Loading...
HomeMy WebLinkAbout03-16-2026 AGENDA CITY COUNCIL MEETING March 16, 2026 - 6:00 PM City Hall Council Chambers Members of the public can participate in person at Lakeville City Hall, 20195 Holyoke Avenue. The mayor will allow for public comments and questions at the appropriate time. The City Council is provided background information for agenda items in advance by staff and appointed commissions, committees, and boards. Decisions are based on this information, as well as City policy, practices, input from constituents, and a council member’s personal judgment. 1. Call to order, moment of silence and flag pledge 2. Roll Call 3. Citizen Comments 4. Additional agenda information 5. Presentations/Introductions a. Fire Department Quarterly Update 6. Consent Agenda a. Check Register Summary b. Minutes of the 03/02/2026 City Council Meeting c. Supplemental Agreement with Alliant for Professional Services for Dodd Boulevard Modernization from 208th Street to 202nd Street d. Resolution Approving Easement Agreement with Minnesota Energy Resources e. Resolution Appointing Members to Advisory Boards, Committees and Commissions f. Quote for Water Meters g. Resolution Calling a Public Hearing on Proposed Assessments for City Improvement Project 26-01 h. Contract and Resolution for the 2026 Street Rehabilitation Project i. Contract for Cracksealing, Pavement Marking Project and Trail Fog Seal j. Contract for 2026 Inflow and Infiltration Improvement Project k. Approval of Professional Services Agreement with Hosington Koegler Group, Inc (HKGI) l. First Amendment to the Amelia Meadows Development Contract m. Cooperative Reimbursement Agreement with the Metropolitan Council Page 1 of 445 City Council Meeting Agenda March 16, 2026 Page 2 for Sanitary Sewer Meter M657 Construction n. Resolution Authorizing Issuance and Sale of General Obligation Bonds, Series 2026A o. Resolution Amending the 2025 Budgets p. North Ryan Second Addition Development Contract q. Contract for Lawn Maintenance at City Facilities and Miscellaneous Sites r. Authorization to Participate in Six Remnant Defendant Opioid Settlement 7. Action Items a. Dodd Commons Preliminary Plat b. Prime 35 Industrial Preliminary Plat 8. Unfinished Business 9. New Business New Business items are intended for informal City Council discussion and will not begin before 6:30 p.m. The Council may provide direction to staff but will not take formal action on these matters. a. Discussion on Keeping of Chickens Ordinance b. Waste Hauler Service Areas c. Prellminary 2025 Financial Report - General Fund 10. Council/Committee Updates 11. Announcements a. Next City Council Meeting Monday, March 2, 2026 12. Adjourn Page 2 of 445 Date: 3/16/2026 Check Register Summary Proposed Action Staff recommends adoption of the following motion: Move to approve the Check Register Summary. Overview Overview Checks 328879 - 328992 $3,067,032.95 ACH/EFT 24612 - 24722 $1,616,636.85 Total $4,683,669.80 The City Council receives a list of expenditures paid (claims detail), which is available to the public upon request. The City serves as the fiscal agent for Lakeville Arenas and Dakota 911 and processes their accounts payable and payments – these amounts are not included in the total above. Supporting Information 1. 03.10.26 CKSUM-Checks 2. 03.10.26 CKSUM-ACH-EFT 3. Check Register 03.10.26 for March 16, 2026 Council Mtg - Checks 4. Check Register 03.10.26 for March 16, 2026 Council Mtg - ACH-EFT Financial Impact: $4,683,669.80 Budgeted: Yes Source: Various Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Cheri Donovan, Assistant Finance Director Page 3 of 445 CHECK DISBURSEMENT REPORT FOR CITY OF LAKEVILLE Amount 1000 GENERAL FUND 136,842.33 2000 COMMUNICATIONS FUND 18,047.40 2230 LOCAL AFFORDABLE HOUSING AID 250,000.00 3125 2025A FIRST CENTER 1,506.00 4000 BUILDING FUND 1,219,455.97 4100 EQUIPMENT FUND 160,115.95 4125 TECHNOLOGY FUND 47,915.88 4200 PARK DEDICATION FUND 95,035.00 4500 PARK IMPROVEMENT FUND 8,870.00 4720 2024A PARK BONDS 168,155.82 5300 PAVEMENT MANAGEMENT FUND 2,022.22 7450 ENVIRONMENTAL RESOURCES FUND 213.06 7575 STREET LIGHTING FUND 15,913.40 7600 WATER FUND 116,182.20 7700 SEWER FUND 509,082.82 7800 LIQUOR FUND 288,166.60 7900 MUNICIPAL RESERVES FUND 24,211.92 8000 ESCROW FUND 4,501.58 9800 PAYROLL CLEARING FUND 794.80 Report Total:3,067,032.95 03/12/2026 08:24 AM Page:1/1 Page 4 of 445 CHECK DISBURSEMENT REPORT FOR CITY OF LAKEVILLE Amount 1000 GENERAL FUND 342,820.32 2000 COMMUNICATIONS FUND 1,923.50 2292 FIRST CENTER OPERATING FUND 1,033.22 4000 BUILDING FUND 9,848.25 4100 EQUIPMENT FUND 116,582.76 4125 TECHNOLOGY FUND 22,788.50 4200 PARK DEDICATION FUND 22,656.89 4710 2023A PARK BONDS 9,029.50 4720 2024A PARK BONDS 4,457.00 5200 STATE AID CONSTRUCTION FUND 27,850.44 5300 PAVEMENT MANAGEMENT FUND 118.25 6597 2025 STREET PROJECTS 1,132.25 6611 2026 STREET PROJECTS 13,946.20 7450 ENVIRONMENTAL RESOURCES FUND 7,505.62 7550 UTILITY FISCAL ADMINISTRATION 61,491.00 7575 STREET LIGHTING FUND 37.53 7600 WATER FUND 584,742.70 7700 SEWER FUND 3,182.38 7800 LIQUOR FUND 385,476.79 8970 LAKEVILLE ARENAS - OPERATIONS 13.75 Report Total:1,616,636.85 03/12/2026 08:23 AM Page:1/1 Page 5 of 445 MINUTES CITY COUNCIL MEETING March 2, 2026 - 6:00 PM City Hall Council Chambers 1. Call to order, moment of silence and flag pledge Mayor Hellier called the meeting to order at 6:00 P.M. 2. Roll Call Members Present: Mayor Hellier, Council Members Bermel, Lee, Volk, Wolter Staff Present: Justin Miller, City Administrator; Andrea McDowell Poehler, City Attorney; Julie Stahl, Finance Director; Joe Masiarchin, Parks & Recreation Director; Allyn Kuennen, Assistant City Administrator; Taylor Snider, Assistant to the City Administrator; Brad Paulson, Police Chief; Paul Oehme, Public Works Director; Tina Goodroad, Community Development Director; Alissa Frey, Human Resources Director 3. Citizen Comments None. 4. Additional agenda information None. 5. Presentations/Introductions a. Parks & Recreation Quarterly Report Parks and Recreation Director Joe Masiarchin presented the quarterly report to Council. He discussed upcoming major projects and the progress that is being made on those projects. He also highlighted many of the successful events that the City hosted throughout the winter and some exciting spring events ahead. 6. Consent Agenda Motion was made by Bermel, seconded by Wolter, to approve the Consent Agenda. Voice vote was taken on the motion. Ayes - Hellier, Bermel, Lee, Volk, Wolter a. Check Register Summary b. Minutes of the 02/17/2026 City Council Meeting c. Resolution Granting Contract Authority and Pledging Funding Page 6 of 445 City Council Meeting Minutes March 2, 2026 Page 2 for Freight Rail Car Storage Facility d. Change order to the 2025 Well Rehabilitation contract e. Park Restroom Cleaning Services Agreement with Vanguard Cleaning Systems of MN f. Amendment of State of Minnesota General Obligation Bond Financed Declaration g. LELS Local No. 177, Sergeants 2026-2027 Labor Agreement h. Agreement with JL Theis, Incorporated for Lakeville Area Arts Center Playground Sitework i. Radio Advertising Agreement with KTMY-FM, LLC. for the Lakeville Area Arts Center j. Supplemental Agreement for Annual Instrumentation and Control Support Services k. Contract for Repainting the Dakota Heights Water Tower l. Resolution Accepting Donations to the Lakeville Parks & Recreation Department in the 1st Quarter of 2026 m. Contract for 2026 Right-of-Way and Park Tree Planting n. Contract for Boulevard Mowing o. Professional Service Agreement for Heritage Center Improvements p. Kyla Crossing Second Addition Final Plat 7. Action Items a. Hearing for a High-Cost Tree Abatement Community Development Director Tina Goodroad, presented the agenda item to Council. Staff have worked with the property owner on this abatement and are in agreement with this action. Motion was made by Wolter, seconded by Lee, to approve the High-Cost Tree Abatement. Roll call was taken on the motion. Ayes - Hellier, Bermel, Lee, Volk, Wolter 8. Unfinished Business 9. New Business Page 7 of 445 City Council Meeting Minutes March 2, 2026 Page 3 a. 2026A Bond Issuance - Street Reconstruction/Utilities/CIP Projects Finance Director Julie Stahl presented to Council regarding the issuance of 2026A bonds. The bonds will provide funding for four city projects. Jessica Green from Northland Securities, Inc., presented the executive summary to the Council as they continue to prepare for the sale. b. Expo 2031 Wendy Meadley, CEO of Expo 2031, presented an event proposal to Council. She laid out the site plans, benefits to Lakeville, and the Expo's credentials. Council asked Meadley and her staff questions regarding the potential event. The Council directed staff to work with Expo 2031 to gather more information about the proposal. c. Commission Application Review Mayor Hellier will present potential appointments to the rest of Council, and they will provide feedback on the appointments. A resolution making final appointments will be presented at the March 16th Council meeting. 