will be reviewed by City staff with the building permit application and final construction plans. FEMA FLOODPLAIN ANALYSIS Launch Park Fourth Addition is located within areas shown on the Flood Insurance Rate Map (FIRM) as Zone X, as determined by FEMA (Map number 27037C0214E). Based on this designation, no areas within the plat are located within a Special Flood Hazard Area (SFHA). WWEETTLLAANNDDSS A wetland delineation was previously completed for the site. No wetlands were identified within the project area. TTRREEEE PPRREESSEERRVVAATT II OONN There are no significant trees identified on the site. LLAANNDDSSCCAAPPEE PPLLAANN The plant schedule is to be updated to identify the specific tree types and quantity of each to be planted prior to recording of the final plat. EERROOSSIIOONN CCOO NNTTRROOLL The Developer is responsible for obtaining an MPCA Construction Permit for the site prior to construction. The developer is responsible for following and implementing all of the requirements outlined in the SWPPP. Any changes made throughout construction must be documented in the SWPPP. Additional erosion control measures may be required during construction as deemed necessary by City staff. Any additional measures required shall be installed and maintained by the Developer. The MS4 Administration Fee has not been collected on the parent parcels and must be paid with the final plat, calculated as follows: $132,000.00 x 2.0% = $2,640.00 Grading Cost Launch Park 4th Addition 2025 Rate MS4 Administration Fee Launch Park 4th Addition Page 855 of 899 LLAAUUNNCCHH PPAARRKK FFOOUURRTTHH AADDDDIITTIIOONN –– FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 2266,, 22002255 PPAAGGEE 66 OOFF 77 SECURITIES The Developer shall provide a Letter of Credit as security for the Developer-installed improvements relating to Launch Park Fourth Addition. Construction costs are based upon a cost estimate submitted by the Developer’s engineer on September 24, 2025. CONSTRUCTION COSTS Sanitary Sewer Connection $ 5,000.00 Watermain Connection 5,000.00 Storm Sewer Connections 10,000.00 Grading, Erosion Control and Restoration 132,000.00 SUBTOTAL - CONSTRUCTION COSTS $ 152,000.00 OTHER COSTS Developer’s Design (3.0%) $ 4,560.00 Developer’s Construction Survey (2.5%) 3,800.00 City’s Legal Expense (0.5%) 760.00 City Construction Observation (5.0%) 7,600.00 Developer’s Record Drawing (0.5%) 760.00 Landscaping Stockpile Removal and Reestablishment Lot Corners/Iron Monuments 47,000.00 10,000.00 200.00 SUBTOTAL - OTHER COSTS $ 74,680.00 TOTAL PROJECT SECURITY $ 226,680.00 The Developer shall post a security to ensure the final placement of iron monuments at property corners with the final plat. The security is $100.00 per lot and outlot for a total of $200.00. The City shall hold this security until the Developer’s Land Surveyor certifies that all irons have been placed following site grading, street, and utility construction. CASH FEES A cash fee for one-year of streetlight operating expenses shall be paid with the final plat and is calculated as follows: 515 feet x $0.2832/front foot/quarter = $145.85 Total Front Foot Launch Park 4th Addition 2025 Rate Streetlight Operating Fee Launch Park 4th Addition Page 856 of 899 LLAAUUNNCCHH PPAARRKK FFOOUURRTTHH AADDDDIITTIIOONN –– FFIINNAALL PPLLAATT SSEEPPTTEEMMBBEERR 2266,, 22002255 PPAAGGEE 77 OOFF 77 A cash fee for one-year of environmental resources management expenses shall be paid with the final plat and is calculated as follows: 1 unit x $61.52/unit x 4.20 = $258.38 Total Units Launch Park 4th Addition 2025 Rate Utility Factor Environmental Resources Fee Launch Park 4th Addition A cash fee for the preparation of addressing, property data, and City base map updating shall be paid with the final plat and is calculated as follows: 2 lots/outlots x $90.00/unit = $180.00 Lots/Outlots Launch Park 4th Addition 2025 Rate Property Data & Asset/Infrastructure Mgmt. Fee Launch Park 4th Addition The Developer shall submit the final plat and construction drawings in an electronic format. The electronic format shall be in .pdf and either .dwg/.dxf or .shx format. The Developer shall also pay a cash fee for City Engineering Administration. The fee for City Engineering Administration will be based on three percent (3.00%) of the estimated construction cost, or $4,560.00. CASH REQUIREMENTS Park Dedication $ 44,807.70 Storm Sewer Charge 86,902.25 Streetlight Operating Fee 145.85 Environmental Resources Management Fee 258.38 Property Data and Asset/Infrastructure Management Fee 180.00 City Engineering Administration (3.00%) 4,560.00 TOTAL CASH REQUIREMENTS $ 136,854.18 RREECCOOMMMMEENNDDAATTIIOONN Engineering recommends approval of the Launch Park Fourth Addition final plat, erosion control plan and grading plan, utility plan, and landscape plan subject to the requirements and stipulations within this report. Page 857 of 899 LAUNCH PARK FOURTH ADDITIONEgan, Field & Nowak, Inc.l a n d s u r v e y o r s s i n c e 1 8 7 2SHEET 1 OF 2 SHEETSPage 858 of 899 BLOCK 1OUTLOT ALOT 1LAUNCH PARK FOURTH ADDITIONEgan, Field & Nowak, Inc.l a n d s u r v e y o r s s i n c e 1 8 7 2NSHEET 2 OF 2 SHEETSVICINITY MAPSECTION 3, T 113 N, R 20 WNPLATPage 859 of 899 Dakota County, Maxar City of Lakeville Location Map Launch Park Fourth Add Preliminary Plat EXHIBIT A Site LocationCEDAR AVE (CSAH 23)220TH ST Eureka TownshipGARVEY LN225TH ST City of FarmingtonAirlake Airport± Page 860 of 899 I-3 I-2 I-2 I-2I-3 I-2 City of Lakeville Zoning Map Launch Park Fourth Add Preliminary Plat EXHIBIT B Site LocationCEDAR AVE (CSAH 23)220TH ST Eureka TownshipGARVEY LNCity of FarmingtonAirlake Airport± I-3 I-3 I-2 Page 861 of 899 222ND STREET WESTNO BUILDING OBSERVEDLOT 1OUTLOT ABLOCK 1REVISIONSPAGEDRAWING NAME:JOB NO.FILE NO.FIELD BOOKSURVEY FOR:PROPERTY ADDRESS:DRAWN BY:BY:CHECKEDFIELDWORKCHIEF:EXISTING LEGAL DESCRIPTION:GENERAL SURVEY NOTES:PRELIMINARY PLAT FOR:WWW.EFNSURVEY.COM New Brighton, Minnesota 55112PHONE: (612) 466-3300475 Old Highway 8 NW, Suite 200Egan, Field & Nowak, Inc.l a n d s u r v e y o r s s i n c e 1 8 7 2LEGEND:GOPHER STATE ONE CALL NOTE:222nd Street W & Garvey LaneLakeville, Minnesota 55024Dakota County Tax PID 224450500010Kimley Horn & Associates, Inc.Kimley Horn & Associates, Inc.PAGEDRAWING NAME:JOB NO.FILE NO.FIELD BOOKDRAWN BY:BY:CHECKEDFIELDWORKCHIEF:NSHEET 1 OF 1CERTIFICATION:PROPOSED LOT SUMMARY:PROPOSED LEGAL DESCRIPTIONS:PRELIMINARY PLAT OFLAUNCH PARK FOURTH ADDITIONOWNER/SUBDIVIDER:LAND SURVEYOR:CIVIL ENGINEER:Page 862 of 899 3222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222222333333333333333333331111111111111111111111111111111111111111111111111111111144444444444455555555511999999999999999910108882' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANG2' OVERHANGWATER SERVICERISER ROOMWATER SERVICERISER ROOMWATER SERVICERISER ROOMWATER SERVICERISER ROOMMATCH STREET(UNDER CONSTRUCTION)BUILDING SETBACKBUILDING SETBACKBUILDING SETBACKBUILDING SETBACK BUILDING SETBACK BUILDING SETBACK BUILDING SETBACK PROPERTY LINEPROPERTY LINEPROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINEPROPERTY LINEPROPERTY LINEDRAINAGE EASEMENTDRAINAGE EASEMENT222ND STREET WEST30' WIDE DRAINAGE SWALE(UNDER CONSTRUCTION)6666666666(UNDER CONSTRUCTION)12453SHEET KEY6NEW BUILDING OVERHEAD DOOR30" CONCRETE APRONBITUMINOUS PAVEMENT24" CONCRETE VALLEY GUTTER724" CONCRETE SURMOUNTABLE CURB & GUTTER8RESERVED9STORM INLET/MANHOLE10STORMWATER MANAGEMENT BASIN1124" CONCRETE RIBBON CURBNEW BUILDING ENTRANCE/EXIT DOORDRAINAGE SWALELEGENDBUILDING SETBACKPROPOSED BITUMINOUSPROPOSED CONCRETE SURFACEPROPOSED BUILDINGPROPOSED STORM WATERMANAGEMENT AREA DRAINAGE SWALE24" RIBBON CURB24" VALLEY GUTTERGENERAL SITE NOTES1.CONTRACTOR TO OBTAIN PERMISSION/PERMIT FROM THE CITY TO WORK INRIGHT-OF-WAY PRIOR TO ANY WORK BEING PERFORMED WITHIN THE PUBLICRIGHT-OF-WAY. ANY REQUIRED LANE CLOSURES OR TRAFFIC CONTROLSIGNAGE/DETOUR PLANS IS THE RESPONSIBILITY OF THE CONTRACTOR ANDSHALL BE COORDINATED WITH CITY STAFF, AS REQUIRED.2.CONTRACTOR TO FIELD VERIFY AND LOCATE ALL EXISTING UTILITIES PRIOR TOCONSTRUCTION.3.CONTRACTOR TO COORDINATE RELOCATION OF ANY SMALL UTILITIES, ASNECESSARY.4.CONTRACTOR SHALL MAINTAIN TRAFFIC ACCESSIBILITY ALONG THE PROJECT.5.NO TREES OR SHRUBS ARE TO BE REMOVED WITHOUT THE PRIOR APPROVALOF THE OWNER.6.ALL SIGNAGE SHALL BE IN ACCORDANCE TO THE CURRENT EDITION OF THEMANUAL ON UNIFORM TRAFFIC CONTROL DEVICES FOR STREETS ANDHIGHWAYS AND MnDOT REQUIREMENTS.24" SURMOUNTABLE CURB & GUTTEREX. STORM WATER UTILITY EASEMENTPROPOSED LOT AREA7.985 ACRESPROPOSED LOT WIDTH515.0'CURRENT ZONINGI2 - GENERAL INDUSTRIAL DISTRICTSETBACK REQUIREMENTSFRONT YARD SETBACK - 40'REAR YARD SETBACK - 30', OR 50' ON THE YARD ABUTTING RESIDENTIAL ZONED PROPERTYSIDE YARD SETBACK - 10' ON ANY 1 SIDE, OR 30'ON THE SIDE YARD ABUTTING A STREET;EXCEPT 50' ON THE SIDE YARD BUTTINGRESIDENTIAL ZONED PROPERTYSITE DATAPROPERTY BOUNDARY LINEEXISTING STORMWATER BASINDRAINAGE & UTILITY EASEMENTPage 863 of 899 942943943943943943943943943942943943943943943943943943943941941942943943938 942942943937938939 INFILTRATION BASIN ABOTTOM ELEV=935.00TEMPORARY SEDIMENT BASIN10 YR HWL = 938.42100 YR HWL = 940.24TOTAL VOL. PROVIDED=43,501 CFWQV REQUIRED = 28,205 CFWQV ELEV. = 936.50TOP ELEV=941.00BUILDING #1F.F.E. = 943.50F.F.E. = 943.50BUILDING #2BUILDING #3F.F.E. = 943.50F.F.E. = 943.50BUILDING #4PROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINE/R.O.W.& UTILITY EASEMENT50' WIDE DRAINAGEGRADINGLIMITS(APPROX.)GRADINGLIMITS(APPROX.)GRADINGLIMITS(APPROX.)GRADINGLIMITS(APPROX.)GRADINGLIMITS(APPROX.)GRADINGLIMITS(APPROX.)GRADINGLIMITS(APPROX.)GRADINGLIMITS(APPROX.)BASIN OUTLETSTRUCTURE(SEE DETAILS)CREST = 940.00OUTFALLSTORM SEWEROUTFALLSTORM SEWEROUTFALLSTORM SEWEROUTFALLSTORM SEWERBASIN OUTLETSTORM WATER5FT WIDEBOTTOMSWALE5FT WIDEBOTTOMSWALE222ND STREET WEST30' WIDE DRAINAGE SWALE(UNDER CONSTRUCTION)CONSTRUCT 1FT WIDE BERM(UNDER CONSTRUCTION)20' WIDE WEIRTOP ELEV.=942.40F.F.E.=943.50943.45H.P./EOF942.50943.33943.33943.332.0%9 4 2 . 7 7 H . P .0.5%9 4 2 . 5 5 0.5%2.9%943.33943.33943.332.0%9 4 2 . 7 7 H . P .0.5%0.5%3.2%0.5%0.5%L.P./RIM=942.130.5%0.5%0.5%0.5%L.P./RIM=F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45L.P./RIM=942.13F.F.E.=943.50943.454.6%3.2%H.P./EOF942.503.2%4.6%3.2%4.6%3.2%4.6%3.2%H.P./EOF942.50F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45H.P./EOF942.50L.P./RIM=942.134.6%3.2%H.P./EOF942.503.2%4.6%3.2%3.2%4.6%3.2%0.5%L.P./RIM=942.130.5%0.5%0.5%943.33943.33943.332.0%942.770.5%942.552.9%L.P./RIM=942.031.0%1.3%H.P.942.550.5%2.9%943.333.2%H.P./EOF942.503.2%0.5%0.5%L.P./RIM=942.130.5%0.5%0.5%H.P./EOFH.P./EOF942.500.5%0.5%2.3%1.5%H.P./EOF942.500.5%0.5%942.06RIM=2.2%941.68RIM=939.58939.88939.340.5%0.5%939.61939.761.4%1.0%1.0%941.10940.86943.00F.F.E.=943.50943.00F.F.E.=943.50F.F.E.=943.50F.F.E.=943.50F.F.E.=943.50943.00F.F.E.=943.50933.93INV=933.54INV=0.5%0.5%L.P./RIM=4.1%942.254.1%1.7%941.919 4 2 . 7 7 0.5%9 4 2 . 5 5 2.9%4.1%942.254.1%1.7%1.7%941.919 4 2 . 5 5 2.9%941.911.7%9 4 2 . 5 5 2.9%4.1%942.251.7%9 4 2 . 5 5 2.9%4.1%940.032.6%942.50L.P./RIM=942.134.6%3.2%H.P./EOF942.503.2%4.6%3.2%4.6%3.2%4.6%3.2%H.P./EOF942.50943.33943.332.0%942.770.5%942.552.9%H.P.942.550.5%2.9%943.33943.33943.332.0%942.770.5%942.552.9%H.P.942.550.5%2.9%1.3%L.P./RIM=942.031.0%1.3%1.3%L.P./RIM=942.031.0%1.3%F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50943.45F.F.E.=943.50F.F.E.=943.50F.F.E.=943.50943.45F.F.E.=943.50943.454.0%1.0%1.7%943.33943.33943.332.0%H . P .0.5%9 4 2 . 5 5 2.9%942.26941.93L.P./RIM=0.7%942.80943.00943.00943.00942.80942.80942.80942.80942.00941.25940.50940.13L.P./RIM=1.5%941.93L.P./RIM=0.5%CONSTRUCT TEMPORARY SEDIMENT BASIN TOPROVIDE LIVE STORAGE VOLUME GREATERTHAN OR EQUAL TO 27,000 CF. REFER TOSWPPP FOR ADDITIONAL INFORMATION.936936 937 937 937 937 938 938 938 938 939 939 939 939 940 940 940 940 941 941 941 941 942 942 942 943 943 943943 943943 943 943 943943 943 943 943943943943943 945935935 935 935 935935 935 940940940 940940 940 940 LEGENDEXISTING 5FT CONTOURSEXISTING 1FT CONTOURSAPPROXIMATE GRADING LIMITSPROPOSED BUILDINGSPROPOSED 5FT CONTOURSPROPOSED 1FT CONTOURSH.P.