10. Announcements a. Next Scheduled Meeting: March 16, 2026 11. Adjourn Motion was made by Bermel, seconded by Wolter, to adjourn at 7:48 P.M. Voice vote was taken on the motion. Ayes – Hellier, Bermel, Lee, Volk, Wolter Respectfully Submitted, Taylor Snider, Deputy City Clerk Luke M. Hellier, Mayor Page 8 of 445 Date: 3/16/2026 Supplemental Agreement with Alliant for Professional Services for Dodd Boulevard Modernization from 208th Street to 202nd Street Proposed Action Staff recommends adoption of the following motion: Move to approve Alliant supplemental agreement for professional services for final engineering of Dodd Boulevard Modernization between 208th Street and 202nd Street, City Project 26-04. Overview The City and Dakota County are partnering to reconstruct the segment of Dodd Boulevard (CSAH 9) between 208th Street and 202nd Street (CSAH 50). This roadway modernization project will improve traffic operations and safety, upgrade intersections, and accommodate future traffic growth. City Project 26-04 is included in both the City's and County's adopted five- year Capital Improvement Plans and consists of the following major elements: • Reconstruction and widening of Dodd Boulevard between 208th Street and 202nd Street as a two-lane divided urban roadway with multi-use trails on both sides. • Construction of roundabouts at the intersections of Dodd Boulevard and 202nd Street, and Dodd Boulevard and 207th Street. • Access modifications consistent with Dakota County standards. • A grade-separated trail crossing for the Lake Marion Greenway. • Improvements to public utilities, including sanitary sewer, water and stormwater systems. Alliant Engineering has submitted a supplemental agreement outlining the scope and estimated cost to complete final engineering, right-of-way acquisition support, permitting and public engagement services, in accordance with the City's Master Services Agreement dated September 20, 2021. The City Council previously approved a supplemental agreement with Alliant for preliminary engineering on January 21, 2025. The City and County will share responsibilities and costs according to the County's adopted cost-share policies and a future Joint Powers Agreement. As the lead agency, the full amount of the amendment is shown in this memo; the City’s estimated net cost is $379,247. Supporting Information 1. 2026.02.02 Alliant Supplemental Agreement (Final Engineering) Page 9 of 445 Financial Impact: $842,770 Budgeted: Yes Source: Multiple Sources Envision Lakeville Community Values: Design that Connects the Community Report Completed by: Jonathan Nelson, Assistant City Engineer Page 10 of 445 Dodd Boulevard Modernization Project // 1 RE: Dodd Boulevard (CSAH 9) Modernization Project Supplemental Agreement for Final Design Services Dear Mr. Nelson: Alliant Engineering has appreciated the opportunity to work with the City of Lakeville and Dakota County with preliminary engineering for the Dodd Boulevard (CSAH 9) Modernization Project and we are excited to move forward with final design. The sections below describe each major task along with key assumptions, information or participation needed from the City, and major deliverables. A detailed spreadsheet documenting the hours and fee associated with each task is also included with this letter. Each task also clarifies whether an existing task budget from preliminary design is being augmented or if a new task is being created. PROJECT UNDERSTANDING The purpose of this project is to advance the preliminary layout for Dodd Boulevard (CSAH 9) between Kenwood Trail and 208th Street/Huntsville Trail through final design and right-of-way acquisition. In partnership with Dakota County, the City intends to construct the proposed improvements in 2027. SCOPE OF SERVICES TASK 1 – PROJECT MANAGEMENT Eric Nelson will remain the Project Manager for the Alliant Team and will serve as the single point of contact for the City and Dakota County. Eric will coordinate all aspects of the design and lead all meetings with external agencies. In addition to preparing monthly progress reports and invoices, Eric will continue to conduct weekly check-in meetings with the City and County project managers. He will also continue monthly Project Management Team (PMT) meetings on Microsoft Teams. The project schedule developed in Microsoft Project will continue to be updated and maintained as needed throughout the project. CITY OF LAKEVILLE RESPONSIBILITIES: ● Participate in weekly PMT update meetings and monthly PMT meetings CONSULTANT DELIVERABLES: ● Monthly progress reports and invoices ● Agendas and minutes for monthly PMT meetings ● Project schedule with updates as needed ● Action Item Log updated monthly Total Additional Design Fee for Task 1: $34,800 TASK 2 – PUBLIC INVOLVEMENT Eric Nelson and Jackie Haugdahl will continue to lead the public involvement efforts on the project. The Public Involvement Plan (PIP) developed during preliminary design will be updated to document the planned milestones and techniques for outreach throughout right-of-way acquisition and final design. February 2, 2026 Jon Nelson, PE Assistant City Engineer City of Lakeville Alliant Engineering, Inc. 733 Marquette Avenue Suite 700 Minneapolis, MN 55402 612.758.3080 www.alliant-inc.com Page 11 of 445 Dodd Boulevard Modernization Project // 2 Our preliminary design scope and fee included two open house events, and only one has occurred to date. The open house event planned for late spring/early summer 2026 will be covered under our preliminary design contract. We will plan on two additional open houses during final design that will follow the same dual in-person and online formats as the previous open houses. Alliant will work with the City to coordinate mailings and social media posts and will prepare all graphics needed. A written summary will be prepared after each meeting to document the feedback received. The project website set up during preliminary design will continue to be updated and augmented as the design progresses. Eric Nelson will attend up to four additional meetings with elected officials or regulatory agencies as needed. If supporting graphics or other materials are needed for these meetings, the Alliant team will prepare those as well. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review and comment of draft public involvement materials ● Provide updated mailing lists prior to open houses ● Attend open houses and additional meetings CONSULTANT DELIVERABLES: ● Updated PIP ● Mailings, graphics, and all other supporting materials for open houses ● Updated and maintained project website Total Additional Design Fee for Task 2: $20,340 TASK 3 – RIGHT OF WAY Our team will include SRF Consulting Group (SRF) to assist with securing the needed land rights for the project. Based on preliminary design analysis, we expect 27 parcels will require some level of land acquisition. A copy of the SRF proposal with detailed assumptions is attached to this letter. In partnership with SRF, Alliant will prepare parcel sketches for each affected parcel and will stake the proposed easements for viewing by the appraiser and property owner. Dan Ekrem, a Professional Land Surveyor with Alliant, will prepare the legal descriptions for each easement required and the Alliant Team will prepare parcel sketches for each parcel requiring acquisition. Eric Nelson will plan on attending meetings with property owners as well to help explain the project’s design components and impacts. CITY OF LAKEVILLE RESPONSIBILITIES: ● Provide O&E reports for affected properties ● Attend meetings with property owners ● City right of way tasks noted in SRF proposal CONSULTANT DELIVERABLES: ● Appraisals, field title reports, and right of way graphics ● Highway right-of-way CAD file ● Parcel sketches and legal descriptions for all affected properties ● Information and documentation needed to support City in condemnation proceedings (if required) Total Additional Design Fee for Task 3: $34,780.00 (Alliant only) Page 12 of 445 Dodd Boulevard Modernization Project // 3 TASK 4 – TOPOGRAPHIC SURVEY Alliant will perform additional topographic survey in identified stormwater management areas and other areas where the preliminary construction limits extend beyond the initial survey. Data collected will be integrated into the base map developed during preliminary design. Total Additional Design Fee for Task 4: $14,270.00 TASK 5 – ENVIRONMENTAL Keara Fehr will continue to lead the wetland permitting process for Alliant. Once the final wetland impact totals are established, we will prepare all application forms and supporting exhibits for Wetland Conservation Act permitting. We assume that wetland impacts will be mitigated through the purchase of banked credits and will prepare all forms needed to document the purchase with both the wetland bank and the Board of Water and Soil Resources. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review draft application forms and materials and sign final versions ● Secure funding and make payment for wetland bank credits CONSULTANT DELIVERABLES: ● Wetland application forms and supporting materials and graphics ● Wetland impact calculations and cross sections ● Documentation to support purchase of wetland bank credits Total Additional Design Fee for Task 5: $8,180.00 TASK 6 – GEOTECHNICAL EVALUATION The design has evolved since the initial soil borings and preliminary geotechnical report were developed. Braun Intertec will continue their work from preliminary design, and a copy of their proposed additional scope is included with this proposal. They will collect additional borings based on the design needs for stormwater management and the pedestrian underpass. These borings will be integrated with those previously collected to develop the final geotechnical report for the project. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review draft geotechnical report CONSULTANT DELIVERABLES: ● Map of additional soil borings ● Draft and Final Geotechnical Report Total Additional Design Fee for Task 6: $540.00 (Alliant only – Braun Intertec fees listed as reimbursable expense) TASK 7 – UTILITY IDENTIFICATION AND COORDINATION Eric Nelson and Cole Adams will lead the utility coordination process throughout the design. We will coordinate and lead the three utility coordination meetings identified in the RFP and have assumed up to three meetings with Page 13 of 445 Dodd Boulevard Modernization Project // 4 individual utility owners. The final plans and cross sections will document existing utility locations and will denote impacts and required relocations. CITY OF LAKEVILLE RESPONSIBILITIES: ● Attend utility coordination meetings and meetings with utility owners (as needed) CONSULTANT DELIVERABLES: ● Utility coordination meetings (including agenda, minutes, and supporting exhibits) ● Written summaries of individual utility owner meetings Total Additional Design Fee for Task 7: $8,220.00 TASK 8 – TRAFFIC FORECASTING AND ANALYSIS The traffic technical memos developed during the preliminary design phase will serve as the basis for the final design. If any updates to these memos are needed based on changes during final design, Nick Grage will lead this effort. Nick will also develop the Intersection Control Evaluation (ICE) documentation for the roundabouts at Kenwood/Dodd and Dodd/207th required for State Aid approval. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review draft ICE reports and sign final version prior to State Aid submittal CONSULTANT DELIVERABLES: ● Modified Traffic Tech Memo(s) – if required ● Draft and final ICE reports Total Additional Design Fee for Task 8: $10,260.00 TASK 9 – PRELIMINARY DESIGN Our team understands that the preliminary layout will remain an effective tool for communicating the scope of the project to the public and elected officials throughout the design process. Upon direction from the City, we will update the layout with current information as aspects of the design are solidified. Our scope and fee include the three revisions of the design layout as needed. Total Additional Design Fee for Task 9: $8,200.00 TASK 10 – STORMWATER MANAGEMENT AND HYDRAULICS EVALUATION Advancing the stormwater management design to the point where best management practice (BMP) locations and sizes are solidified will be a key first step in this process. TKDA will continue to lead the stormwater design for the project, and their proposed scope and fee are included with this proposal. They will refine the existing and proposed drainage area maps and HydroCAD models developed during preliminary design to confirm that rate control requirements are met in addition to providing the required volume for water quality. This task will also include analysis of floodplain impacts in Marion Fields Park and documentation of no-rise for both the FEMA-regulated floodplain and the city’s floodplain ordinance. Their design will include a modified inlet Page 14 of 445 Dodd Boulevard Modernization Project // 5 pipe for the Lake Marion discharge swale and providing compensatory floodplain storage within the park. TKDA will design a storm sewer system to meet both City and State Aid design requirements. Our design will culminate in a Stormwater Management Report that includes all calculations and demonstrates compliance with all relevant stormwater regulations. This report will also include the storm sewer design calculations needed for State Aid approval of final plans. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review draft Stormwater Management Report CONSULTANT DELIVERABLES: ● Updated preliminary layout with BMP sizes and grading limits ● Stormwater management workshop meetings (including agenda, minutes, and supporting exhibits) ● Draft and final Stormwater Management Report Total Additional Design Fee for Task 10: $2,700.00 (Alliant only – TKDA fees listed as reimbursable expense) TASK 11 – FINAL DESIGN (NEW TASK) Cole Adams will lead the final design effort from a roadway perspective. We will prepare draft plans at the 30%, 60%, and 95% levels of completion and final 100% plans once all comments are addressed and all approvals have been obtained. The plan sets will include the major categories noted in our fee estimate and any others needed to produce a complete plan set. Alliant and TKDA will integrate the storm water and structural aspects of each design into each submittal. Following each draft submittal review period, we will prepare a Comment Resolution Log that includes all received City and County comments to document how comments are being addressed. Engineer’s Estimates will be prepared along with the 60%, 95%, and 100% complete plans. We will prepare a Project Manual in conjunction with the 95% submittal that includes all technical specifications based on the City’s standard special provisions. Once the project is advertised for bids, we will support the City with answering any clarification questions or preparing required addenda. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review draft submittals CONSULTANT DELIVERABLES: ● 30% Plans ● 60% Plans and Engineer’s Estimate ● 95% Plans, Specifications, and Engineer’s Estimate ● 100% Bidding Plans, Specifications, and Engineer’s Estimate (electronic and hard copy formats) ● Electronic copies of all project reports and documentation ● Addenda and clarifications during the bidding phase Design Fee for Task 11: $207,100.00 Page 15 of 445 Dodd Boulevard Modernization Project // 6 TASK 12 – CSAH 50 MILL-AND-OVERLAY DESIGN (NEW TASK ) Dakota County has planned a mill-and-overlay project between the proposed roundabout at Kenwood Trail/Dodd Boulevard and the western terminus of the recently constructed roundabout at Holyoke Avenue. To streamline design and construction and minimize public disturbance, the City and County have agreed to incorporate the design of the mill-and-overlay project into the Dodd Boulevard Modernization Project. Alliant will follow the County’s typical approach of using planimetric CAD data and high-definition aerial photography in lieu of topographic survey throughout the project area. Alliant survey crews will collect topographic survey and prepare base mapping where pedestrian ramps will be upgraded for ADA compliance. We will obtain a separate State Aid Number for this project area and track all pay items and quantities separately for tracking project costs. The design for this project will be integrated into the overall plan set and specifications for the project. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review draft submittals (concurrently with Task 11) CONSULTANT DELIVERABLES: ● Plans and specifications integrated into deliverables defined in Task 11. Design Fee for Task 12: $43,970.00 TASK 13 – PERMITS AND APPROVALS (NEW TASK) We will help the City obtain all the required approvals and permits for the project and will start the permitting processes with schedule recognition to ensure that bidding is not delayed. The wetland permitting noted in the RFP is included under Task 5. CITY OF LAKEVILLE RESPONSIBILITIES: ● Review draft permit applications and sign final application forms ● Pay any associated permit fees CONSULTANT DELIVERABLES: ● Draft and final permit applications with supporting graphics and documentation Design Fee for Task 12: $3,970.00 FEE SUMMARY Current Alliant Contract Amount for Preliminary Design $299,995 Alliant Fee for Final Design $397,050 Subconsultant – Braun Intertec $ 26,820 Subconsultant - TKDA $179,100 Subconsultant – SRF Consulting Group $237,800 SUBTOTAL FOR SUPPLEMENTAL AGREEMENT $842,770 Total Amended Alliant Contract Amount $1,142,765 Page 16 of 445 Dodd Boulevard Modernization Project // 7 SCHEDULE The City intends to begin construction on this project in spring 2027 with bidding in winter 2026/2027. Our schedule below highlights the targeted deadlines for major milestones and submittals: • Notice to Proceed – Week of February 16, 2026 • Begin right-of-way acquisition – March 2026 • Open House Meeting 1 (included in preliminary design contract) – May 2026 • 30% Plans, construction limits, and parcel sketches complete – June 30, 2026 • 60% Plans and Engineer’s Estimate – September 30, 2026 • Open House Meeting 2 – October 2026 • 95% Plans, Specifications, and Engineer’s Estimate submittal to City, County, and State Aid – December 1, 2026 • 100% Bidding Plans, Specifications, and Engineer’s Estimate – January 30, 2027 • Right-of-way acquisition complete – February 2027 • Bidding assistance – February/March 2027 • Pre-Construction Open House – Spring 2027 • Construction Services (under separate contract) – 2027 construction season KEY STAFF The Alliant design team will consist of the following individuals: • Eric Nelson, PE – Project Manager • Cole Adams, PE – Roadway Design Lead • Jonathan Libby, PE (TKDA) – Stormwater Design Lead • Jim Bellefeuille, PE (TKDA) – Structural Design Lead • Jackie Haugdahl – Public Engagement Support • Keara Fehr, WDC – Wetland Permitting Lead • Nick Grage, PE – Traffic Analysis • Dan Ekrem, PLS – Right-of-way documentation • Ken Helvey, PE (SRF) – Lead right-of-way agent • Kevin Zalec, PE (Braun Intertec) – Geotechnical Report updates Page 17 of 445 Dodd Boulevard Modernization Project // 8 We again thank you for the opportunity to work with the City on this project and are ready and eager to get started. If you have any questions about this scope and fee or want to discuss in further detail, please contact me at 612- 554-3413 or enelson@alliant-inc.com. Sincerely, Alliant Engineering, Inc. Eric Nelson, PE Project Manager EMAIL enelson@alliant-inc.com DIRECT 612.767.9380 Building better communities with excellence and passion ACCEPTED BY CITY OF LAKEVILLE ____________________________ Mayor ____________________________ City Clerk Page 18 of 445 Alliant EngineeringDodd Boulevard Modernization ProjectFinal Design Scope and FeePrincipal/ Project ManagerAssociate/ Professional Land SurveyorSenior Professional EngineerProfessional EngineerPublic Engagement SpecialistGraduate Engineer (EIT)Senior Environmental Specialist2-person Survey CrewGraphics/AdminNelsonEkremGrage Adams Haugdahl Fehr1.0Project Management12000160000013634,800.00 1.1Project administration (1)30301.2Weekly conference calls (2)30301.3PMT meetings (3) (4)3016461.4Project schedule and monthly updates15151.5Action Item Log and updates15152.0 Public Involvement 22 0 0 0 80 0 0 0 40 142 20,340.00 2.1 Update/refine Public Involvement Plan 2 4 62.2 Open House Meetings (5) 12 60 40 1122.3 Additional individual stakeholder meetings (6) 8 82.4 Maintain project website 16 163.0Right of Way (7)4040027054024018534,780.00 3.1Coordination of acquisition process (8)16163.2Meetings with affected property owners (9)16 24 403.3Parcel maps for affected properties (10)84027541294.0 Topographic Survey 0 0 0 0 0 0 0 64 0 64 14,720.00 4.1Additional topographic survey and basemapping64645.0 Environmental 2 0 0 0 0 32 24 0 0 58 8,180.00 5.1 Wetland permitting 23224586.0Geotechnical Evaluation2000000002540.00 6.1 Update Geotechnical Evaluation Report 2 27.0 Utility Identification and Coordination 8 0 0 22 0 24 0 0 0 54 8,220.00 7.1Utility Coordination Meetings (12)4 16 24 447.2Meetings with individual utilIty owners (13)4 6 108.0 Traffic Forecasting and Analysis 0 12 40 0 0 0 0 0 0 52 10,260.00 8.1Update Traffic Technical Memorandum4 8 128.2ICE reports for roundabouts8 32 409.0Preliminary Design00024040000648,200.00 9.1Preliminary layout updates (13)24406410.0Stormwater Management and Hydraulics Evaluation (15)100000000102,700.00 10.1Update and finalize stormwater management design8810.2Final Stormwater Management Report2211.0Final Design (16)(17)260367786640001504207,100.00 11.130% Plans11.1.1Title Sheet/General Layout/Index24611.1.2Typical Sections16163211.1.3Inplace Topo and Utility Plans12243611.1.4Removal Plans16163211.1.5Construction Plans40246411.260% Plans11.2.1Updates to 30% plan sections212163011.2.2Draft public utility relocation plans121628Task DescriptionTASKTOTAL COSTTEAM TOTALAlliant EngineeringHoursPage 19 of 445 11.2.3Draft construction staging plans2416406211.2.4Draft utility improvement/adjustment plans24406411.2.5Draft intersection details (18)161608025611.2.9Draft cross sections1008018011.360% Engineer's Estimate2161811.495% PlansUpdates to 60% plan sections28080162SEQ216826Quantity Tabulations4080120Detour/Traffic Control Plans162440Signing and Striping Plans404080Final cross sections with utilities, ROW, etc.16804013611.595% Engineer's Estimate21642211.695% Technical Specifications and Project Manual12243611.7100% Plans, Specifications, and Engineer's Estimate240327411.8Bidding Assistance012.0 CSAH 50 Mill-and-Overlay Design 4 2 0 136 0 160 0 16 0 0 43,970.00 12.1Additional topographic survey and basemapping for ped ramps2 1612.2Mill-and-overlay design2 40 6412.3Pedestrian ramp design2 96 9613.0 Permits and Approvals (19) 2 0 0 18 0 0 0 0 0 20 3,240.00 13.1NPDES Permit2 213.2MnDOT State Aid Submittal2 12 1413.3Dakota County Highway Permit2 213.4MDH Watermain Permit2 2PROJECT TOTAL HOURS236 54 76 1021 80 974 24 104 40 2271Hourly Billing Rates270$ 205$ 195$ 150$ 125$ 115$ 165$ 230$ 110$ DIRECT LABOR$63,720$11,070$14,820$153,150$10,000$112,010$3,960$23,920$4,400$397,050SUBTOTAL LABOR COST$397,050.00Direct Expenses:Subconsultant: Braun Intertec - Geotechnical Report updates$26,820.00Subconsultant: TKDA - Structural Design$74,194.00Subconsultant: TKDA - Water Resources Design$104,906.00Subconsultant: SRF Consulting Group - Right of Way acquisition$237,800.00Open house mailings, printing, venue fees, etc.$1,500.00Mileage$500.00SUBTOTAL DIRECT EXPENSES$445,720.00PROJECT COST NOT TO EXCEEDAssumptions:(1) Includes monthly invoices and progress reports (15-month project duration assumed, February 2026 through April 2027).(2) Assumes weekly 30-minutes Teams meetings with City and County project managers.(3) Assumes PMT meetings from February 2026 through April 2027 (15 meetings)(4) Hours include preparation of agendas, minutes, and other supporting materials as needed.