= HIGH POINT GRADE ELEVATION= LOW POINT GRADE ELEVATIONFFE= FINISHED FLOOR ELEVATIONPROPOSED FINISHED GRADESURFACE DRAINAGEL.P.XXX.XX(ALL CURB SPOT ELEVATION SHOWN ARE ATCURB FLOWLINE UNLESS OTHERWISE NOTED)PROPOSED FINISHED GRADE SPOT ELEVATIONSBENCHMARKX.X%1.REFER TO SHEET C1.1 - "GENERAL NOTES" FOR GRADINGNOTES.GRADING NOTESEOF= EMERGENCY OVERFLOWTEMPORARY SEDIMENT BASIN(APPROXIMATE)PROPERTY BOUNDARY LINEPage 864 of 899 >WWWWWWWWWWWWWWWWWWWWWW>>> >STMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTMSTM >>>>>>>>>>>> >>>>>>>>>>> > >STMSTM222ND STREET WEST30' WIDE DRAINAGE SWALE(UNDER CONSTRUCTION)(UNDER CONSTRUCTION)I(24")=933.93W/ TRASHGUARDSTM F.E.S. #E224" RCP F.E.S.STM F.E.S. #E1I(24")=933.5424" RCP F.E.S.78'-24" RCP @ 0.5%STM INLET #C5STM INLET #B5(2'x3' BOX)NEENAH R-3067-V CASTINGD = 3.00'R = 941.93I(12"E) = 938.93STM INLET #A5D = 3.82'I(12"W) = 938.21R = 941.93I(15"E) = 938.11NEENAH R-3067-V CASTINGSTM INLET #A4STM INLET #B4STM INLET #B3STM INLET #C3STM INLET #C4(4' DIAM. MH)180'-12" RCP(CL5) @ 0.4%(2'x3' BOX)NEENAH R-3067-V CASTINGD = 2.75'R = 942.03I(12"E) = 939.28100'-12" RCP(CL5) @ 0.4%150'-15" RCP(CL5) @ 0.4%(4' DIAM. MH)D = 3.35'I(12"W) = 938.88R = 942.13I(15"E) = 938.78NEENAH R-2540 CASTING(4' DIAM. MH)D = 4.05'I(15"W) = 938.18R = 942.13I(18"E) = 938.08NEENAH R-2540 CASTING100'-12" RCP(CL5) @ 0.4%150'-15" RCP(CL5) @ 0.4%(2'x3' BOX)NEENAH R-3067-V CASTINGD = 2.75'R = 942.03I(12"E) = 939.28(4' DIAM. MH)D = 3.35'I(12"W) = 938.88R = 942.13I(15"E) = 938.78NEENAH R-2540 CASTING(4' DIAM. MH)D = 4.05'I(15"W) = 938.18R = 942.13I(18"E) = 938.08NEENAH R-2540 CASTINGNEENAH R-3067-V CASTINGSAFL BAFFLE )NEENAH R-3067-V CASTING(5' DIAM. MH W/I(18"W) = 937.47R = 941.91I(18"E) = 937.37SAFL BAFFLE )NEENAH R-3067-V CASTINGD = 9.54'SUMP(5') = 932.37D = 9.59'NEENAH R-3067-V CASTINGI(18")=936.00STM OUTFALL #B118" RCP F.E.S.I(18")=936.00STM OUTFALL #C118" RCP F.E.S.I(18")=936.00STM OUTFALL #D118" RCP F.E.S.(2'x3' BOX)NEENAH R-3067-V CASTINGD = 2.75'R = 942.03I(12"E) = 939.28STM INLET #D5(4' DIAM. MH)D = 4.05'I(15"W) = 938.18R = 942.13I(18"E) = 938.08NEENAH R-2540 CASTINGSTM INLET #D3(4' DIAM. MH)D = 3.35'I(12"W) = 938.88R = 942.13I(15"E) = 938.78NEENAH R-2540 CASTINGSTM INLET #D4100'-12" RCP(CL5) @ 0.4%150'-15" RCP(CL5) @ 0.4%153'-18" STM @ 0.4%24'-18" STM @ 5.8%R = 941.91SAFL BAFFLE )STM INLET #B2STM INLET #C2STM INLET #D2(6' DIAM. MH W/(6' DIAM. MH W/SUMP(6') = 931.37D = 10.54'I(18"E) = 937.37I(18"W) = 937.4723'-18" STM @ 6.0%D = 10.54'SUMP(6') = 931.37I(18"E) = 937.37I(18"W) = 937.47R = 941.9123'-18" STM @ 6.0%154'-18" STM @ 0.4%154'-18" STM @ 0.4%37'-18" STMI(15"W) = 937.49R = 942.06I(18"E) = 937.39NEENAH R-3067-V CASTINGSTM INLET #A3(4' DIAM. MH)(5' DIAM. MH W/I(18"NW) = 937.19R = 941.68SAFL BAFFLE )I(18"SE) = 937.09SUMP(5') = 932.09I(18")=936.0018" RCP F.E.S.STM INLET #A2STM OUTFALL #A1154'-15" RCP(CL5) @ 0.4%50'-18" STM@ 0.4%D = 4.67'@ 3.0%STM STRUCTURE #F(SEE DETAILS)STM OUTFALL #F112" RCP F.E.S.I(12")=933.28BUILDING #1 -WTR SERVICE10' - 4" WTR SERV. W/6"x6"x4" TEE & 4" G.V.BUILDING #2 -WTR SERVICE10' - 4" WTR SERV. W/6"x6"x4" TEE & 4" G.V.BUILDING #3 -WTR SERVICE10' - 4" WTR SERV. W/6"x6"x4" TEE & 4" G.V.BUILDING #4 -WTR SERVICE55' - 4" WTR SERV. W/ 4" G.V.12" WTR STUB. CONNECT TO EXISTING& 6" GATE VALVEINSTALL 12"x6" REDUCER24°24°589' - 6" WTR(SEE DETAILS)F.G. = 943.3019.0' - 6" LEAD6"x6" TEE W/WITH VALVEHYDRANT #1(2)45°6"x4" REDUCER14'-8" STM @ 17.9%INV(8"E)=941.50INV(8"W)=939.00BUILDING #1 -SAN. SERVICE22'-6" PVC @ 2.0%(MIN.)W/ 8"x8"x6" WYEBUILDING #2 -SAN. SERVICE22'-6" PVC @ 2.0%(MIN.)W/ 8"x8"x6" WYEBUILDING #3 -SAN. SERVICE22'-6" PVC @ 2.0%(MIN.)W/ 8"x8"x6" WYEBUILDING #4 -SAN. SERVICE45-6" PVC @ 2.0%(MIN.)W/ 8"x8"x6" WYE & (3) 45°BENDINV (8")=930.108" PVC SANITARY STUBCONNECT TO EXISTING62'- 8 " P V C (SD R 3 5 ) @ 0 . 5 %DEPTH=11.03'INV OUT(8"NE)=930.41RIM=941.44SAN MH A1INV IN(8"S)=930.51RIM=942.91SAN MH A2RIM=942.60SAN MH A3DEPTH=9.36'INV OUT(8"N)=933.24270'-8" PVC(SDR 35) @ 0.5%DEPTH=11.12'INV OUT(8"N)=931.79INV IN(8"S)=931.89256'-8" PVC(SDR 35) @ 0.5%LEGENDPROPOSED BUILDINGSPROPOSED STORM SEWERPROPOSED SANITARY SEWERPROPOSED WATER MAINEXISTING STORM SEWEREXISTING SANITARY SEWEREXISTING HYDRANT AND VALVEEXISTING CATCH BASINEXISTING SANITARY SEWEREXISTING WATERMAINEXISTING OVERHEAD ELECTRIC LINEEXISTING POWER POLEEXISTING UNDERGROUND GAS LINEPROPOSED INSULATIONEXISTING ELECTRIC LINEEXISTING TELEPHONE LINESTORM WATER UTILITY EASEMENT1.REFER TO SHEET C1.1 - "GENERAL NOTES" FOR GENERALUTILITY, SANITARY SEWER, WATER AND STORM SEWERNOTES.UTILITY NOTESPROPERTY BOUNDARY LINEPage 865 of 899 222ND STREET WEST (UNDER CONSTRUCTION) 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.4 0.6 0.6 0.4 0.2 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.2 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.3 0.6 0.7 0.5 0.2 0.1 0.2 0.2 0.2 0.2 0.3 0.2 0.4 1.0 1.7 1.5 0.7 0.3 0.3 0.4 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.2 0.3 0.3 0.2 0.2 0.1 0.1 0.2 0.1 0.1 0.3 0.7 1.0 0.7 0.4 0.2 0.2 0.2 0.2 0.2 0.3 0.1 0.3 0.8 1.9 2.3 1.1 0.4 0.1 0.5 0.4 0.3 0.5 0.8 0.1 0.4 1.4 3.1 2.6 0.9 0.2 0.1 1.4 0.6 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.3 0.8 1.4 1.1 0.6 0.4 0.3 0.2 0.3 0.4 0.2 0.6 1.6 2.9 1.8 0.6 0.2 0.6 0.6 0.3 0.5 1.0 0.1 0.2 0.9 2.8 3.8 1.4 2.1 1.1 0.5 1.2 3.1 4.3 1.2 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.2 0.5 1.7 3.5 2.4 0.8 1.1 0.6 0.4 1.0 1.5 0.1 0.5 1.8 2.8 1.9 0.7 0.8 2.8 4.6 6.3 2.3 0.7 1.8 5.8 5.0 1.6 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.3 1.2 0.6 2.1 5.5 7.0 3.8 1.0 1.1 4.0 6.7 6.2 2.7 0.8 1.8 5.3 5.8 1.7 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 5.6 1.8 0.8 2.6 6.4 6.1 4.1 1.2 1.1 3.8 7.2 6.9 2.8 0.9 1.5 4.3 3.7 1.6 0.4 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.0 2.1 0.8 2.4 6.7 4.0 1.3 0.9 2.9 4.6 3.7 2.4 0.9 1.3 3.2 5.3 2.0 0.4 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.8 2.0 0.8 1.9 3.9 3.2 1.3 0.9 2.6 4.5 6.5 3.3 1.0 1.4 4.6 6.2 2.4 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.2 2.1 0.8 1.8 4.7 5.2 1.6 0.9 3.1 7.2 6.4 3.7 1.1 1.3 4.2 6.3 6.9 2.6 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.9 2.7 0.9 2.0 5.8 5.2 1.8 0.9 2.9 6.6 7.2 4.0 1.2 1.1 3.7 6.2 4.4 2.2 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.5 2.9 0.9 1.8 5.5 5.5 1.8 0.8 2.4 5.4 3.7 3.0 1.2 1.0 2.7 3.7 5.0 2.6 0.6 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.0 2.8 0.9 1.5 3.9 3.5 1.7 0.8 2.0 4.0 4.1 1.4 1.0 3.4 7.1 7.0 3.3 0.7 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.8 2.6 0.9 1.4 3.6 6.0 2.2 0.8 2.3 6.5 4.8 1.6 1.0 3.3 6.4 7.1 3.6 0.8 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 7.2 3.6 1.1 1.4 4.7 6.0 2.5 0.9 2.2 5.8 5.3 1.7 0.9 2.9 6.8 5.0 3.0 0.8 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.3 3.9 1.2 1.3 4.4 6.7 6.8 2.6 0.9 1.8 5.1 3.7 1.6 0.8 2.2 3.7 4.2 3.1 0.9 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.6 3.9 1.2 1.1 3.4 5.1 3.9 2.2 0.8 1.5 3.4 4.6 1.8 0.8 2.4 6.3 6.9 4.4 1.1 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.3 3.0 1.2 1.0 2.8 4.2 6.0 2.8 0.9 1.6 5.1 6.0 2.2 0.9 2.5 6.1 4.6 1.3 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.6 1.4 1.0 3.5 7.4 6.6 3.3 1.0 1.5 4.7 6.4 2.3 0.8 2.2 6.4 4.1 1.2 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.8 1.6 1.0 3.3 6.6 7.3 3.6 1.0 1.4 4.4 4.6 2.1 0.8 1.7 3.7 3.4 1.3 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 5.2 1.7 0.9 2.8 6.0 4.2 2.8 1.0 1.1 2.9 3.4 4.5 2.3 0.8 1.7 4.9 5.6 1.7 0.3 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 3.4 1.6 0.8 2.2 3.9 5.0 3.5 1.2 1.1 3.8 6.7 7.0 2.9 0.9 1.8 5.3 5.4 1.9 0.4 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 5.4 1.9 0.9 2.6 6.8 6.6 4.4 1.3 1.1 3.7 6.4 6.7 3.2 1.0 1.7 5.3 5.5 1.9 0.4 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 5.8 2.2 0.9 2.5 6.1 4.7 1.4 1.0 3.5 7.2 5.7 2.9 1.0 1.3 3.5 3.8 1.8 0.4 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.6 2.4 0.9 2.2 6.0 3.7 1.4 0.9 2.5 3.8 4.1 2.8 1.0 1.3 3.7 6.6 2.4 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.1 2.1 0.8 1.7 3.6 4.0 1.6 0.9 2.7 6.2 7.3 4.0 1.1 1.3 4.2 6.6 6.2 2.6 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 5.6 2.6 0.9 1.8 5.5 5.7 1.9 0.9 2.8 6.4 6.3 4.1 1.2 1.2 4.0 7.1 6.7 2.7 0.6 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.7 3.0 0.9 1.8 5.1 5.7 2.0 0.8 2.6 6.8 3.9 1.2 1.0 3.0 4.6 3.7 2.3 0.6 0.2 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 7.2 3.2 1.0 1.6 5.1 4.7 1.9 0.8 2.0 4.0 3.1 1.2 0.9 2.7 4.7 6.6 3.1 0.7 0.2 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.5 2.6 0.9 1.3 3.1 4.1 1.9 0.8 1.9 4.9 5.0 1.5 0.9 3.2 7.2 6.3 3.4 0.8 0.2 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.9 3.0 1.0 1.3 4.1 6.7 2.5 0.8 2.0 5.8 4.9 1.6 0.8 2.9 6.7 7.0 3.5 0.7 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 7.0 3.9 1.1 1.2 4.2 6.2 6.3 2.6 0.8 1.8 5.6 4.9 1.4 0.6 2.0 4.6 2.6 1.7 0.5 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 6.6 4.1 1.1 1.0 3.8 7.0 5.5 2.1 0.6 1.1 3.0 1.8 0.8 0.4 0.8 1.1 0.1 0.5 1.5 3.0 2.3 0.9 0.3 0.5 0.6 0.2 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 4.4 2.9 0.8 0.6 1.9 2.7 1.9 0.5 0.1 1.5 0.9 0.4 0.5 0.8 0.1 0.3 1.0 2.6 3.0 1.2 0.4 0.1 0.5 0.3 0.2 0.3 0.3 0.2 0.4 0.9 1.4 1.2 0.6 0.2 0.1 0.2 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.5 2.0 4.0 2.3 0.7 1.1 0.5 0.3 0.6 0.5 0.2 0.6 1.7 2.8 1.6 0.6 0.2 0.4 0.3 0.2 0.2 0.2 0.1 0.2 0.5 1.0 1.1 0.6 0.3 0.1 0.2 0.2 0.1 0.1 0.1 0.1 0.2 0.3 0.4 0.4 0.2 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.2 0.5 1.3 2.1 1.4 0.6 0.5 0.3 0.2 0.2 0.2 0.2 0.4 0.7 0.9 0.6 0.3 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.3 0.2 0.2 0.1 0.0 0.1 0.1 0.1 0.1 0.1 0.0 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.3 0.5 0.6 0.5 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 · · Page 866 of 899 NON-PUBLIC FACING SIDEWALLPUBLIC FACING SIDEWALLPUBLIC FACING ENDWALLPUBLIC FACING ENDWALLPage 867 of 899 Lakeville FlexSpace Facility | Exterior Rendering- Public Facing Lakeville, MN | 07/09/2025 | V1 Public Face 1 2 BOULDER AVE & HWY 3 1 MIDWESTFlexSpace Stone/Faux Stone Wainscot Cement Bd Siding (Horizontal) 2 Page 868 of 899 942943943943943943943943943942943943943943943943943943943941941942943943938 942942943BUILDING #1BUILDING #2BUILDING #3BUILDING #4PROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINE/R.O.W.222ND STREET WEST30' WIDE DRAINAGE SWALE(UNDER CONSTRUCTION)& UTILITY EASEMENT50' WIDE DRAINAGE937938939 936936 937 937 937 937 938 938 938 938 939 939 939 939 940 940 940 940 941 941 941 941 942 942 942 943 943 943943 943943 943 943 943943 943 943 943943943943943 945935935 935 935 935935 935 940940940 940940 940 940 EDDEEDDEEDEDDDEQRPGPGPPCOCOQRPGPGANPPASASANPPLEGENDLANDSCAPE PLANTING SCHEDULENTSDECIDUOUS TREE PLANTING DETAILN.T.S.EVERGREEN PLANTING DETAILSEED w/ MNDOT SOUTHERNBOULEVARD (SB) SEED MIX (TYP.)SEED w/ MNDOT WET DITCH (WD)SEED MIX (TYP.)SCREENING TREE(EVERGREEN)SCREENING TREE(DECIDUOUS)DEPage 869 of 899 Date: 10/6/2025 Spirit of Brandtjen Farm Commercial 7th Addition Preliminary and Final Plat Proposed Action Staff recommends adoption of the following motion: Move to approve: 1) a resolution approving the Spirit of Brandtjen Farm Commercial 7th Addition preliminary and final plat, and 2) a resolution vacating a public drainage and utility easement. Overview Representatives from MSP Pilot Knob LLC are requesting approval of the Spirit of Brandtjen Farm Commercial 7th Addition preliminary and final plat of one lot and one outlot to allow the construction of a 9,205 square foot commercial building to house Grow