(5) Assumes two public open houses and includes direct mailings, other digital outreach, graphics and supporting materials, and preparing meeting summaries.(6) Assumes four additional meetings. Hours include preparing agendas, minutes, and supporting graphics as needed.(7) Assumes 27 parcels will require land acquisition.(8) Hours shown are for Alliant only. See attached proposal from SRF Consulting Group. SRF fees are shown as reimbursable expense.(9) Hours include staking easements prior to property owner meetings.(10) Hours include preparing parcel sketches and legal descriptions.(11) Hours shown are for Alliant only. See attached proposal from Braun Intertec. Braun Intertec fees are shown as reimbursable expense.(12) Includes three utility coordination meetings per RFP. Hours include preparing agendas, minutes, and supporting graphics as needed.(13) Includes up to 3 individual meetings per RFP.(14) Includes up to 3 layout updates.(15) Hours shown are for Alliant only. See attached proposal from TKDA. TKDA fees are shown as reimbursable expense.(16) Hours for completing miscellaneous plan components such as design details, standard plates, etc. are embedded in these hours.(17) Hours includes QA/QC procedures with prior to each major submittal and a comment resolution log following each review.(18) Includes roundabout design details.(19) Hours for completing WCA permit are included in Task 5.$842,770.00Page 20 of 445 www.sr fconsulting.com 3701 Wayzata Boulevard, Suite 100 | Minneapolis, MN 55416-3791 | 763.475.0010 Equal Employment Opportunity/Affirmative Action Employer SRF Project No. 20088.PP January 13, 2026 Eric Nelson, Principal Alliant Engineering, Inc. 733 Marquette Avenue Suite 700 Minneapolis, MN 5542-2340 ENelson@alliant-inc.com Subject: Proposal for Professional Services for the Dodd Boulevard Project- Revised Dear Eric Nelson: Based on your request, SRF Consulting Group, Inc. (“SRF”) is pleased to submit this Proposal to provide professional services for Right of Way Acquisition for the Dodd Boulevard Project in Minneapolis. It is our pleasure to provide you with this proposal, and we look forward to the opportunity to work with Alliant Engineering, Inc. (Client) on this project. The SRF team includes right of way professionals who have a wide variety of experience in highway, municipal, utility, relocation, and community redevelopment projects. The project will be led by Cindy Wiste, SRF Senior Project Manager, who has 20 years of experience in the right of way profession. Scope of Services Acquisition Activities Project Management SRF’s Project Manager will maintain contact with the Client throughout the project and provide bi-weekly status reports. Title Analysis Provided by Alliant Owner Notifications and Field Title Reports SRF will provide owners of the 45 parcels with notification of the project; prepare full field title reports, including tenant information. Assumptions: 45 Parcels Appraisals and Review Appraisals Appraisals and Review Appraisals will be provided by DKJ Appraisal, LLC and Nolan Appraisals, LLC Assumptions: 27 Appraised Parcels Assumes no impacts to improvement, loss of parking or loss of primary access point. SRF Consulting Group - Scope and Fee for Right-of-Way Services Page 21 of 445 Eric Nelson January 12, 2026 Alliant Engineering, Inc. Page 2 of 6 Offer Packages and Document Preparation SRF will prepare the offer letter, statement of compensation, appraisal notification and receipt, and any other documents and forms required by the Client. The Client will provide sample conveyance documents to be used for this project. Assumptions: 27 Parcels Negotiation Activities The offers will be presented to the owners, in person, if possible, at the earliest possible time the affected owner is willing to meet with SRF personnel. In the case of an out-of-town owner, or when required by time constraints, the offer will be presented by certified mail, but continuing attempts will be made to contact the owner and meet at the earliest possible time after mailing the offer. The owner will receive a copy of the appraisal report, unless we are directed otherwise. All concerns and issues raised by an owner will be communicated to the Client. Communications will be by means of periodic status reports, telephone, or written correspondence, depending upon the nature of the issue. We will make recommendations and prepare an administrative settlement form for the parcel if a settlement more than the certified offer seems appropriate. Assumptions: 27 Parcels. Also, there is no minimum compensation, or loss of Going Concern Analysis included in this scope. Mortgage Consents SRF will assist with obtaining any required lender consents or subordinations. This task is assumed to be needed on the 9 blue parcels. Any fees required by the lender are NOT included in this proposal. Submittal of Parcel Files The acquisition files will include a contact diary in which every contact or attempted contact with the property owner is noted, whether by the agent responsible for the parcel or by other SRF staff. This diary will include relevant details about the substance of each contact. SRF will complete an internal review of all parcel files and submit a complete acquisition file to the city for payment and recordation. Assumptions SRF understands the project includes the acquisition of 27 Parcels as it is assumed that 18 of the purple parcels will be removed. For the “purple” parcels (27 parcels) where grading limits are expected to be within existing D&U easements (but still need to be confirmed), SRF assumes the following: • Assume Early Notification Letters are sent to all of the “purple” parcels, with the letter stating that property impacts are being confirmed and an acquisition may not be needed. • Assume 1/3 of the parcels (9 parcels) will require TE beyond the existing D&U. • Assume SRF will send a letter to the other 2/3 (18 parcels) stating that acquisition is not required from them (once construction limits are confirmed). Page 22 of 445 Eric Nelson January 12, 2026 Alliant Engineering, Inc. Page 3 of 6 Subconsultants SRF intends to use the following subconsultant(s): DKJ Appraisal, LLC., and Nolan Appraisals, LLC for appraisals and review appraisals. Any subconsultants will be required to enter a contract with SRF which will obligate the subconsultant to comply with all terms and conditions of this proposal related to the services that the subconsultant will provide. SRF shall pay all subconsultants within ten (10) business days of SRF’s receipt of payment for undisputed services provided by the subconsultant. Schedule SRF will complete this work within a mutually agreed-upon time schedule. Basis of Payment/Budget SRF proposes to be reimbursed for the Scope of Services on an hourly basis for the actual time expended. Other direct project expenses, such as printing, supplies, reproduction, etc., will be billed at cost and mileage will be billed at the current allowable IRS rate for business miles. Any subconsultants will be paid on an hourly or a lump sum basis. Invoices are submitted monthly for work performed during the previous month. Payment is due within 35 days. Based on SRF’s understanding of the project and our Scope of Services, the estimated cost for this Proposal, including any subconsultant budget, is $237,800 which includes both time and expenses. Lender fees not included. Project Management and Meetings $ 24,000 Right of Way Acquisition Services $120,000 Subconsultant – appraisals ($2,600/appraisal) $ 70,200 Subconsultant: - review appraisals ($800/review) $ 21,600 Expenses $ 2,000 Total Estimated Cost $ 237,800 Changes in Scope of Services It is understood that if the scope or extent of work changes, the cost will be adjusted accordingly. Before any out-of-scope work is initiated, however, SRF will submit a budget request for the new work and will not begin work until you provide authorization. Page 23 of 445 Eric Nelson January 12, 2026 Alliant Engineering, Inc. Page 4 of 6 Standard Terms and Conditions The attached Standard Terms and Conditions (Attachment A), together with this Proposal for professional services, constitute the entire agreement between you