Pediatrics clinic and additional tenant space and the vacation of an underlying public drainage and utility easement that is being processed in conjunction with the preliminary and final plat. The site is located south of 160th Street (CSAH 46) and east of Pilot Knob Road (CSAH 31), directly south of Valvoline Instant Oil Change and north of Hy-Vee. The Planning Commission held a public hearing on the Spirit of Brandtjen Farm Commercial 7th Addition preliminary and final plat and easement vacation at their September 4, 2025 meeting and unanimously recommended approval. There was no public comment. Supporting Information 1. Plat and Vacation Resolutions 2. September 4, 2025 Planning Commission meeting minutes 3. August 25, 2025 Memos and exhibits Financial Impact: $0 Budgeted: No Source: Envision Lakeville Community Values: Diversified Economic Development Report Completed by: Kris Jenson, Planning Manager Page 870 of 899 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 25-_______ RESOLUTION APPROVING THE PRELIMINARY AND FINAL PLAT OF SPIRIT OF BRANDTJEN FARM COMMERCIAL 7TH ADDITION WHEREAS, the owner of the plat described as SPIRIT OF BRANDTJEN FARM COMMERCIAL 7TH ADDITION has requested preliminary and final plat approval; and WHEREAS, the preliminary and final plat was reviewed by the Planning Commission and the Parks, Recreation and Natural Resources Committee and recommended for approval; and WHEREAS, the preliminary and final plat meets Subdivision Ordinance requirements and is consistent with the Spirit of Brandtjen Farm Master Planned Unit Development Stage Plan Agreement dated October 17, 2005. NOW, THEREFORE, BE IT RESOLVED by the Lakeville City Council: 1. The preliminary and final plat of SPIRIT OF BRANDTJEN FARM COMMERCIAL 7TH ADDITION is hereby approved subject to City Council approval of the development contract and security requirements. 2. The Mayor and City Clerk are hereby directed to sign the final plat mylars. 3. The City Clerk is directed to file a certified copy of this resolution with the Dakota County Recorder. Page 871 of 899 ADOPTED by the Lakeville City Council this 6th day of October 2025. CITY OF LAKEVILLE BY: _______________________ Luke M. Hellier, Mayor ATTEST: ________________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) ( CITY OF LAKEVILLE ) I hereby certify that the foregoing Resolution No. 25-_____ is a true and correct copy of the resolution presented to and adopted by the City Council of the City of Lakeville at a duly authorized meeting thereof held on the 6th day of October 2025 as shown by the minutes of said meeting in my possession. ________________________ Ann Orlofsky, City Clerk (SEAL) Drafted by: City of Lakeville 20195 Holyoke Ave Lakeville, MN 55044 Page 872 of 899 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 25-_____ RESOLUTION VACATING A PUBLIC DRAINAGE AND UTILITY EASEMENT WHEREAS, the City Council has conducted a public hearing, preceded by two (2) weeks published notice, to consider the following described public drainage and utility easement vacation, and WHEREAS, the City Council has determined that it is in the public interest to approve the public drainage and utility easement vacation. NOW, THEREFORE, BE IT RESOLVED by the Lakeville City Council: 1. The following public drainage and utility easement is hereby vacated: (see attached Exhibit A) 2. The City Clerk is directed to file a certified copy of this resolution with the Dakota County Recorder. ADOPTED by the Lakeville City Council this 6th day of October 2025. Page 873 of 899 CITY OF LAKEVILLE ________________________ Luke M. Hellier, Mayor ATTEST: ________________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) ( CITY OF LAKEVILLE ) I hereby certify that the foregoing Resolution No. 25-_____ is a true and correct copy of the resolution presented to and adopted by the City Council of the City of Lakeville at a duly authorized meeting thereof held on the 6th day of October 2025, as shown by the minutes of said meeting in my possession. ___________________________ Ann Orlofsky, City Clerk (SEAL) Drafted by: City of Lakeville 20195 Holyoke Ave Lakeville, MN 55044 Page 874 of 899 EXHIBIT A Description of Drainage and Utility Easement to be Vacated All those drainage and utility easements as dedicated in the recorded plat of SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION, Dakota County Minnesota, lying within that part of OUTLOT A, said plat, which lies easterly of the recorded plats of SPIRIT OF BRANDTJEN FARM COMMERCIAL 3RD ADDITION, SPIRIT OF BRANDTJEN FARM COMMERCIAL 4TH ADDITION, and SPIRIT OF BRANDTJEN FARM COMMERCIAL 5TH ADDITION, Dakota County, Minnesota, and which lies westerly and southerly of the recorded plat of SPIRIT OF BRANDTJEN FARM COMMERCIAL 6TH ADDITION, Dakota County, Minnesota. Page 875 of 899 CITY OF LAKEVILLE. PLANNING COMMISSION MEETING MINUTES September 4, 2025 Vice Chair Einck called the meeting to order at 6:00 p.m. in the Council Chambers at City Hall. The Pledge of Allegiance to the flag was given. Members Present: Vice Chair Scott Einck, Pat Kaluza, John Swaney, Jason Swenson, Amanda Tinsley, Mark Traffas, Alternate Dylan Duckworth, Ex-Officio Jeff Hansen Members Absent: Christine Zimmer Staff Present: Kris Jenson, Planning Manager; Jon Nelson, Assistant City Engineer; Dawn Erickson, Community Development Recorder. 3. Approval of the Meeting Minutes The August 7, 2025 Planning Commission meeting minutes were approved as presented. 4. Announcements Planning Manager Kris Jenson stated there were no announcements. 5a. Spirit of Brandtjen Farm Commercial 7th Addition Vice Chair Einck opened the public hearing to consider the application of MSP Pilot Knob, LLC for a preliminary and final plat and PUD development stage plans of one commercial lot and the vacation of public drainage and utility easements. Rodney Hintz with MSP Commercial introduced the project. Steve Paetzel from Mohagen Architecture and Brian Nygard from Civil Site Group were also in attendance. Ms. Jenson presented the staff report, stating MSP Pilot Knob, LLC have submitted applications for a preliminary and final plat to be known as Spirit of Brandtjen Farm Commercial 7th Addition for one commercial lot and one outlot as well as the vacation of public drainage and utility easements for the development of a multi-tenant building. The subject property is currently a 2.95 acre outlot within the Spirit of Brandtjen Farm (SBF) commercial area and is zoned PUD, Planned Unit Development. The property is located south of 160th Street (CSAH 46) and east of Pilot Knob Road. The SBF Commercial 7th Addition preliminary and final plat and site development plans have been reviewed by Engineering and Environment Resources Division staff as well as the City Forester. Page 876 of 899 Planning Commission Meeting Minutes, September 4, 2025 Page 2 Vice Chair Einck opened the hearing to the public for comment. There was no public comment. Motion was made by Kaluza, seconded by Swaney to close the public hearing at 6:08 p.m. Voice vote was taken on the motion. Ayes – unanimous Vice Chair Einck asked for comments from the Planning Commission. • Commissioner Kaluza expressed his support for the project. Motion was made by Swaney, seconded by Tinsley to recommend to City Council approval of the Spirit of Brandtjen Farm Commercial 7th Addition preliminary and final plat, PUD Development Stage Plan and easement vacation, subject to the following stipulations: 1. Implementation of the recommendations listed in the August 25, 2025 engineering report. 2. The site shall be developed according to the plans approved by the City Council. 3. All rooftop and/or ground-mounted mechanical equipment must be screened per Zoning Ordinance requirements. 4. The City Forester has reviewed and approved the landscape plan dated June 25, 2025. Landscaping on site must be installed per the approved plan. Prior to a landscape inspection, an as-built landscape plan must be submitted to the city. 5. A $22,609.50 financial security shall be submitted to guarantee installation of the approved landscaping. 6. Park dedication of $5,400 as a cash in lieu fee, in accordance with the SBF Master PUD Agreement, must be paid at the time of final plat approval. 7. Exterior lighting shall have a 90-degree horizontal cutoff and shall be limited to a height of 35 feet or less in compliance with Section 11-16-17 of the Zoning Ordinance. 8. Snow storage shall not occur within required parking spaces. Ayes: Traffas, Kaluza, Einck, Duckworth, Swaney, Swenson, Tinsley Nays: 0 There being no further business the meeting was adjourned at 6:09 p.m. Respectfully submitted, Dawn Erickson, Community Development Recorder Page 877 of 899 City of Lakeville Community Development Memorandum To: Planning Commission From: Kris Jenson, Planning Manager Date: August 25, 2025 Subject: Packet Material for the September 4, 2025 Planning Commission Meeting Agenda Item: Spirit of Brandtjen Farm Commercial 7th Addition 1. Preliminary and final plat and PUD development stage plans of one commercial lot to be known as Spirit of Brandtjen Farm Commercial 7th Addition. 2. Vacation of public drainage and utility easements. Application Action Deadline: November 11, 2025 BACKGROUND MSP Pilot Knob, LLC have submitted applications for a preliminary and final plat to be known as Spirit of Brandtjen Farm Commercial 7th Addition for one commercial lot and one outlot as well as the vacation of public drainage and utility easements for the development of a multi-tenant building, of which Grow Pediatrics will be a tenant. The plat is 2.95 acres in area. The subject property is currently an outlot within the Spirit of Brandtjen Farm (SBF) commercial area and is zoned PUD, Planned Unit Development. The SBF PUD was approved in 2005 and the property is located south of 160th Street (CSAH 46) and east of Pilot Knob Road. The SBF Commercial 7th Addition preliminary and final plat and site development plans have been reviewed by Engineering and Environment Resources Division staff as well as the City Forester. Page 878 of 899 2 EXHIBITS A. Location Map B. Zoning Map C. SBF Land Use Plan D. Preliminary Plat E. Final Plat F. Site Plan G. Landscape Plan H. Exterior materials I. Easement Vacation STAFF ANALYSIS P RELIMINARY AND FINAL PLAT Comprehensive Plan. The SBF Commercial 7th Addition property is located in Planning District 3, Northeast Lakeville, and is guided for commercial uses in the 2040 Comprehensive Land Use Plan. The proposed commercial use is consistent with the commercial designation of the Comprehensive Land Use Plan. Zoning. The SBF Commercial 7th Addition property is zoned PUD, Planned Unit Development District. The SBF Land Use Plan, attached as Exhibit C, guides the site for mixed use development based on the uses allowed in the O-R, Office/Residential Transition District and the C-3, General Commercial District. Development of a multi-tenant building is consistent with the SBF Land Use Plan. Surrounding Land Uses and Zoning North – Valvoline Oil Change (PUD District) South – Hy-Vee (PUD District) East – Petsmart (PUD District) West – Undeveloped land (PUD District) Consistency with the Capital Improvement Plan (CIP). No public street construction or other public funded infrastructure construction is proposed with the SBF Commercial 7th Addition final plat. All streets, sanitary sewer, water and storm sewer improvements required for the area of the SBF Commercial 7th Addition were installed by the developer with the SBF Commercial development in 2015. Lots/Blocks. The SBF Commercial 7th Addition final plat proposes one lot and one outlot on one block. The SBF PUD District does not require minimum area or width for lots being platted. The subject site is 43,672 square feet in area (1.00 acre) and is 226 feet wide. Outlot. There is one outlot in the SBF Commercial 7th Addition plat. Outlot A is intended for future development and will be retained by the property owner. Page 879 of 899 3 Access. The site is proposed to be accessed by a private drive that extends across Outlot A, SBF Commercial 1st Addition, extending east to Elmhurst Drive. No new public street construction is proposed with this plat. Existing sidewalks will be extended along the west and south property lines to provide additional pedestrian access through the site. Grading, Drainage, Erosion Control, and Utilities. Grading, drainage and erosion control plans have been submitted with the SBF Commercial 7th Addition preliminary plat. Jon Nelson, Assistant City Engineer and Maria Friedges, Environmental Resources Specialist have reviewed the site, grading, drainage and erosion control, and utility plans. A copy of the engineering report dated August 25, 2025 is attached for your review. The Engineering Division recommends approval of the preliminary and final plat subject to the recommendations outlined in the report. Tree Preservation. There are no significant trees located on the subject property. Wetlands. There are no wetlands located on the subject property. Park Dedication. Lot 1, Block 1 as shown on the preliminary and final plat is subject to park dedication requirements at the time of final plat approval. The park dedication requirements will be met as a cash fee in lieu of land at $5,400 per acre for commercial uses in accordance with the SBF Master PUD Agreement. Lot 1, Block 1 is one acre in area for a park dedication fee of $5,400. SITE P LAN Use. A 9,205 square foot, single level building is proposed to be constructed. Grow Pediatrics clinic is shown to be occupying 5,000 square feet on the east side of the building. The remainder of the building is designed to accommodate one or two users. Medical offices are consistent with the SBF Land Use Plan. Setbacks. The SBF PUD uses the C-3, General Commercial District as the base zoning for the the SBF Commercial Area, which allows 10-foot setbacks to side or rear property lines not adjacent to public right of way. The proposed building is setback 10 feet from the north property line and 15 feet from the east property line, in compliance with the setback requirements. Parking. The proposed 9,205 square foot building requires 41 parking spaces, taking into account the allowable 10% gross floor area credit and the requirement for one parking space per 200 square feet of floor area. The site plan proposes 51 parking spaces along the south and west sides of the site, including three handicap accessible spaces divided among the two front entrances. The proposed parking spaces and drive aisle dimensions and configurations comply with the requirements of the Zoning Ordinance. Parking aisles will be 24 feet in width and parking stall dimensions will be nine feet in width and 18 feet in length, which is permitted when the space accommodates two feet for a vehicle overhang. Snow storage may not occur within required parking spaces. Circulation/Loading Area. Access to the site will be from the private drive along the west side of the site. A second driveway access that will be signed for trash hauler access only, is located at the Page 880 of 899 4 northwest corner of the site. No direct driveway access to primary east-west private drive is proposed. There is a recorded access and utility easement over Outlot A to benefit Lot 1, Block 1, SBF Commercial 7th Addition. Landscaping. The landscape plan proposes overstory trees along the west and south sides of the site, foundation plantings on three sides of the building, and plantings at the drive entrance. Remaining areas will be sodded and in-ground irrigation installed. The Developer must provide a security of $22,609.50 to be paid at the time of final plat to guarantee installation of the landscaping. The City Forester has reviewed and approved the landscape plan dated June 25, 2025. Landscaping on site must be installed per the approved plan. Prior to a landscape inspection, an as-built landscape plan must be submitted to the city. Building Height. The primary building height is 19 feet, with parapets of varying heights, up to 22 feet, which complies with Zoning Ordinance requirements. Building Exterior. The primary exterior building materials are black and white brick and fiber cement panels. Brick, glazing and cast stone make up 66% of the building’s exterior materials. The remainder of the building is Grade C fiber cement and metal trim (34%), and all materials proposed comply with Zoning Ordinance requirements. The contracting materials colors are used to create a block effect that breaks up the façade of the building. Trash Enclosure. Trash for the site will be stored inside the building, at the northwest corner of the building. Signs. Wall signs are proposed at each entrance point, which is permitted by ordinance. A sign permit is required to be issued prior to the installation of any signs on site. Exterior Lighting. Three parking lot lights are proposed for the site, each with a maximum height of 30 feet. The remainder of the site lighting is mounted on the building. The photometric plan indicates that the proposed light levels complies with Zoning Ordinance requirements. All lighting fixtures shall contain a cutoff which directs the light at an angle of 90 degrees or less. All building mounted lighting must face downward onto the structure. Mechanical Equipment. Roof screening is indicated on the building elevations plans. Ground- mounted mechanical equipment must be screened with landscaping and/or fencing. Snow Storage. Snow storage may not take place in required parking spaces. EASEMENT VACATION The platted drainage and utility easements within the parent parcel are proposed to be vacated. Lot 1, Block 1 includes perimeter drainage and utility easements, while the necessary easements for Outlot A will be temporary until such time that the property is platted in lots and blocks. Page 881 of 899 5 RECOMMENDATION Community Development Department staff recommends approval of the Spirit of Brandtjen Farm Commercial 7th Addition preliminary and final plat, PUD Development Stage Plan and easement vacation, subject to the following stipulations: 1. Implementation of the recommendations listed in the August 25, 2025 engineering report. 2. The site shall be developed according to the plans approved by the City Council. 3. All rooftop and/or ground-mounted mechanical equipment must be screened per Zoning Ordinance requirements. 4. The City Forester has reviewed and approved the landscape plan dated June 25, 2025. Landscaping on site must be installed per the approved plan. Prior to a landscape inspection, an as-built landscape plan must be submitted to the city. 5. A $22,609.50 financial security shall be submitted to guarantee installation of the approved landscaping. 6. Park dedication of $5,400 as a cash in lieu fee, in accordance with the SBF Master PUD Agreement, must be paid at the time of final plat approval. 7. Exterior lighting shall have a 90-degree horizontal cutoff and shall be limited to a height of 35 feet or less in compliance with Section 11-16-17 of the Zoning Ordinance. 8. Snow storage shall not occur within required parking spaces. Page 882 of 899 Dakota County, Maxar, Microsoft 162ND ST±City of Lakeville Spirit of Brandtjen Farm Commercial 7th Add. Site Location MapPILOT KNOB RD (CSAH 31)160TH ST (CSAH 46) CITY OF APPLE VALLEY Hy-Vee Grocery EXHIBIT A Building Site Proposed plat boundary Page 883 of 899 P/OS P/OS PUD PUD PUD 162ND ST City of Lakeville Spirit of Brandtjen Farm Commercial 7th Add. Zoning MapPILOT KNOB RD (CSAH 31)160TH ST (CSAH 46) CITY OF APPLE VALLEY EXHIBIT B Building Site Plat boundary ELMNURST LNPUD PUD PUD P/OS± Page 884 of 899 CommercialCommercial/6-10 units/acre6-10 units/acre2-4 units/acre4-6 units/acre2-4 units/acre2-4 units/acre6-10 units/acreThis site plan is a conceptual drawing and merely an artist rendition used for illustrative purposes and may not reflect actual measurements/alignment.See New Home Consultant for current pricing, features, amenities and lot availability. Copyright infringement could result in legal prosecution under federal copyright law.East Lake DriveEast Lake TrailEast Lake DriveEarly Dawn Trail167th Street WestAsterbilt Lane167th Street West168th Street WestEagleview DriveEast Lak e D ri v e Dynamic DriveDream LaneDragonetteStreetevirD cimanyDHorse CourtDraft Horse Blvd168th Street West169th Street WestetnomaiDhtaP etnomaiDnejtdnarBevirD mraF167th Street WesthtaP dnomaiD erutuF170th StreetDraft Horse BlvdhtaP etnomaiDEagleview DriveliarT nairtseuqEyaW yovnEdaoR bonK toliP160th Street West CR 46FutureEast Community ParkDraftWayCommunityWoodsEast LakeCommunityTrail wayPedestrian Bridge16972 Brandtjen Farm DriveLakeville, MN 55044www.HOMESOFSPIRIT.com952.322.8700info@homesofspirit.comEXHIBITCPage 885 of 899 [16] Temporary Easementper Doc. No. 2289830& Dakota County Right of WayMap No. 265[9][20] Access Restriction as shown on Plats and per Doc. No. 3032559[21] Access Easement Per Doc. No. 3032562(Continues to Elmhurst Lane)[21] Access Easement Per Doc. No. 3032562(Continues to 162nd Street)Existing BuildingConcrete WalkConcrete WalkTrash EnclosureW/ GateTrash EnclosureW/ GateConcrete Concrete BituminousParking LotBituminous Drive& Parking LotBituminous DriveBituminous DriveBituminous DriveBituminous Drive Gravel12" RCP15" RCP18" RCP 18" RCP 21" RCP21" RCP21" RCP21" RCP21" RCP 21" RCP Storm Structure per Rec.Not Found (Buried)Inv=935.69 (Rec.)Silt FenceSilt Fence 18" RCP 15" RCP 8" PVC8" PVC8" PVC 6" PVC W.M. (Per Rec.)6" PVC Wat. Serv. (Per Rec.)6" PVC San. Serv. (Per Rec.)6 " P V C 6" PVC12" PVC W.M. (Per Rec.)6" PVC W.M. (Per Rec.)6" PVC W.M. (Per Rec.)8" PVC8" PVC8" PVC 12" RCP(Per Rec.)21" RCP18" RCP 15" RCP NO BUILDINGS[2 4 ] H i g h w a y R e s e r v a t i o n Ar e a p e r D o c . N o s . 3 1 5 3 3 6 9 & 3 2 0 6 4 9 6[25] 30 Foot WideAccess Easement perDoc. No. 3153369[25] 30 Foot WideAccess Easement perDoc. No. 3153369[25] 50 Foot WideUtility Easement perDoc. No. 3153369[25] 50 Foot WideUtility Easement perDoc. No. 3153369[28] Temporary Drainage & Utility Easementper Doc. No. 3263842[28] Temporary Drainage& Utility Easementper Doc. No. 3263842[29] 30 Foot WideUtility EasementPer Doc. No. 3263843[29] 15 Foot WideUtility EasementPer Doc. No. 3263843[29] 15 Foot WideUtility EasementPer Doc. No. 3263843Concrete8" PVC An E Line of OUTLOT A, SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION S00°07'20"W 196.00 N89°53'13"E 362.36N89°53'13"E 2285.76N Line of Sec. 1, Twp. 114, Rng. 20NW Corner of Sec. 1, Twp. 114, Rng. 20(Dakota County Cast Iron Monument)N 1/4 Corner of Sec. 1, Twp. 114, Rng. 20(Dakota County Cast Iron Monument)Drainage & Utility EasementFound 1/2 InchIron Pipe w/Cap No. 47481Found Mag NailFound Mag NailFound Mag NailHighway Reservation Areaper Doc. Nos. 3153369 & 3206496A S Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONLOT 1BLOCK 1S00°05'57"E184.63 85.23 S44°52'40"E 87.29S00°07'19"W 5.46 S89°52'40"E25.14S00°07'20"W15.00Drainage & Utility Easement Drainage & Utility EasementS89°52'40"E 138.8927.67Point of Beginning of ExceptionSW Corner of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONS89°52'40"E 275.03S Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONE Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITION& It's N'ly ExtensionN00°07'20"E 293.11 N89°52'40"W 276.58S00°13'24"E 246.2746.85Δ=0°31'35"R=5100.00 EXCEPTIONN Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONN89°53'13"E 227.45Point of Beginningof ExceptionFound Mag NailN89°52'40"W 276.91W Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONN00°13'24"W 184.81 N89°53'13"E 