and SRF and supersedes all prior written or oral understandings. This agreement may only be amended, supplemented, modified, or canceled by a written instrument executed by both parties. Acceptance/Notice to Proceed A signed copy of this Proposal, mailed or emailed to Ken Helvey at the address khelvey@srfconsulting.com, will serve as acceptance of this Proposal and SRF’s notice to proceed. We appreciate your consideration of this Proposal and look forward to working with you on this project. Please feel free to contact us if you have any questions or need additional information. Sincerely, SRF Consulting Group, Inc. Cindy Wiste Ken Helvey Senior Project Manager Senior Project Director KH/cjw Attachment(s): Attachment A – Standard Terms and Conditions Approved: Kimley-Horn (signature) Name Title Date This cost proposal is valid for a period of 90 days. SRF reserves the right to adjust its cost estimate after 90 days from the date of this proposal. Page 24 of 445 Eric Nelson January 12, 2026 Alliant Engineering, Inc. Page 5 of 6 Attachment A – Standard Terms and Conditions Page 25 of 445 Eric Nelson January 12, 2026 Alliant Engineering, Inc. Page 6 of 6 Page 26 of 445 January 26, 2026 Project B2502275 Eric Nelson, PE Alliant Engineering, Inc. 733 Marquette Avenue, Suite 700 Minneapolis, MN 55402 Re: Change Order 1 Dodd Boulevard (CSAH 9) Modernization From 208th Street West to CSAH 50 (Kenwood Trail) Lakeville, Minnesota Dear Mr. Nelson: Braun Intertec Corporation (Braun Intertec) submits this Change Order 1 to complete two additional SPT borings and four additional hand auger borings for the Dodd Boulevard (CSAH 9) Modernization project in Lakeville, Minnesota. This Change Order amends the agreement between the parties dated March 11, 2025 (Alliant Engineering Subconsultant Agreement) to the above-referenced Project (“Agreement”) in the manner set forth below. Changed Scope of Services Per email correspondence with you on December 16, 2025, we understand as design has progressed the layout for Dodd Boulevard has been updated to include the following: ▪ Pedestrian Underpass: Shifted approximately 250 feet south of original proposed location ▪ Roundabout at 207th Street West ▪ An approximately 350-foot cast-in-place (CIP) retaining wall will be constructed on the east side of the pedestrian underpass running north and south (roughly 175 feet on each side of the tunnel) with assumed exposed wall heights between 8- to 18-feet. With the updated project layout, soil borings are required to provide geotechnical recommendations for support of the new retaining wall, new underpass location, and roundabout. In discussion with the design team, we have proposed an additional four soil borings for the project, three at the pedestrian tunnel/CIP retaining wall and one for the roundabout embankment at the southwest corner of 207th Street West and Dodd Boulevard. The soil borings are proposed to nominal depths of 30 to 50 feet below existing grade. Alongside the soil borings, we will also perform environmental soil screening and sampling on geotechnical soil borings. Braun Intertec - Scope and Fee for Geotechnical Services Page 27 of 445 Alliant Engineering, Inc. Dodd Boulevard (CSAH 9) Modernization Project B2502275 January 26, 2026 Braun Intertec Change Order 1 Page 2 We have also included an additional four hand auger borings to nominal depths of 6 to 8 feet (or hand auger refusal, whichever occurs first) for the roundabout embankments and trails on the west side of Dodd Boulevard, north of 207th Street West. This additional scope will be provided under the original agreement agreed upon between our parties, and all scope will generally follow what was provided in our original proposal for the project. Fees Authorization of this Change Order will affect the overall project budget as shown in Table 1 below. Table 1. Project Budget Summary Description Amount Current Authorized Contract Amount $ 34,955 Change Order 1 Site Layout - Staking - Utility Clearance - CADD $ 1,015 Drilling Services $ 12,590 Traffic Control $ 4,100 Hand Auger Borings $ 1,490 Sample Review and Laboratory Testing $ 2,590 Engineering and Reporting $ 5,035 Requested Change Order 1 Total $ 26,820 Revised Budget Total $ 61,775 Page 28 of 445 Alliant Engineering, Inc. Dodd Boulevard (CSAH 9) Modernization Project B2502275 January 26, 2026 Braun Intertec Change Order 1 Page 3 Authorization We appreciate the opportunity to continue our work with you. Services described in this Change Order will be provided under the terms of the parties’ Agreement and any prior change orders and/or amendments. To have questions answered regarding this Change Order, please contact Zach Semlak at 651.788.5071 (zsemlak@braunintertec.com). Sincerely, Braun Intertec Corporation Zachary T. Semlak, EIT Staff Engineer Valerie L. Wood Manager, Senior Scientist Kevin S. Zalec, PE Senior Manager, Senior Engineer The Change Order is accepted, and Braun Intertec is authorized to proceed. _____________________________________________ Authorizer’s Firm _____________________________________________ Authorizer’s Signature _____________________________________________ Authorizer’s Name (please print or type) _____________________________________________ Authorizer’s Title _____________________________________________ Date Page 29 of 445 January 16, 2026 Mr. Eric Nelson Principal Alliant Engineering, Inc. 733 Marquette Avenue South Minneapolis, Minnesota 55402 Re: Amendment for Engineering Services Dodd Boulevard (CSAH 9) Final Design City of Lakeville, Dakota County, Minnesota TKDA Project No. 0023626.000 Dear Mr. Nelson: In response to your request, we propose to provide additional Engineering Services in connection with Dodd Boulevard (CSAH 9) Final Design, in the City of Lakeville, hereinafter called the Project. Our services will be provided as an Amendment to our existing Engineering Subconsultant Agreement dated November 21, 2025. Hereinafter, Alliant Engineering, Inc., is referred to as the CLIENT, and the City of Lakeville is referred to as the OWNER. I. PROJECT DESCRIPTION The CLIENT has requested assistance completing final drainage, retaining wall, and bridge (box culvert) design services for the Project. The roadway plans are being completed by the CLIENT. The Project limits are from 208th Street West to Kenwood Trail (CSAH 50). The Project includes a roadway upgrade to a full urban section with roundabouts and a pedestrian tunnel as shown on the layout received from the CLIENT on November 9, 2025. The general scope of services for the final drainage design include catch basin spacing, storm sewer design, basin grading, plan sheets, and summary memorandum preparation. The general scope of services for the final structural design include standard retaining wall design and plans, standard box culvert design and plans, custom west wingwall designs, and custom design of the west connection between box culvert and retaining wall. II. SERVICES TO BE PROVIDED BY TKDA Based on TKDA’s understanding of the Project, we propose to provide the following Engineering services: A. Project Management 1. Prepare for and hold ten virtual progress meetings with the CLIENT. 2. Provide day-to-day management of internal staff, scheduling, correspondence, and invoicing. 3. Prepare Quality Management Plan for the Project and complete Quality Checking and Quality Assurance on deliverables. B. Drainage Design 1. Prepare catch basin spacing. Assumes a total of 75 structures. 2. Prepare storm sewer and minor culvert design. 3. Prepare final HydroCAD model of the proposed conditions, including three treatment basins. 4. Prepare final XP-SWMM model of floodplain, including two mitigation basins. 5. Prepare memorandum summarizing the design. Submit memorandum to City for review and concurrence. 6. Prepare construction plans for 30-, 60-, 90-, 95-, and final submittal. Construction plans will include Statement of Estimated Quantities, Standard Plan/Plate Tabulation, Drainage Tabulation, Erosion/Turf Tabulation, Drainage Plan, Drainage Profiles, Drainage Details, Grading Plans, Erosion/Turf Plans, and SWPPP Notes. Assumes eight sheet layout at 50-scale. 7. Prepare Division S Special Provisions for drainage related items. 