277.30185.94EXCEPTIONEXCEPTION EXCEPTIONPoint of Beginning of ExceptionNE Corner of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONFound 1/2 Inch Open Iron PipeFound 1/2 InchIron Pipe w/Cap No. 47481Found Mag NailFound Mag NailN89°53'13"E 218.70N00°13'24"W 196.00 S89°53'13"W 226.27S00°07'20"W 196.01N88°26'54"W 107.04N89°52'40"W 337.83N00°07'20"E 49.12 N00°05'57"W 338.39 103.77Δ=0°35'46"R=9975.00CB=S85°46'19"EC=103.777.85S00°13'24"E 388.41 118.10219.73192.41 152.45 Drainage & Utility Easement45.03 S89°46'36"W25.00OUTLOT AVICINITY MAPPROJECTPROJECT NO.: 25104COPYRIGHT 2025 CIVIL SITE GROUP INC.cREVISION SUMMARYDATE DESCRIPTIONV2.0PRELIMINARY PLAT. .. .. .. .. .. .N44565RORY L. SYNSTELIENLICENSE NO.DATEI HEREBY CERTIFY THAT THIS SURVEY,PLAN, OR REPORT WAS PREPARED BY MEOR UNDER MY DIRECT SUPERVISION ANDTHAT I AM A DULY LICENSED LANDSURVEYOR UNDER THE LAWS OF THESTATE OF MINNESOTA.7-11-2025NCLIENT Civil Engineering Surveying Landscape Architecture5000 Glenwood AvenueGolden Valley, MN 55422civilsitegroup.com612-615-0060QA/QCFIELD CREWDRAWN BYREVIEWED BYUPDATED BYCJCJRS.PRELIMINARY PLAT GENERAL NOTESPROPERTY DESCRIPTION:Outlot A, Spirit of Brandtjen Farm Commercial 1st Addition, according to the recorded plat thereof, Dakota County, Minnesota.EXCEPT:That part of Outlot A, Spirit of Brandtjen Farm Commercial 1st Addition, Dakota County, Minnesota, described as follows:Beginning at the Southwest corner of said Outlot A; thence on an assumed bearing of South 89 degrees 52 minutes 40 secondsEast, along the South line of said Outlot A, a distance of 275.03 feet to the East line of said Outlot A; thence North 00 degrees 07minutes 20 seconds East, along said East line and its Northerly extension, a distance of 293.11 feet; thence North 89 degrees 52minutes 40 seconds West, a distance of 276.58 feet to the West line of said Outlot A; thence South 00 degrees 13 minutes 24seconds East, along said West line, a distance of 246.27 feet; thence Southerly 46.85 feet, along said West line, being a tangentialcurve, concave to the West, having a central angle of 00 degrees 31 minutes 35 seconds and a radius of 5100.00 feet to the pointof beginning;AND EXCEPT:That part of Outlot A, Spirit of Brandtjen Farm Commercial 1st Addition, Dakota County, Minnesota, described as follows:Beginning at the Northeast corner of said Outlot A; thence on an assumed bearing of South 00 degrees 07 minutes 20 secondsWest, along an East line of said Outlot A, a distance of 196.00 feet; thence South 89 degrees 53 minutes 13 seconds West, adistance of 226.27 feet; thence North 00 degrees 13 minutes 24 seconds West, a distance of 196.00 feet to the North line of saidOutlot A; thence North 89 degrees 53 minutes 13 seconds East, along said North line of Outlot A, a distance of 227.45 feet to thepoint of beginning.AND EXCEPT:That part of Outlot A, Spirit of Brandtjen Farm Commercial 1st Addition, Dakota County, Minnesota, described as follows:Commencing at the Southwest corner of said Outlot A; thence on an assumed bearing of South 89 degrees 52 minutes 40seconds East, along the South line of said Outlot A, 275.03 feet to an East line of said Outlot A; thence North 00 degrees 07minutes 20 seconds East, along said East line and its Northerly extension, 293.11 feet; thence North 00 degrees 05 minutes 57seconds West, 152.45 feet to the point of beginning of the land to be described; thence North 89 degrees 52 minutes 40 secondsWest, 276.91 feet to the West line of said Outlot A; thence North 00 degrees 13 minutes 24 seconds West, along said West line,184.81 feet to the Northwest corner of said Outlot A; thence North 89 degrees 53 minutes 13 seconds East, along the North lineof said Outlot A, 277.31 feet to the intersection of a line bearing North 00 degrees 05 minutes 57 seconds West, from the point ofbeginning; thence South 00 degrees 05 minutes 57 seconds East, 185.94 feet to the point of beginning.AND EXCEPT:Lot 1, Block 1, Spirit of Brandtjen Farm Commercial 4th Addition, Dakota County, Minnesota.This map and report was prepared with the benefit of a Commitment for Title Insurance issued by Commercial Partners Title, adivision of Chicago Title Insurance Company as agent for Chicago Title Insurance Company, File No. CP75362, dated May 13,2025.DATE OF PREPARATION:7-11-2025Please note that the background survey information is per a survey performed by us dated 6-16-2025.APPLICANT:MSP Commercial6436 Penn Ave SRichfield, MN 55423Steve Miller651-287-8787smiller@mspcommercial.comBENCHMARKS:Elevations are on an assumed datum based on plans by James R. Hill dated 4/18/2018 (Revised 5/17/2018), provided to us bythe client. Site Benchmark is the top nut of the fire hydrant located on the north side of the east/west bituminous drive throughthe middle portion of the subject property, as shown hereon.Elevation = 948.27.AREAS:Proposed Lot 1 = 43,672 Sq. Ft. or 1.003 AcresProposed Outlot A = 85,014Sq. Ft. or 1.951 AcresTotal Area = 128,686Sq. Ft. or 2.954 AcresFLOOD ZONE:This property is contained in Zone X (area determined to be outside the 0.2% annual chance floodplain) per Flood Insurance RateMap, Community Panel No. 27037C0208E, effective date of December 2, 2011.________________________________________________________Rory L. Synstelien Minnesota License No. 44565rory@civilsitegroup.comPRELIMINARY PLAT: SPIRIT OF BRANDTJEN FARM COMMERCIAL 7TH ADDITIONOVERHEAD UTILITIESGASMAINSANITARY SEWERSTORM SEWERFIBER/COMM. LINEELECTRIC LINE (RECORD)WATERMAINELECTRIC LINEGASMAIN (RECORD)CHAINLINK FENCE LINELinetype & Symbol Legend CONCRETE SURFACEPAVER SURFACEBITUMINOUS SURFACEGRAVEL/LANDSCAPE SURFACEIRON FENCE LINEGUARDRAILWATERMAIN (RECORD)SANITARY SEWER (RECORD)STORM SEWER (RECORD)FIBER/COMM. LINE (RECORD)TELEPHONE LINE (RECORD)TELEPHONE LINESIGNSANITARY MANHOLESTORM MANHOLECABLE TV BOXTELEPHONE MANHOLEELECTRIC TRANSFORMERTELEPHONE BOXTRAFFIC SIGNALGAS METERELECTRICAL METERWATER MANHOLEWATER VALVEAIR CONDITIONERBOLLARDCATCH BASINELECTRIC MANHOLEGAS VALVEFLAG POLEHANDICAP SYMBOLFOUND IRON MONUMENTHYDRANTCAST IRON MONUMENTSET OR TO BE SET IRON MONUMENTFLARED END SECTIONPOWER POLEUTILITY MANHOLEGUY WIRECONIFEROUS TREEDECIDUOUS TREEROOF DRAINSEWER CLEAN OUTFIRE CONNECTIONWELLUTILITY VAULTPOST INDICATOR VALVEGAS MANHOLEHAND HOLEFIBER/COMM. MANHOLEMAIL BOXFUEL TANKELECTRICAL OUTLETSB SOIL BORINGLIGHT POLEACCESS RESTRICTIONWOODEN FENCE LINESATELLITE DISHBUSH/SHRUBPart of Outlot A, Spirit of Brandtjen Farm Commercial 1st Addition Address Unassigned, 160th Street West, Lakeville, Dakota County, Minnesota 55044 6436 Penn Avenue S, Richfield, MN 55423 MSP Commercial 60153001530SCALE IN FEETEXHIBIT DPage 886 of 899 An E Line of OUTLOT A, SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION S00°07'20"W 196.00 N89°53'13"E 362.36N89°53'13"E 2285.76N Line of Sec. 1, Twp. 114, Rng. 20NW Corner of Sec. 1, Twp. 114, Rng. 20(Dakota County Cast Iron Monument)N 1/4 Corner of Sec. 1, Twp. 114, Rng. 20(Dakota County Cast Iron Monument)Drainage & Utility EasementFound 1/2 InchIron Pipe w/Cap No. 47481Found Mag NailFound Mag NailFound Mag NailHighway Reservation Areaper Doc. Nos. 3153369 & 3206496A S Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONLOT 1BLOCK 1S00°05'57"E 184.63 85.23 S44°52'40"E 87.29S00°07'19"W 5.46 S89°52'40"E25.14S00°07'20"W15.00Drainage & Utility Easement Drainage & Utility EasementS89°52'40"E 138.8927.67Point of Beginning of ExceptionSW Corner of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONS89°52'40"E 275.03S Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONE Line of OUTLOT A, SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION & It's N'ly Extension N00°07'20"E 293.11 N89°52'40"W 276.58S00°13'24"E 246.2746.85Δ=0°31'35"R=5100.00 EXCEPTIONN Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONN89°53'13"E 227.45Point of Beginningof ExceptionFound Mag NailN89°52'40"W 276.91W Line of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONN00°13'24"W 184.81 N89°53'13"E 277.30185.94EXCEPTIONEXCEPTION EXCEPTIONPoint of Beginning of ExceptionNE Corner of OUTLOT A, SPIRIT OFBRANDTJEN FARM COMMERCIAL 1ST ADDITIONFound 1/2 Inch Open Iron PipeFound 1/2 InchIron Pipe w/Cap No. 47481Found Mag NailFound Mag NailN89°53'13"E 218.70N00°13'24"W 196.00 S89°53'13"W 226.27S00°07'20"W 196.01N88°26'54"W 107.04N89°52'40"W 337.83N00°07'20"E 49.12 N00°05'57"W 338.39 103.77Δ=0°35'46"R=9975.00CB=S85°46'19"EC=103.777.85S00°13'24"E 388.41 118.10219.73192.41 152.45 OUTLOT ASPIRIT OF BRANDTJEN FARM COMMERCIAL 7TH ADDITIONDenotes a Cast Iron Monument.Denotes a set Nail with Disk Marked "RLS 44565"NBearings are based on the north line of OUTLOT A,SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITIONhaving an assumed bearing of N 89°53'13" E.Denotes a Found Iron Monument (Type as shown on plat)OFFICIAL PLAT60153001530SCALE IN FEETVICINITY MAPSEC. 1 - T114 - R20DAKOTA COUNTY, MINNESOTANNOT TO SCALESHEET 2 OF 2 SHEETSDenotes Restricted Access Per Doc. No. 3032559 EXHIBIT EPage 887 of 899 S89°53'13"W 226.27S00°07'20"W 196.01N88°26'54"W 107.04N89°52'40"W 337.83[10] Drainage & Utility Easement per plat ofSPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION[26] Storm Maintenance Easement per Doc. No. 3185641[21] Access Easement Per Doc. No. 3032562(Continues to Elmhurst Lane)Concrete WalkConcrete WalkTrash EnclosureW/ GateTrash EnclosureW/ GateConcrete Concrete BituminousParking LotBituminous Drive& Parking LotBituminous DriveBituminous Drive 12" RCP18" RCP 21" RCP21" RCP21"RCP21" RCP 21" RCP Storm Structure per Rec.Not Found (Buried)Inv=935.69 (Rec.)18" RCP 15"RCP 8" PVC8" PVC8" PVC6" PVC W.M. (Per Rec.)6" PVC Wat. Serv. (Per Rec.)6" PVC San. Serv. (Per Rec.)6" PVC 6" PVC12" PVC W.M. (Per Rec.)12" RCP(Per Rec.)21" RCP18" RCP 15" RCP Found 1/2 InchIron Pipe w/Cap No. 47481Found Mag NailFound Mag NailFound Mag Nail[25] 30 Foot WideAccess Easement perDoc. No. 3153369[25] 50 Foot WideUtility Easement perDoc. No. 3153369[28] Temporary Drainage & Utility Easementper Doc. No. 3263842[28] Temporary Drainageper Doc. No. 3263842[29] 15 Foot WideUtility EasementPer Doc. No. 3263843PID: 227132000013Address: UnassignedOwner: Hy-Vee IncPID: 227135501010Address: 16001 Elmhurst LnOwner: Thomas Joseph &Connie Lee Baron TrusteesConcrete8" PVC UP103105106104 101 102 6112014CONSTRUCTIONLIMITSCONSTRUCTIONLIMITSBLDG AREA: 9,205 SFSITE AREA: 43,672 SF51 PARKING STALLSACCESSIBLE ROUTEARROW. DO NOTPAINT, FOR CODEREVIEW ONLY, TYP.R15.0R15.0R3.0 R3.0R3.0R8.0R3.0R8.0R3.0 ACCESSIBLE PARKINGSPACE, INCL. SIGNAGE,STRIPING AND RAMPSCONCRETESIDEWALK,TYP.B612 CURB &GUTTER, TYP.B612 CURB &GUTTER, TYP.CONCRETE SIDEWALK,TYP.CONCRETE DRIVEWAYAPRON PER CITYSTANDARDS, TYP.H.D. BIT. PVMT.,TYP,PVMT.MARKINGS, TYP.MATCH, TYP.MATCH, TYP.MATCH, TYP.PED RAMP,SEE DETAILS,TYP.THICKENED EDGEDCONCRETE SIDEWALK,TYP.MATCH, TYP.CONC.VALLEYGUTTER6.718.024.018.09.0TYP.7.718.024.018.08.310.010.015.315.09.0TYP.3.05.02.05.95.015.05.05.018.05.63.34.711.05.77.39.0TYP.3.315.0TOTOTOTOTOTOL.D. BIT. PVMT.,TYP,10' BUILDING SETBACK5' PARKING SETBACK15' BUILDING SETBACK5' PARKING SETBACKCONCRETE DRIVEWAYAPRON FOR TRASHPICKUP ONLYR3. 0R3.03' CURB TAPER3' CURB TAPER7' CURB TAPER7' CURB TAPER9' CURB TAPER9' CURB TAPER9.0TYP.D412 CURB &GUTTER, TYP.5' DU EASEMENT(PUBLIC)5' DU EASEMENT(PUBLIC)25' DU EASEMENT(PUBLIC)DU EASEMENT(PUBLIC)10' DU EASEMENT(PRIVATE)DU EASEMENT(PRIVATE)SIGN TYP.DO NOT ENTER , TRUCKTRASH HAULER ONLYPICK UP TO BESCHEDULED ON NONBUSINESS HRS.SITE DATAZONING SUMMARYEXISTING ZONINGPUDPROPOSED ZONINGPUDREQUIREDPROVIDEDBUILDING SETBACKSFRONTREAR10 FT10 FTSIDE15 FT15 FTPARKING SETBACKSFRONT15 FT15 FTREAR5 FT5 FTSIDE5 FT5 FTREQUIREDPROVIDEDPARKING SUMMARYPARKING STALLDIMENSIONS20 FT X 9 FT18 FT X 9 FT(OVERLAP)COMPACT PARKINGSTALL DIMENSIONS16 FT X 8 FTN/ADRIVE AISLEDIMENSIONS24 FT24 FTFIRE ACCESS ROADDIMENSIONSN/AN/AREQUIREDPROVIDEDPARKING STALLS -SURFACE4651PARKING STALLS -GARAGEN/AN/ACOPYRIGHT CIVIL SITE GROUP INC.cPROJECT P R E L I M I N A R Y : N O T F O R C O N S T R U C T I O N2025ISSUE/SUBMITTAL SUMMARYDATEDESCRIPTION06/25/2025 CITY SUBMITTALPROJECT MANAGER PATRICK SARVERCONTACT NUMBER 612-615-0060 X 702DRAWN BYBNREVIEWED BY PSPROJECT NUMBER 25104 GROW PEDS LAKEVILLE PART OF OUTLOT A, 160TH STREET WEST, LAKEVILLE, MN 55044 MSP COMMERCIAL 6436 PENN AVE S, RICHFIELD, MN 5542324904Patrick J. SarverLICENSE NO.DATEI HEREBY CERTIFY THAT THIS PLAN,SPECIFICATION, OR REPORT WASPREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULYLICENSED LANDSCAPE ARCHITECT UNDERTHE LAWS OF THE STATE OF MINNESOTA.06/25/2025Civil Engineering ° Surveying ° LandscapeArchitecture5000 Glenwood AvenueGolden Valley, MN 55422civilsitegroup.com612-615-0060OWNER SITE LAYOUT NOTES:SITE PLAN LEGEND:TRAFFIC DIRECTIONAL ARROW PAVEMENT MARKINGSSIGN AND POST ASSEMBLY. SHOP DRAWINGS REQUIRED.HC = ACCESSIBLE SIGNNP = NO PARKING FIRE LANEST = STOPCP = COMPACT CAR PARKING ONLYPROPERTY LINECURB AND GUTTER-SEE NOTES (T.O.) TIP OUT GUTTERWHERE APPLICABLE-SEE PLANLIGHT DUTY BITUMINOUS PAVEMENT (IF APPLICABLE). SEEGEOTECHNICAL REPORT FOR AGGREGATE BASE & WEARCOURSE DEPTH, SEE DETAIL.HEAVY DUTY BITUMINOUS PAVEMENT (IF APPLICABLE). SEEGEOTECHNICAL REPORT FOR AGGREGATE BASE & WEARCOURSE DEPTH, SEE DETAIL.CONSTRUCTION LIMITSTOCITY OF LAKEVILLE SITE SPECIFIC NOTES:1. RESERVED FOR CITY SPECIFIC SITE NOTES.ACCESSIBILITY ROUTE ARROW (IF APPLICABLE) DO NOT PAINT.1. ALL EXISTING UTILITY LOCATIONS SHOWN ARE APPROXIMATE. CONTACT "GOPHER STATE ONE CALL" (651-454-0002 OR 800-252-1166) FOR UTILITY LOCATIONS, 48 HOURS PRIOR TOCONSTRUCTION. THE CONTRACTOR SHALL REPAIR OR REPLACE ANY UTILITIES THAT ARE DAMAGED DURING CONSTRUCTION AT NO COST TO THE OWNER.2. CONTRACTOR SHALL VERIFY LOCATIONS AND LAYOUT OF ALL SITE ELEMENTS PRIOR TO BEGINNING CONSTRUCTION, INCLUDING BUT NOT LIMITED TO, LOCATIONS OF EXISTING ANDPROPOSED PROPERTY LINES, EASEMENTS, SETBACKS, UTILITIES, BUILDINGS AND PAVEMENTS. CONTRACTOR IS RESPONSIBLE FOR FINAL LOCATIONS OF ALL ELEMENTS FOR THE SITE. ANYREVISIONS REQUIRED AFTER COMMENCEMENT OF CONSTRUCTION, DUE TO LOCATIONAL ADJUSTMENTS SHALL BE CORRECTED AT NO ADDITIONAL COST TO OWNER. ADJUSTMENTS TO THELAYOUT SHALL BE APPROVED BY THE ENGINEER/LANDSCAPE ARCHITECT PRIOR TO INSTALLATION OF MATERIALS. STAKE LAYOUT FOR APPROVAL.3. THE CONTRACTOR SHALL OBTAIN ALL NECESSARY PERMITS PRIOR TO CONSTRUCTION, INCLUDING A RIGHT-OF-WAY AND STREET OPENING PERMIT.4. THE CONTRACTOR SHALL VERIFY RECOMMENDATIONS NOTED IN THE GEO TECHNICAL REPORT PRIOR TO INSTALLATION OF SITE IMPROVEMENT MATERIALS.5. CONTRACTOR SHALL FIELD VERIFY COORDINATES AND LOCATION DIMENSIONS & ELEVATIONS OF THE BUILDING AND STAKE FOR REVIEW AND APPROVAL BY THE OWNERS REPRESENTATIVEPRIOR TO INSTALLATION OF FOOTING MATERIALS.6. LOCATIONS OF STRUCTURES, ROADWAY PAVEMENTS, CURBS AND GUTTERS, BOLLARDS, AND WALKS ARE APPROXIMATE AND SHALL BE STAKED IN THE FIELD, PRIOR TO INSTALLATION, FORREVIEW AND APPROVAL BY THE ENGINEER/LANDSCAPE ARCHITECT.7. CURB DIMENSIONS SHOWN ARE TO FACE OF CURB. BUILDING DIMENSIONS ARE TO FACE OF CONCRETE FOUNDATION. LOCATION OF BUILDING IS TO BUILDING FOUNDATION AND SHALL BE ASSHOWN ON THE DRAWINGS.8. THE CONTRACTOR SHALL SUBMIT SHOP DRAWINGS OR SAMPLES AS SPECIFIED FOR REVIEW AND APPROVAL BY THE ENGINEER/LANDSCAPE ARCHITECT PRIOR TO FABRICATION FOR ALLPREFABRICATED SITE IMPROVEMENT MATERIALS SUCH AS, BUT NOT LIMITED TO THE FOLLOWING, FURNISHINGS, PAVEMENTS, WALLS, RAILINGS, BENCHES, FLAGPOLES, LANDING PADS FORCURB RAMPS, AND LIGHT AND POLES. THE OWNER RESERVES THE RIGHT TO REJECT INSTALLED MATERIALS NOT PREVIOUSLY APPROVED.9. PEDESTRIAN CURB RAMPS SHALL BE CONSTRUCTED WITH TRUNCATED DOME LANDING AREAS IN ACCORDANCE WITH A.D.A. REQUIREMENTS-SEE DETAIL.10. CROSSWALK STRIPING SHALL BE 24" WIDE WHITE PAINTED LINE, SPACED 48" ON CENTER PERPENDICULAR TO THE FLOW OF TRAFFIC. WIDTH OF CROSSWALK SHALL BE 5' WIDE. ALL OTHERPAVEMENT MARKINGS SHALL BE WHITE IN COLOR UNLESS OTHERWISE NOTED OR REQUIRED BY ADA OR LOCAL GOVERNING BODIES.11. SEE SITE PLAN FOR CURB AND GUTTER TYPE. TAPER BETWEEN CURB TYPES-SEE DETAIL.12. ALL CURB RADII ARE MINIMUM 3' UNLESS OTHERWISE NOTED.13. CONTRACTOR SHALL REFER TO FINAL PLAT FOR LOT BOUNDARIES, NUMBERS, AREAS AND DIMENSIONS PRIOR TO SITE IMPROVEMENTS.14. FIELD VERIFY ALL EXISTING SITE CONDITIONS, DIMENSIONS.15. PARKING IS TO BE SET PARALLEL OR PERPENDICULAR TO EXISTING BUILDING UNLESS NOTED OTHERWISE.16. ALL PARKING LOT PAINT STRIPING TO BE WHITE, 4" WIDE TYP.17. BITUMINOUS PAVING TO BE "LIGHT DUTY" UNLESS OTHERWISE NOTED. SEE DETAIL SHEETS FOR PAVEMENT SECTIONS.18. ALL TREES THAT ARE TO REMAIN ARE TO BE PROTECTED FROM DAMAGE WITH A CONSTRUCTION FENCE AT THE DRIP LINE. SEE LANDSCAPE DOCUMENTS.19. CONTRACTOR IS RESPONSIBLE TO INSTALL ANY SIDEWALK AND CURBING PER DESIGN PLAN. CONTRACTOR TO VERIFY ALL CURBS AND SIDEWALKS WILL DRAIN PROPERLY IN FIELDCONDITIONS. CONTRACTOR MUST CONTACT THE CIVIL ENGINEER 24-HOURS PRIOR TO ANY CURB AND/OR SIDEWALK INSTALLATION TO REVIEW AND INSPECT CURB STAKES. CONTRACTOR ISRESPONSIBLE FOR ANY CURB OR SIDEWALK REPLACEMENT IF THIS PROCEDURE IS NOT FOLLOWED.20. FINISH GRADING FOR HARDSCAPE AREAS IE. PARKING LOTS, CURBS, SIDEWALKS SHALL BE WITHIN 0.05 FEET. ADA AREAS MUST COMPLY WITH REQUIREMENTS ON PLANS AND ADAREGULATIONS. TOLERANCE WITHIN ADA AREAS IS 0.00 FEET DISCUSS ANY DEVIATIONS WITH ENGINEER PRIOR TO CONSTRUCTION. CONTRACTOR IS RESPONSIBLE FOR ANY CURB, SIDEWALKAND/OR PAVEMENT REPLACEMENT THAT DOES NOT MEET TOLERANCE/ADA REQUIREMENTS.CONCRETE PAVEMENT (IF APPLICABLE) AS SPECIFIED (PADOR WALK) SEE GEOTECHNICAL REPORT FOR AGGREGATEBASE & CONCRETE DEPTHS, WITHIN ROW SEE CITY DETAIL,WITHIN PRIVATE PROPERTY SEE CSG DETAILREVISION SUMMARYDATEDESCRIPTIONC2.0SITE PLANOPERATIONAL NOTESSNOW REMOVALALL SNOW SHALL BE STORED ON-SITE OUTSIDEPARKING LOT. WHEN FULL, REMOVAL CO. SHALLREMOVE EXCESS OFF-SITE.TRASH REMOVALTRASH SHALL BE PLACED IN INTERIOR SOLIDWASTE COLLECTION POINT, MOVED TOTEMPORARY EXTERIOR LOCATION ONCOLLECTION DAY AND REMOVED BYCOMMERCIAL CO.DELIVERIESDELIVERIES SHALL OCCUR AT THE FRONT DOORVIA STANDARD COMMERCIAL DELIVERYVEHICLES (UPS, FED-EX, USPS).01" = 20'-0"20'-0"10'-0"NKnow what'sbelow.before you dig.CallROWNER INFORMATIONMSP COMMERCIAL6436 PENN AVE SRICHFIELD, MN 55423STEVE MILLER651-270-6397SMILLER@MSPCOMMERCIAL.COMEXHIBIT FPage 888 of 899 S89°53'13"W 226.27S00°07'20"W 196.01N88°26'54"W 107.04N89°52'40"W 337.83SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION[26] Storm Maintenance Easement per Doc. No. 3185641[21] Access Easement Per Doc. No. 3032562(Continues to Elmhurst Lane)Concrete WalkConcrete WalkConcrete Concrete8" PVC8" PVC8" PVC6" PVC W.M. (Per Rec.)6" PVC Wat. Serv. (Per Rec.)6" PVC San. Serv. (Per Rec.)6" PVC 6" PVC12" PVC W.M. (Per Rec.)Found 1/2 InchIron Pipe w/Cap No. 47481Found Mag NailFound Mag NailFound Mag Nail[25] 30 Foot WideAccess Easement perDoc. No. 3153369[25] 50 Foot WideUtility Easement perDoc. No. 3153369[28] Temporary Drainage & Utility Easementper Doc. No. 3263842PID: 227132000013Address: UnassignedPID: 227135501010Address: 16001 Elmhurst LnOwner: Thomas Joseph &Connie Lee Baron TrusteesConcrete8" PVC UP103105106104 101 102 CONSTRUCTIONLIMITSCONSTRUCTIONLIMITS10' BUILDING SETBACK5' PARKING SETBACK15' BUILDING SETBACK5' PARKING SETBACK2 - GC22 - GC22 - QB1 - QB2 - PN25 - SS5 - PN27 - SS7 - PN27 - SS5 - PN25 - ZA5 - NW27 - PN26 - SS7 - PN27 - NW27 - ZA7 - NW29 - SS9 - ZA3 - SH2 - NW23 - SH2 - ZA3 - SH2 - NW22 - SHPLANTING BEDS TO USEDSAME ROCK AS INMAINTENANCE STRIP, TYP.LANDSCAPEEDGER, TYP.SOD, TYP.4 - HC25 - HX35 - NW258 - NW26 - HC26 - HX5 - HC26 - HXSITE DATAZONING SUMMARYEXISTING ZONINGPUDPROPOSED ZONINGPUDREQUIREDPROVIDEDBUILDING SETBACKSFRONTREAR10 FT10 FTSIDE15 FT15 FTPARKING SETBACKSFRONT15 FT15 FTREAR5 FT5 FTSIDE5 FT5 FTREQUIREDPROVIDEDPARKING SUMMARYPARKING STALLDIMENSIONS20 FT X 9 FT18 FT X 9 FT(OVERLAP)CODE COMMON / BOTANICAL NAMEQTYCONT NATIVE PLANTS POLLINATOR FRIENDLYTREESGC2 True North™ Kentucky Coffeetree / Gymnocladus dioica 'UMNSynergy'42.5" Cal. B&B NATIVE CULTIVARNQB Prairie Stature Oak / Quercus x bimundorm 'Midwest'3 2.5" Cal. B&B NOT NATIVEYSUBTOTAL:7CODE COMMON / BOTANICAL NAMEQTYSIZE NATIVE PLANTS POLLINATOR FRIENDLYGRASSESPN2Shenandoah Switch Grass / Panicum virgatum `Shenandoah`33 36" HT.NATIVE CULTIVARYSS Standing Ovation Little Bluestem Grass / Schizachyrium scoparium `Standing Ovation`34 24" HT.NATIVE CULTIVARYSH Prairie Dropseed / Sporobolus heterolepis11 18" HT. NATIVEYSUBTOTAL:78PERENNIALSHXSunday Gloves Daylily / Hemerocallis x `Sunday Gloves`17 24" HT. NOT NATIVEYHC2 Coral Bells / Heuchera x `Cajun Fire`15 18" HT. NOT NATIVEYNW2 Walkers Low Catmint / Nepeta x faassenii `Walkers Low`116 18" HT. NOT NATIVEYZAGolden Alexander / Zizia aurea23 18" HT.NATIVEYSUBTOTAL:171PLANT SCHEDULE: TREES, SHRUBS AND PERENNIALSSYMBOL COMMON / BOTANICAL NAMEQTYSIZEMAINTENANCE STRIPROCK MAINTENANCE STRIP / ROCK MAINTENANCE STRIP1.5" DECORATIVE SCREENED ROCK/STONE INSTALLED 3"DEEP OVER GEOTEXTILE FABRIC. PROVIDE EDGING ASSHOWN ON LANDSCAPE PLAN.1,198 sfMulchSUBTOTAL:1,198 sfSODBLUE GRASS SOD / SODBLUE GRASS SOD W/IMPROVED VARIATIES, INSTALLEDON PREPARED SOIL, CONTAINING 6" OF TOPSOILW/MINIMUM 4% ORGANICS BY WEIGHT. SCARIFIED ANDEVENLY GRADED. BIG ROLL PREFERRED FOR LARGERAREAS.6,847 sfSodSUBTOTAL:6,847 sfGROUND COVER SCHEDULEL1.0LANDSCAPE PLANCOPYRIGHT CIVIL SITE GROUP INC.cPROJECT P R E L I M I N A R Y : N O T F O R C O N S T R U C T I O N2025ISSUE/SUBMITTAL SUMMARYDATEDESCRIPTION06/25/2025 CITY SUBMITTALPROJECT MANAGER PATRICK SARVERCONTACT NUMBER612-615-0060 X 702DRAWN BYBNREVIEWED BY PSPROJECT NUMBER25104GROW PEDS LAKEVILLE PART OF OUTLOT A, 160TH STREET WEST, LAKEVILLE, MN 55044 MSP COMMERCIAL 6436 PENN AVE S, RICHFIELD, MN 5542324904Patrick J. SarverLICENSE NO.DATEI HEREBY CERTIFY THAT THIS PLAN,SPECIFICATION, OR REPORT WASPREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULYLICENSED LANDSCAPE ARCHITECT UNDERTHE LAWS OF THE STATE OF MINNESOTA.06/25/2025Civil Engineering ° Surveying ° LandscapeArchitecture5000 Glenwood AvenueGolden Valley, MN 55422civilsitegroup.com612-615-0060OWNER LANDSCAPE NOTES:PROPOSED PERENNIAL PLANT SYMBOLS - SEE PLANTSCHEDULE AND PLAN FOR SPECIES AND PLANTING SIZESPROPOSED DECIDUOUS AND EVERGREEN SHRUB SYMBOLS - SEEPLANT SCHEDULE AND PLAN FOR SPECIES AND PLANTING SIZESPROPOSED ORNAMENTAL TREE SYMBOLS - SEE PLANT SCHEDULE ANDPLAN FOR SPECIES AND PLANTING SIZESPROPOSED EVERGREEN TREE SYMBOLS - SEE PLANT SCHEDULE ANDPLAN FOR SPECIES AND PLANTING SIZESPROPOSED CANOPY TREE SYMBOLS - SEEPLANT SCHEDULE AND PLAN FOR SPECIESAND PLANTING SIZESDECORATIVE BOULDERS (ROUNDED & BLOCK STYLE), 18"-30" DIA.LANDSCAPE PLAN LEGEND:EDGING - SHALL BE COMMERCIAL GRADE, 4" DEPTH ALUMINUM, BLACK ORDARK GREEN IN COLOR, INCLUDE ALL CONNECTORS, STAKES, & ALLAPPURTENANCES PER MANUF. INSTALL PER MANUF. INSTRUC./SPECS.CONSTRUCTION LIMITSREVISION SUMMARYDATEDESCRIPTION01" = 20'-0"20'-0"10'-0"NKnow what'sbelow.before you dig.CallRMULCH SCHEDULEAREAMULCH TYPEEDGING FABRICREMARKSTREE RINGS4" DEPTH, SHREDDED HARDWOODYESNOSEE DETAIL SHT. L1.1PLANTING BEDS3" DECORATIVE ROCK MULCHYESNOMAINT. STRIP AT BUILDING FOUNDATION 3" DECORATIVE ROCK MULCHNANANOTE: COORDINATE ALL MULCH AND PLANTING BED MATERIAL PRIOR TO INSTALLATION, PROVIDE SAMPLES AND SHOP DRAWINGS/PHOTOS/DATA SHEETS OF ALLMATERIALS1. ALL EXISTING UTILITY LOCATIONS SHOWN ARE APPROXIMATE. CONTACT "GOPHER STATE ONE CALL" (651-454-0002 OR 800-252-1166) FOR UTILITY LOCATIONS, 48 HOURS PRIOR TO CONSTRUCTION. THECONTRACTOR SHALL REPAIR OR REPLACE ANY UTILITIES THAT ARE DAMAGED DURING CONSTRUCTION AT NO COST TO THE OWNER.2. REFERENCE MULCH SCHEDULE FOR MULCH MATERIALS AND LOCATIONS.3. ALL TREES SHALL BE MULCHED WITH SHREDDED HARDWOOD MULCH TO OUTER EDGE OF SAUCER OR TO EDGE OF PLANTING BED, IF APPLICABLE. ALL