8. Prepare cost estimate of the proposed drainage infrastructure. 9. Prepare State Aid Drainage submittal. TKDA - Scope and Fee for Water Resources and Structural Design Services Page 30 of 445 Mr. Eric Nelson | Alliant Engineering, Inc. Dodd Road Preliminary Drainage Design January 16, 2026 Page 2 C. Structural Design 1. Review CLIENT provided Geotechnical Report for the retaining wall and bridge (box culvert). 2. Develop standard spread footing supported retaining wall plans, to include concrete parapet and ornamental metal railing for approximately 396 feet of wall. 3. Develop standard 16W x 10H box culvert bridge plans for approximately 90-foot-long trail underpass. 4. Obtain new bridge number from MnDOT Bridge Inventory Management Unit. 5. Develop custom design and plans for west flared wingwalls with ornamental metal railings. 6. Develop custom connection design and details for box culvert - retaining wall interface on the east end of trail underpass. 7. Load rating calculations and forms. 8. Develop Division SB Special Provisions. 9. Develop lighting design and plans for wall pack lights within the box culvert. 10. Develop design and plans for security cameras near to or within the box culvert, depending on vertical clearances. III. ADDITIONAL SERVICES If authorized in writing by the CLIENT, we will furnish or obtain from others Additional Services of the types listed below which are not considered as basic services under this Amendment. Additional Services shall be billable on an Hourly Time and Materials basis and such billings shall be over and above any maximum amounts set forth in this Amendment. A. Plan turn-in and bidding support. B. Construction services as office support for shop drawings and RFI’s or as field inspection support for the construction of the box culvert and retaining wall. C. Additional final drainage or structural design that is not included under SECTION II. IV. CLIENT RESPONSIBILITIES These responsibilities shall include, but are not limited to the following: A. Designate one individual to act as a representative with respect to the work to be performed, and such person shall have complete authority to transmit instructions, receive information, interpret and define policies, and make decisions with respect to critical elements pertinent to the Project. This individual shall be identified in the signature block area of this Amendment. B. Provide TKDA with access to the site as required to perform services listed in SECTION II. C. Provide reviews of materials furnished by TKDA in a reasonable and prompt manner so the Project schedule can be maintained. D. Provide Geotechnical Report for the retaining wall and bridge (box culvert). V. PERIOD OF SERVICE We would expect to start our services promptly upon receipt of a fully singed Amendment and to complete SECTION II services by December 31, 2026. VI. COMPENSATION Compensation to TKDA for services provided as described in SECTION II of this Amendment shall be on an Hourly Time and Materials basis in the estimated amount of $179,100 resulting in a revised project limit of $220,800. Our detailed Project Fee Estimate is attached. The level of effort required to accomplish SECTION II services can be affected by factors which are beyond our control. Therefore, if it appears at any time charges for services rendered under SECTION II will exceed the above, we agree we will not perform services or incur costs which will result in billings in excess of such amount until we have been advised by you additional funds are available and our work can proceed. Page 31 of 445 Mr. Eric Nelson | Alliant Engineering, Inc. Dodd Road Preliminary Drainage Design January 16, 2026 Page 3 VII. CONTRACTUAL INTENT We thank you for the opportunity to submit this Amendment request. If acceptable, please issue the appropriate amendment to our Engineering Subconsultant Agreement for our review and execution. This Amendment request will be open for acceptance for 30 days, unless the provisions herein are changed by us in writing prior to that time. Please feel free to contact Jim Bellefeuille directly at 612.810.0646 or james.bellefeuille@tkda.com if you have any questions. Sincerely, James Bellefeuille, PE Matthew Christensen, PE Project Manager Vice President–Surface Transportation Attachments: Project Fee Estimate JJB:MJC:lmf/sfs Page 32 of 445 Project Fee Estimate Client: Alliant Engineering (City of Lakeville)Date: 1/16/2026 Project:Dodd Road Final Design Prepared By:JJB Estimated Person Hours Required Task Task Description GM Reg Eng Grad Eng SR Reg Eng SR Reg Eng Reg Eng Grad Admin A Project Management Client Meetings (10) 10 10 10 5 35 7,660$ Day-to-Day Management 4 20 24 6,324$ Quality Management Plan 24 24 2 50 12,812$ B Drainage Design Catch Basin Spacing 2 16 64 82 11,658$ Storm Sewer and Culvert Design 2 16 64 82 11,658$ HydroCAD Model 2 8 40 50 7,106$ XP-SWMM Model 2 24 8 34 6,050$ Memorandum Summarizing Design 2 16 24 4 46 7,002$ Estimated Quantities (1) 4 8 12 1,768$ Standard Plans/Plates (1) 2 2 254$ Drainage Tabulation (2) 8 24 32 4,552$ Erosion/Turf Tabulation (1) 2 8 10 1,392$ Drainage Plans (8) 2 8 40 50 7,106$ Drainage Profiles (4) 2 8 40 50 7,106$ Drainage Details (3) 2 4 8 14 2,290$ Grading Plans (5) 2 10 60 72 10,022$ Erosion/Turf Plans (8) 8 40 48 6,584$ SWPPP Notes (3) 2 8 10 1,392$ Division S - Drainage Items 4 4 2 10 2,008$ Cost Estimate 2 2 4 630$ State Aid Submittal 2 2 16 20 2,930$ D Structural Design Geotech Report 2 2 4 814$ Retaining Wall Plans 16 16 30 50 112 17,774$ Box Culvert Plans 16 30 50 96 13,550$ Bridge Number 2 2 286$ Wingwall Plans 16 20 36 4,808$ Box Culvert and Wingwall Connection Plans 4 16 20 40 5,548$ Load Rating 2 8 10 1,514$ Division S - wall items & Division SB 8 2 10 2,324$ Lighting Plans & Provisions 10 12 16 2 40 7,088$ Security Camera Plans & Provisions 10 12 16 2 40 7,088$ 62 152 456 100 62 104 172 19 1,127 261$ 188$ 127$ 264$ 185$ 143$ 126$ 106$ 16,182$ 28,576$ 57,912$ 26,400$ 11,470$ 14,872$ 21,672$ 2,014$ 179,098$ Expenses: Travel & Subsistence (TS)-$ Reproduction & Reprographics (RR)-$ Miscellaneous (MI)-$ Subconsultants -$ Subconsultant Mark-up 10%-$ Total Project Fees 179,098$ Total Not to Exceed 179,100$ Total Person Hours Billing Rate/Hr x Multiplier Total Billable for Charged Time Total Hours Total Dollars Page 33 of 445 Date: 3/16/2026 Resolution Approving Easement Agreement with Minnesota Energy Resources Proposed Action Staff recommends adoption of the following motion: Move to approve the grant of an exclusive permanent utility easement, access and parking easement, and temporary construction easement to Minnesota Energy Resources Corporation across City-owned property and authorizing execution of the Easement Agreement. Overview Minnesota Energy Resources has requested an easement across City-owned property (Lots 4-9, Block 5, Fairfield, and vacated Howland Avenue West right-of-way) for installation and maintenance of a new gas regulator and valve assembly facility. The new facility will replace an existing facility located approximately 250 feet to the northeast that requires relocation and replacement to provide for existing and future gas service area needs. The agreement grants: • A permanent utility easement for gas facilities. • A permanent access and parking easement for ingress/egress. • A temporary construction easement for staging equipment and materials during construction (expires upon substantial completion or December 31, 2026, whichever occurs first). The agreement includes provisions for restoration, landscaping, indemnification and compliance with City ordinances and permitting requirements. There is no direct cost to the City. Supporting Information 1. 2026.03.16 Resolution Granting Easements 2. 