MULCH SHALL BE KEPT WITHIN A MINIMUM OF 2" FROM TREETRUNK.4. IF SHOWN ON PLAN, RANDOM SIZED LIMESTONE BOULDERS COLOR AND SIZE TO COMPLIMENT NEW LANDSCAPING. OWNER TO APPROVE BOULDER SAMPLES PRIOR TO INSTALLATION.5. PLANT MATERIALS SHALL CONFORM WITH THE AMERICAN ASSOCIATION OF NURSERYMEN STANDARDS AND SHALL BE OF HARDY STOCK, FREE FROM DISEASE, DAMAGE AND DISFIGURATION. CONTRACTOR ISRESPONSIBLE FOR MAINTAINING PLUMPNESS OF PLANT MATERIAL FOR DURATION OF ACCEPTANCE PERIOD.6. UPON DISCOVERY OF A DISCREPANCY BETWEEN THE QUANTITY OF PLANTS SHOWN ON THE SCHEDULE AND THE QUANTITY SHOWN ON THE PLAN, THE PLAN SHALL GOVERN.7. CONDITION OF VEGETATION SHALL BE MONITORED BY THE LANDSCAPE ARCHITECT THROUGHOUT THE DURATION OF THE CONTRACT. LANDSCAPE MATERIALS PART OF THE CONTRACT SHALL BE WARRANTED FORTWO (2) FULL GROWING SEASONS FROM SUBSTANTIAL COMPLETION DATE.8. ALL AREAS DISTURBED BY CONSTRUCTION ACTIVITIES SHALL RECEIVE 6" LAYER TOPSOIL AND SOD AS SPECIFIED UNLESS OTHERWISE NOTED ON THE DRAWINGS.9. COORDINATE LOCATION OF VEGETATION WITH UNDERGROUND AND OVERHEAD UTILITIES, LIGHTING FIXTURES, DOORS AND WINDOWS. CONTRACTOR SHALL STAKE IN THE FIELD FINAL LOCATION OF TREES ANDSHRUBS FOR REVIEW AND APPROVAL BY THE LANDSCAPE ARCHITECT PRIOR TO INSTALLATION.10. ALL PLANT MATERIALS SHALL BE WATERED AND MAINTAINED UNTIL ACCEPTANCE.11. REPAIR AT NO COST TO OWNER ALL DAMAGE RESULTING FROM LANDSCAPE CONTRACTOR'S ACTIVITIES.12. SWEEP AND MAINTAIN ALL PAVED SURFACES FREE OF DEBRIS GENERATED FROM LANDSCAPE CONTRACTOR'S ACTIVITIES.13. PROVIDE SITE WIDE IRRIGATION SYSTEM DESIGN AND INSTALLATION. SYSTEM SHALL BE FULLY PROGRAMMABLE AND CAPABLE OF ALTERNATE DATE WATERING. THE SYSTEM SHALL PROVIDE HEAD TO HEAD ORDRIP COVERAGE AND BE CAPABLE OF DELIVERING ONE INCH OF PRECIPITATION PER WEEK. SYSTEM SHALL EXTEND INTO THE PUBLIC RIGHT-OF-WAY TO THE EDGE OF PAVEMENT/BACK OF CURB.14. CONTRACTOR SHALL SECURE APPROVAL OF PROPOSED IRRIGATION SYSTEM INCLUDING PRICING FROM OWNER, PRIOR TO INSTALLATION.DRAWN @ ? sizePERENNIAL BED PLANTINGN T SPLANT TOP OF ROOTBALL 1-2" ABOVE ABOVESURROUNDING GRADEROOTS AT OUTER EDGE OF ROOTBALL LOOSENED TOENSURE PROPER BACKFILL-TO-ROOT CONTACTSLOPE SIDES OF HOLE OR VERTICAL SIDES AT EDGE OFPLANTING BEDEXISTING GRADEROCK OR ORGANIC MULCH, SEE GENERAL LANDSCAPENOTES AND PLAN NOTES FOR MULCH TYPE. KEEP MULCHMIN. 2" FROM PLANT STEMBACKFILL AS PER SPECIFICATIONDO NOT EXCAVATE BELOW ROOTBALL.SIZE VARIESSEE LANDSCAPE PLANMODIFY EXCAVATION BASED ON LOCATION OF PLANTMATERIAL AND DESIGN OF BEDS OR OVERALL PLANTPLACEMENT2THREE TIMES WIDTHOF ROOTBALLDECIDUOUS & CONIFEROUS TREE PLANTINGN T SPRUNE AS FIELD DIRECTED BY THE LANDSCAPEARCHITECT TO IMPROVE APPEARANCE (RETAIN NORMALTREE SHAPE)THREE 2"X4"X8' WOODEN STAKES, STAINED BROWN WITHTWO STRANDS OF WIRE TWISTED TOGETHER. STAKESSHALL BE PLACED AT 120° TO ONE ANOTHER. WIRE SHALLBE THREADED THROUGH NYLON STRAPPING WITHGROMMETS. ALTERNATE STABILIZING METHODS MAY BEPROPOSED BY CONTRACTOR.TRUNK FLARE JUNCTION: PLANT TREE 1"-2" ABOVEEXISTING GRADEMULCH TO OUTER EDGE OF SAUCER OR TO EDGE OFPLANTING BED, IF APPLICABLE. ROCK OR ORGANIC MULCH,SEE GENERAL LANDSCAPE NOTES AND PLAN NOTES FORMULCH TYPE. KEEP MULCH MIN. 2" FROM PLANT TRUNKEXISTING GRADECUT AND REMOVE BURLAP FROM TOP 1/3 OF ROOT BALL. IFNON-BIODEGRADABLE, REMOVE COMPLETELYSLOPE SIDES OF HOLE OR VERTICAL SIDES AT EDGE OFPLANTING BEDBACKFILL AS SPECIFIEDCOMPACT BOTTOM OF PIT, TYP.RULE OF THUMB - MODIFY EXCAVATION BASED ONLOCATION OF PLANT MATERIAL AND DESIGN OF BEDS OROVERALL PLANT PLACEMENT3FINISHED GRADE18" - VERIFY W/ PLANDRAWN @ ? sizeAGGREGATE MAINTANENCE STRIPN T SSLOPE - MIN. 2%, MAX. 5:1VERIFY W/ GRADING PLANFACE OF BUILDING, WALL, OR STRUCTUREMIN. 3" LAYER OF ROCK MULCH AS SPECIFIED. PROVIDESAMPLE TO LANDSCAPE ARCHITECT FOR APPROVAL PRIORTO INSTALLATIONSTAKED LANDSCAPE EDGER AS SPECIFIED, SEEMANUFACTURER'S INSTRUCTIONS AND SPECS. FORINSTALLATION AND PLACEMENTWATER PERMEABLE GEOTEXTILE FABRIC AS SPECIFIEDCOMPACTED SUBGRADE11. ENTIRE SITE SHALL BE FULLY IRRIGATED. THE CONTRACTOR SHALL SUBMIT IRRIGATION SHOP DRAWINGS FOR REVIEW AND APPROVAL BY THE LANDSCAPE ARCHITECT PRIOR TO INSTALLATION.2. PROVIDE SITE WIDE IRRIGATION SYSTEM DESIGN AND INSTALLATION. SYSTEM SHALL BE FULLY PROGRAMMABLE AND CAPABLE OF ALTERNATE DATE WATERING. THE SYSTEM SHALL PROVIDE HEAD TO HEAD ORDRIP COVERAGE AND BE CAPABLE OF DELIVERING ONE INCH OF PRECIPITATION PER WEEK. SYSTEM SHALL EXTEND INTO THE PUBLIC RIGHT-OF-WAY TO THE EDGE OF PAVEMENT/BACK OF CURB.3. CONTRACTOR SHALL SECURE APPROVAL OF PROPOSED IRRIGATION SYSTEM INLCUDING PRICING FROM OWNER, PRIOR TO INSTALLATION.4. SEE MECHANICAL AND ELECTRICAL PLANS AND SPECIFICATIONS FOR IRRIGATION WATER, METER, AND POWER CONNECTIONS.5. CONTRACTOR TO VERIFY LOCATION OF ALL UNDERGROUND/ABOVE GROUND FACILITIES PRIOR TO ANY EXCAVATION/INSTALLATION. ANY DAMAGE TO UNDERGROUND/ABOVE GROUND FACILITIES SHALL BE THERESPONSIBILITY OF THE CONTRACTOR AND COSTS ASSOCIATED WITH CORRECTING DAMAGES SHALL BE BORNE ENTIRELY BY THE CONTRACTOR.6. SERVICE EQUIPMENT AND INSTALLATION SHALL BE PER LOCAL UTILITY COMPANY STANDARDS AND SHALL BE PER NATIONAL AND LOCAL CODES. EXACT LOCATION OF SERVICE EQUIPMENT SHALL BE COORDINATEDWITH THE LANDSCAPE ARCHITECT OR EQUIVALENT AT THE JOB SITE.7. CONTRACTOR SHALL COORDINATE WITH LOCAL UTILITY COMPANY FOR THE PROPOSED ELECTRICAL SERVICE AND METERING FACILITIES.8. IRRIGATION WATER LINE CONNECTION SIZE IS 1-12" AT BUILDING. VERIFY WITH MECHANICAL PLANS.9. ALL MAIN LINES SHALL BE 18" BELOW FINISHED GRADE.10. ALL LATERAL LINES SHALL BE 12" BELLOW FINISHED GRADE.11. ALL EXPOSED PVC RISERS, IF ANY, SHALL BE GRAY IN COLOR.12. CONTRACTOR SHALL LAY ALL SLEEVES AND CONDUIT AT 2'-0" BELOW THE FINISHED GRADE OF THE TOP OF PAVEMENT. EXTEND SLEEVES TO 2'-0" BEYOND PAVEMENT.13. CONTRACTOR SHALL MARK THE LOCATION OF ALL SLEEVES AND CONDUIT WITH THE SLEEVING MATERIAL "ELLED" TO 2'-0" ABOVE FINISHED GRADE AND CAPPED.14. FABRICATE ALL PIPE TO MANUFACTURE'S SPECIFICATIONS WITH CLEAN AND SQUARE CUT JOINTS. USE QUALITY GRADE PRIMER AND SOLVENT CEMENT FORMULATED FOR INTENDED TYPE OF CONNECTION.15. BACKFILL ALL TRENCHES WITH SOIL FREE OF SHARP OBJECTS AND DEBRIS.16. ALL VALVE BOXES AND COVERS SHALL BE BLACK IN COLOR.17. GROUP VALVE BOXES TOGETHER FOR EASE WHEN SERVICE IS REQUIRED. LOCATE IN PLANT BED AREAS WHENEVER POSSIBLE.18. IRRIGATION CONTROLLER LOCATION SHALL BE VERIFIED ON-SITE WITH OWNER'S REPRESENTATIVE.19. CONTROL WIRES: 14 GAUGE DIRECT BURIAL, SOLID COPPER IRRIGATION WIRE. RUN UNDER MAIN LINE. USE MOISTURE-PROOF SPLICES AND SPLICE ONLY AT VALVES OR PULL BOXES. RUN SEPARATE HOT ANDCOMMON WIRE TO EACH VALVE AND ONE (1) SPARE WIRE AND GROUND TO FURTHEST VALVE FROM CONTROLLER. LABEL OR COLOR CODE ALL WIRES.20. AVOID OVER SPRAY ON BUILDINGS, PAVEMENT, WALLS AND ROADWAYS BY INDIVIDUALLY ADJUSTING RADIUS OR ARC ON SPRINKLER HEADS AND FLOW CONTROL ON AUTOMATIC VALVE.21. ADJUST PRESSURE REGULATING VALVES FOR OPTIMUM PRESSURE ON SITE.22. USE SCREENS ON ALL HEADS.23. A SET OF AS-BUILT DRAWINGS SHALL BE MAINTAINED ON-SITE AT ALL TIMES IN AN UPDATED CONDITION.24. ALL PIPE 3" AND OVER SHALL HAVE THRUST BLOCKING AT EACH TURN.25. ALL AUTOMATIC REMOTE CONTROL VALVES WILL HAVE 3" MINIMUM DEPTH OF 3/4" WASHED GRAVEL UNDERNEATH VALVE AND VALVE BOX. GRAVEL SHALL EXTENT 3" BEYOND PERIMETER OF VALVE BOX.26. THERE SHALL BE 3" MINIMUM SPACE BETWEEN BOTTOM OF VALVE BOX COVER AND TOP OF VALVE STRUCTURE.IRRIGATION NOTES:EXHIBIT GPage 889 of 899 UP A A F F D D C C 27' - 0"25' - 2" B B 114' - 8"80' - 0" 3 3 1 1 2 240' - 0"40' - 0"25' - 10"36' - 8"4' - 8"6' - 4"3' - 0"10' - 0"1' - 0"12' - 0"1' - 0"4' - 0"4' - 0"6' - 0"4' - 0"4' - 0"4' - 0"12' - 0"4' - 0"10' - 0"15' - 7"14' - 0"14' - 0" 2' - 8"3' - 4" 10' - 0" 3' - 4" 3' - 4" 4' - 0" 6' - 0" 4' - 0" 3' - 4" 3' - 4" 11' - 4" 4' - 0" 6' - 0" 4' - 0" 6' - 0" 4' - 0" 4' - 0" 4' - 0" 14' - 0" 4' - 0" 12' - 0" 4' - 0" 1' - 0" 12' - 0" 1' - 0" 4' - 0" 4' - 0"14' - 8"4' - 0" 4' - 0" 1' - 0" 12' - 0" 4' - 0" 12' - 0" 1' - 0" 4' - 0" 12' - 0" 4' - 0"4' - 0"4' - 0"4' - 0"2' - 0"4' - 0"6' - 0"4' - 0"6' - 0"4' - 0"6' - 0"4' - 0"12' - 0"4' - 0"12' - 0"4' - 0"103 105106104101102 1ST LEVEL 100' - 0" B.O. ROOF DECK - HIGH 117' - 4" B.O. ROOF DECK - LOW 115' - 8" T.O. PARAPET 4 119' - 0" B.O. ROOF TRUSS 113' - 0" T.O. PARAPET 5 118' - 0" FC-1 BRK-2CSTN-1BRK-1 EPT-1 1ST LEVEL 100' - 0" B.O. ROOF DECK - HIGH 117' - 4" B.O. ROOF DECK - LOW 115' - 8" T.O. PARAPET 4 119' - 0" B.O. ROOF TRUSS 113' - 0" T.O. PARAPET 3 120' - 0" FC-1 BRK-1 CSTN-1 BRK-2 1ST LEVEL 100' - 0" T.O. PARAPET 1 122' - 0" B.O. ROOF DECK - HIGH 117' - 4" B.O. ROOF DECK - LOW 115' - 8" B.O. ROOF TRUSS 113' - 0" T.O. PARAPET 3 120' - 0" T.O. PARAPET 2 121' - 0" SIGNAGE - 80 SFSIGNAGE - 20 SF FC-1BRK-1 ACM-1BRK-2 CSTN-1RS-1ACM-1 1ST LEVEL 100' - 0" B.O. ROOF DECK - HIGH 117' - 4" B.O. ROOF DECK - LOW 115' - 8" T.O. PARAPET 4 119' - 0" B.O. ROOF TRUSS 113' - 0" T.O. PARAPET 3 120' - 0" T.O. PARAPET 2 121' - 0" SIGNAGE - 20 SF BRK-2BRK-1CSTN-1RS-1FC-2ACM-1EPT-1 BRK-1 DARK BRICK BRICK 1 - MODULAR BRICK; COLOR: DARK GRAY WITH COORDINATING GROUT; SUMMIT 813 ANDIRON - GRAIN FINISH EXTERIOR MATERIALS LEGEND CSTN-1 CAST STONE SILL COLOR: WHITE FC-1 FIBER CEMENT BOARD NICHIHA: VINTAGE WOOD, COLOR: BLACKWOOD EPT-1 PAINT ACM: ALUCOBOND OR EQ., COLOR: CHARCOAL GREY BRK-2 LIGHT BRICK BRICK 2 - MODULAR BRICK; COLOR: WHITE WITH COORDINATING GROUT; SUMMIT 216 ALASKAN - SMOOTH FINISH ACM-1 CANOPY METAL ACM: ALUCOBOND OR EQ., COLOR: CHARCOAL GREY RS-1 ROOF SCREENING ENVISOR 3 SCREENING BY CITYSCAPES. COLOR: STONE WHITE, STYLE: METAL 7.2 RIB SOLID, TOP TRIM: BAND, COLOR: STONE WHITE FC-2 FIBER CEMENT BOARD NICHIHA: LATURA V-GROOVE, COLOR: WHITE NORTH EAST SOUTH WEST TOTAL GRADE A: BRICK 718 SF 608 SF 1,124 SF 1,067 SF 3,517 SF 46% GRADE A: CAST STONE 70 SF 53 SF 50 SF 40 SF 213 SF 3% GRADE A: GLAZING 227 SF 233 SF 613 SF 273 SF 1,346 SF 17% 66% GRADE C: FIBER CEMENT 1,053 SF 645 SF 497 SF 140 SF 2,335 SF 32% GRADE C: METAL/ DOOR 24 SF 0 SF 84 SF 80 SF 188 SF 2% 34% TOTAL SF 7,599 SF MATERIAL PERCENTAGES A South Line of OUTLOT A, SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION Drainage & Utility Easement per SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION Drainage & Utility Easement per SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION MINNESOTA CERTIFICATION I hereby certify that this survey, plan or report was prepared by me or under my direct supervision and that I am a duly Licensed Land Surveyor under the laws of the State of Minnesota. Dated this 25th day of August, 2025 ______________________________________________ Rory L. Synstelien Minnesota License No. 44565 Project No. 25104 SHEET 1 OF 1 80 160 SCALE IN FEET 0 5000 GLENWOOD AVENUE GOLDEN VALLEY, MN 55422 CivilSiteGroup.com DESCRIPTION All those drainage and utility easements as dedicated in the recorded plat of SPIRIT OF BRANDTJEN FARM COMMERCIAL 1ST ADDITION, Dakota County Minnesota, lying within that part of OUTLOT A, said plat, which lies easterly of the recorded plats of SPIRIT OF BRANDTJEN FARM COMMERCIAL 3RD ADDITION, SPIRIT OF BRANDTJEN FARM COMMERCIAL 4TH ADDITION, and SPIRIT OF BRANDTJEN FARM COMMERCIAL 5TH ADDITION, Dakota County, Minnesota, and which lies westerly and southerly of the recorded plat of SPIRIT OF BRANDTJEN FARM COMMERCIAL 6TH ADDITION, Dakota County, Minnesota. Drawn By: CJ N EXHIBIT I Page 892 of 899 City of Lakeville Public Works – Engineering Division Memorandum To: Kris Jenson, Planning Manager From: Jon Nelson, Assistant City Engineer McKenzie L. Cafferty, Environmental Resources Manager Joe Masiarchin, Parks and Recreation Director Copy: Zach Johnson, City Engineer Julie Stahl, Finance Director Dave Mathews, Building Official Date: August 25, 2025 Subject: Spirit of Brandtjen Farm Commercial 7th Addition • Preliminary and Final Plat Review • Grading and Erosion Control Plan Review • Utility Plan Review • Site Plan Review • Easement Vacation BBAACCKKGGRROOUUNNDD MSP Pilot Knob, LLC has submitted a preliminary and final plat named Spirit of Brandtjen Farm Commercial 7th Addition to construct a retail facility on Lot 1, Block 1. The proposed development is located south of and adjacent to 160th Street (CSAH 46), north of 162nd Street, east of Pilot Knob Road (CSAH 31), and west of Elmhurst Lane. The parent parcel consists of a portion of Outlot A, Spirit of Brandtjen Farm Commercial 1st Addition. The development is zoned PUD, Planned Unit Development. The preliminary and final plats consist of one lot within one block on 1.00 acres. The proposed development and site plan will be completed by: Developer: MSP Pilot Knob, LLC Engineer/Surveyor: Civil Site Group Page 893 of 899 SSPPIIRRIITT OOFF BBRRAANNDDTTJJEENN FFAARRMM CCOOMMMMEERRCCIIAALL 77TTHH AADDDDIITTIIOONN –– PPRREELLIIMMIINNAARRYY AANNDD FFIINNAALL PPLLAATT AAUUGGUUSSTT 2255,, 22002255 PPAAGGEE 22 OOFF 77 SSIITTEE CCOONNDDIITTIIOONNSS The Spirit of Brandtjen Farm Commercial 7th Addition site consists of 1.00 acres of undeveloped land. The property generally slopes west to east. There are no wetlands or trees on the property. EEAASSEEMMEENNTTSS The parent parcel contains existing public Drainage and Utility Easements dedicated with the Spirit of Brandtjen Farm Commercial 1st Addition plat, which will be vacated with the final plat. The Drainage and Utility Easement will be re-dedicated with the final plat over the area containing existing public utilities located on the parent parcel. SSTTRREEEETT AANNDD SSUUBBDDIIVVIISSIIOONN LLAAYYOOUUTT Private Drive Spirit of Brandtjen Farm Commercial 7th Addition will be accessed from existing private drives connecting to Elmhurst Lane and 162nd Street. CCOONNSSTTRRUUCCTTIIOONN AACCCCEESSSS Construction traffic access and egress for grading, utility and site construction shall be from the private access drive. PPAARRKKSS,, TTRRAAIILLSS AANNDD SSIIDD EEWWAALLKKSS Development of Spirit of Brandtjen Farm Commercial 7th Addition includes the construction of private sidewalks. Private sidewalks will be constructed to provide access from the site to other uses in the Spirit of Brandtjen Farm Commercial development. The Park Dedication fee has not been collected on the parent parcel and will be satisfied through a cash contribution with the final plat. The Park Dedication fee for commercial areas in Spirit of Brandtjen Farm is $5,400.00 per acre, consistent with the Spirit of Brandtjen Farm Master PUD Agreement. 1.00 acres x $5,400/acre = $5,400.00 Area of Lot 1, Block 1 Park Dedication Charge Required Park Dedication Page 894 of 899 SSPPIIRRIITT OOFF BBRRAANNDDTTJJEENN FFAARRMM CCOOMMMMEERRCCIIAALL 77TTHH AADDDDIITTIIOONN –– PPRREELLIIMMIINNAARRYY AANNDD FFIINNAALL PPLLAATT AAUUGGUUSSTT 2255,, 22002255 PPAAGGEE 33 OOFF 77 UUTTIILLIITTIIEESS SSAANN IITTAARRYY SSEE WWEERR Spirit of Brandtjen Farm Commercial 7th Addition is located within subdistrict NC-20060 of the North Creek sanitary sewer district, as identified in the City’s Comprehensive Sewer Plan. Wastewater will be conveyed to the MCES Farmington Interceptor and continue to the Empire Wastewater Treatment Facility. The downstream facilities have sufficient capacity to serve the proposed commercial development. Sanitary sewer to serve the development will be conveyed downstream via sanitary sewer located in the existing private drive. The Developer shall connect to public sanitary sewer from a proposed privately owned and maintained sanitary sewer stub within the lot. The Sanitary Sewer Availability Charge has not been collected on the parent parcel and shall be collected with the Building Permit Application. The Sanitary Sewer Availability Charge will be calculated at the rate in effect at the time of approval of the Building Permit Application, as determined by the City’s Building Official. WWAATTEERRMMAAIINN Development of Spirit of Brandtjen Farm Commercial 7th Addition includes the extension of a private watermain service to provide water service to the development. Watermain to serve the development will be provided via watermain located in the existing private drive. The Developer shall connect to public watermain from a proposed privately owned and maintained watermain stub within the lot. OOVVEERRHHEEAADD LLIINN EESS There are no overhead utilities located adjacent to or within the parent parcel. DDRRAAIINNAAGGEE AANNDD GGRRAADDIINNGG Spirit of Brandtjen Farm Commercial 7th Addition is located within subdistrict NC-9C of the North Creek Stormwater District as identified in the City’s Water Resources Management Plan. Stormwater runoff generated from the Spirit of Brandtjen Farm Commercial 7th Addition development will be conveyed via a proposed private storm sewer system within the property. The stormwater management requirements for the parent parcel were satisfied through stormwater management basins constructed with Spirit of Brandtjen Farm Commercial 2nd Addition. Page 895 of 899 SSPPIIRRIITT OOFF BBRRAANNDDTTJJEENN FFAARRMM CCOOMMMMEERRCCIIAALL 77TTHH AADDDDIITTIIOONN –– PPRREELLIIMMIINNAARRYY AANNDD FFIINNAALL PPLLAATT AAUUGGUUSSTT 2255,, 22002255 PPAAGGEE 44 OOFF 77 The final grading plan shall identify all fill lots in which the building footings will be placed on fill material. The grading specifications shall also indicate that all embankments meet FHA/HUD 79G specifications. The Developer shall certify to the City that all lots with footings placed on fill material are appropriately constructed. Building permits will not be issued until a soils report and an as-built certified grading plan have been submitted and approved by City staff. Spirit of Brandtjen Farm Commercial 7th Addition does not contain more than one acre of site disturbance, however because the project is part of a common development a National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency. SSTTOORRMM SSEEWWEERR The development of Spirit of Brandtjen Farm Commercial 7th Addition includes the construction of a private storm sewer system. The privately-owned and maintained storm sewer will be located within Lot 1, Block 1 and will collect and convey stormwater runoff generated from within the development to the private storm sewer system located at the south of the property. Draintile construction is required in areas of non-granular soils within Brookshire 4th Addition for the street sub-cuts and lots. Any additional draintile construction, including perimeter draintile required for building footings, deemed necessary during construction by the City shall be the Developer’s responsibility to install and finance. The Storm Sewer Charge has not been collected on the parent parcel and must be paid with the final plat. The Storm Sewer Charge for Lot 1, Block 1 is calculated as follows: 43,672.00 s.f. x $0.250/s.f. = $10,918.00 Area of Lot 1, Block 1 Commercial Area Charge Total Storm Sewer Charge The Storm Sewer Charge for Outlot A will be collected with subsequent phases of the Spirit of Brandtjen Farm Commercial 7th Addition preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. FEMA FLOODPLAIN ANALYSIS Spirit of Brandtjen Farm Commercial 7th Addition is shown on the Flood Insurance Rate Map (Map No. 27037C0208E) as Zone X by the Federal Emergency Management Agency (FEMA). Based on this designation, there are no areas in the plat located within a Special Flood Hazard Area (SFHA), as determined by FEMA. Page 896 of 899 SSPPIIRRIITT OOFF BBRRAANNDDTTJJEENN FFAARRMM CCOOMMMMEERRCCIIAALL 77TTHH AADDDDIITTIIOONN –– PPRREELLIIMMIINNAARRYY AANNDD FFIINNAALL PPLLAATT AAUUGGUUSSTT 2255,, 22002255 PPAAGGEE 55 OOFF 77 WWEETTLLAANNDDSS There are no existing wetlands on the site. TTRREEEE PPRREESSEERRVVAATTIIOONN No significant trees are located on the property. EERROOSSIIOONN CCOONNTTRROOLL The Developer is responsible for obtaining a MPCA Construction Permit for the site as well as developing and maintaining the SWPPP throughout construction phase. The permit requires that all erosion and sediment BMPS must be clearly outlined in a site’s SWPPP. Changes made throughout construction should be documented in the SWPPP. Additional erosion control measures may be required during construction as deemed necessary by City staff or the Dakota County Soil and Water District. Any additional measures required shall be installed and maintained by the Developer. The MS4 Administration Fee has not been collected on the parent parcels and is required with the final plat, calculated as follows: $10,000.00 x 2% Grading Costs = $200.00 Grading Cost Spirit of Brandtjen Farm Commercial 7th Addition 2025 Rate MS4 Administration Fee Spirit of Brandtjen Farm Commercial 7th Addition SECURITIES The Developer shall provide a Letter of Credit as security for the Developer-installed improvements relating to Spirit of Brandtjen Farm Commercial 7th Addition. CONSTRUCTION COSTS Grading, Erosion Control, and Restoration $ 10,000.00 SUBTOTAL - CONSTRUCTION COSTS $ 10,000.00 OTHER COSTS Developer’s Design (3.0%) $ 300.00 Developer’s Construction Survey (2.5%) 250.00 City’s Legal Expense (0.5%) 50.00 City Construction Observation (5.0%) 500.00 Developer’s Record Drawing (0.5%) Landscaping 50.00 22,609.50 Page 897 of 899 SSPPIIRRIITT OOFF BBRRAANNDDTTJJEENN FFAARRMM CCOOMMMMEERRCCIIAALL 77TTHH AADDDDIITTIIOONN –– PPRREELLIIMMIINNAARRYY AANNDD FFIINNAALL PPLLAATT AAUUGGUUSSTT 2255,, 22002255 PPAAGGEE 66 OOFF 77 Lot Corners/Iron Monuments 200.00 SUBTOTAL - OTHER COSTS $23,959.50 TOTAL PROJECT SECURITY $ 33,959.50 The Developer shall post a security to ensure the final placement of iron monuments at property corners with the final plat. The security is $100.00 per lot and outlot for a total of $100.00. The City shall hold this security until the Developer’s Land Surveyor certifies that all irons have been placed following site grading, street and utility construction. CCAASSHH FFEEEESS A cash fee for one-year of the Environmental Resources Fee shall be paid at the time of final plat approval and is calculated as follows: 1 unit x $61.52/unit x 4.20 = $258.38 Total Units Spirit of Brandtjen Farm Commercial 7th Addition 2025 Rate Utility Factor Environmental Resources Fee Spirit of Brandtjen Farm Commercial 7th Addition A cash fee for the preparation of addressing, property data, and City base map updating shall be paid with the final plat and is calculated as follows: 2 lots/outlots x $90.00/unit = $180.00 Lots/Outlots Spirit of Brandtjen Farm Commercial 7th Addition 2025 Rate Property Data & Asset/Infrastructure Mgmt. Fee Spirit of Brandtjen Farm Commercial 7th Addition The Developer shall submit the final plat and construction drawings in an electronic format. The electronic format shall be in either .dwg (AutoCAD) or .dxf format. The Developer shall also pay a cash fee for City Engineering Administration. The fee for City Engineering Administration will be based on three percent (3.00%) of the estimated construction cost, or $300.00. CASH REQUIREMENTS Park Dedication Fee $ 5,400.00 Storm Sewer Charge 10,918.00 Environmental Resources Management Fee MS4 Administration Fee 258.38 200.00 Property Data and Asset/Infrastructure Management Fee 180.00 City Engineering Administration (3.00%) 300.00 TOTAL - CASH REQUIREMENTS $ 17,256.38 Page 898 of 899 SSPPIIRRIITT OOFF BBRRAANNDDTTJJEENN FFAARRMM CCOOMMMMEERRCCIIAALL 77TTHH AADDDDIITTIIOONN –– PPRREELLIIMMIINNAARRYY AANNDD FFIINNAALL PPLLAATT AAUUGGUUSSTT 2255,, 22002255 PPAAGGEE 77 OOFF 77 RREECCOOMMMMEENNDDAATTIIOONN Engineering recommends approval of the Spirit of Brandtjen Farm Commercial 7th Addition preliminary and final plat, grading and erosion control plan and utility plan subject to the requirements and stipulations within this report. Page 899 of 899