2026.03.16 Grant of Permanent Easement Financial Impact: $0 Budgeted: Yes Source: N/A Envision Lakeville Community Values: Safety Throughout the Community Report Completed by: Grace Ellis, Graduate Engineer Page 34 of 445 CITY OF LAKEVILLE RESOLUTION NO. 26-__ RESOLUTION APPROVING GRANT OF EXCLUSIVE PERMANENT UTILITY EASEMENT, ACCESS AND PARKING EASEMENT, AND TEMPORARY CONSTRUCTION EASEMENT TO MINNESOTA ENERGY RESOURCES COROPORATION WHEREAS, the City of Lakeville owns certain real property legally described on Exhibit A attached to the Easement Agreement; and WHEREAS, Minnesota Energy Resources Corporation has requested an exclusive, permanent utility easement, a non-exclusive access and parking easement, and a temporary construction easement across said property for the purpose of constructing, operating, and maintaining privately owned utility facities; and WHEREAS, the City Council finds that granting such easements will not interfere with the City’s use of the property and is in the public interest; and WHEREAS, Minnesota Statutes authorize the City Council to convey interests in real property by resolution. NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Lakeville: 1. The City Council hereby approves the grant of an exclusive, permanent utility easement, a non-exclusive access and parking easement, and a temporary construction easement to Minnesota Energy Resources Corporation across the property described in Exhibit A, substantially in the form of the Easement Agreement attached hereto as Exhibit 1. 2. The Mayor and City Clerk are authorized and directed to execute the Easement Agreement and any related documents on behalf of the City. 3. City staff is directed to ensure the Easement Agreement and all exhibits are properly recorded with the Dakota County Recorder’s Office. ADOPTED by the Lakeville City Council this 16th day of March 2026. CITY OF LAKEVILLE ______________________________ Luke M. Hellier, Mayor ATTEST: _________________________________ Ann Orlofsky, City Clerk Page 35 of 445 237583v10 GRANT OF PERMANENT EASEMENT THIS EASEMENT AGREEMENT (“Agreement”) is made and entered as of the 16th day of March 2026 (“Effective Date”), by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation, 20195 Holyoke Avenue, Lakeville, MN 55044 (“City”) and MINNESOTA ENERGY RESOURCES CORPORATION, a Delaware corporation, 2685 145th Street West, Rosemount, MN 55068 (“Grantee”) (Grantor and Grantee may be referred to individually as the “Party” or collectively, the “Parties”). RECITALS A. The City is the fee owner of property legally described on Exhibit A (“City Property”). B. Grantee desires an easement over City Property for the purpose of installing gas pipeline facilities. NOW, THEREFORE, in consideration of the sum of One and No/100 Dollars ($1.00) and other good and valuable consideration to it in hand paid by Grantee, the receipt and sufficiency of which is hereby acknowledged by the City: 1. Easements. A. Permanent Utility Easement. The City hereby grants unto Grantee, its, successors and assigns, forever, an exclusive easement subject to the limitations and reservations herein stated, to install, construct, operate, maintain, inspect, test, protect, alter, repair, reconstruct, replace, relocate, enlarge and remove gas regulators and valve assemblies together with and including the necessary foundations, protective barriers, piping and associated appurtenances, filters, gas process heating equipment, remote power actuator facilities together with an antenna and associated communication equipment, an electric transformer, wires, cable, anchor and guy wires, riser equipment and power pedestals for electric service and metering, solar power panel facilities, and other related appurtenances under and above-ground of such design and material as Grantee may deem necessary in the construction and operation of a gas regulator, valve assembly and other gas facilities by Grantee for the transmission and distribution of natural gas and all by-products thereof, or any liquids, gases, or substances which can or may be transported or distributed through a pipeline or pipelines, including customary growth and replacement thereof ("Utility System") over, across, on, under, and through land legally described on the attached Exhibit "B-1" and depicted on the attached Exhibit “B-2” ("Utility Easement Premises"). The City retains the right to landscape the Utility Easement Premises with grass, mulch or other similar material. Page 36 of 445 237583v10 B. Access and Parking Easement. In addition, the City grants to Grantee, its successors and assigns, a non-exclusive easement for vehicular parking and ingress and egress (“Access and Parking Easement”) from Howland Avenue to the Utility Easement Premises over, across, on, and through land legally described on attached Exhibit “C-1” and depicted on the attached Exhibit “C- 2” (“Access and Parking Easement Premises”), including the right to park within one parking stall as designated on attached Exhibit “C-2”; C. Temporary Construction Easement. In addition, the City grants to Grantee, its successors and assigns a temporary construction easement (“Temporary Construction Easement”) over, across, on and through the land legally described on the attached Exhibit “D-1” and depicted on the attached Exhibit “D-2” (“Temporary Easement Premises”). The purpose of the Temporary Construction Easement shall be solely for storing materials and construction equipment, and for use as a staging area during the period of construction of the Utility System within the Utility Easement Premises. The Temporary Construction Easement shall commence upon the Effective Date and shall terminate upon the earlier of a) the date upon which the Utility System is substantially completed; or b) December 31, 2026. 2. Location of Utility Facilities. The Utility System shall be located and constructed so as not to interfere with the safety and convenience of ordinary travel along and over currently existing public ways and so as not to disrupt normal operation of any facilities currently existing and used for providing sewer, water, or any other public utility service owned, operated, or abandoned by the City or agency thereof ("City Utility System"). Grantee’s construction, operation, repair, maintenance and location of such Utility System shall be subject to other ordinances or regulations of the City including permitting and fee requirements. 3. Protection of Utility System. A. Grantee shall take reasonable measures to prevent the Grantee’s Utility System from causing damage to persons or property. Grantee shall take reasonable measures to protect the Utility System from damage that could be inflicted on the Utility System by persons, property, or the elements. Grantee shall take protective measures to the extent reasonably necessary given the City’s work when the City performs work within the Utility Easement Premises near the Utility System, if given reasonable notice by the City of such work prior to its commencement. The City shall, and shall cause anyone claiming by, through or under the City, and their respective contractors, agents, and employees, to performing any work within the Utility Easement Premises and near the Utility System to use reasonable measures to prevent such work from causing damage to Grantee’s Utility System. B. The City agrees not to interfere with, obstruct, or perform or undertake any activity that could damage or restrict Grantee’s use or operation of the Utility System within the Utility Easement Premises or the rights granted to Grantee by this instrument, except as necessary for the City to operate and abandon the City Utility System located within the Utility Easement Premises. Additionally, City agrees not to encroach upon the Utility Easement Premises by filling, excavating or erecting buildings or permanent enclosures unless the same are pre-approved by Grantee, which approval shall not be unreasonably delayed or withheld. City understands and agrees that Grantee may remove any unapproved encroachments or obstructions City places on the Utility Easement Premises, at City’s expense. Page 37 of 445 237583v10 C. City agrees that future utilities of other entities will not be located within the Utility Easement Premises without Grantee’s advance written consent, which consent shall not be unreasonably delayed or withheld. 4. Restoration, Landscaping and Maintenance. Upon completion of any work requiring the opening of the Utility Easement Premises, Grantee shall, in all cases, place the Utility Easement Premises in, on, under or across which the same are located in as good condition as they were prior to said operation. In addition, Grantee shall landscape the Utility Easement Premises and screen the Utility System in accordance with the landscape plan attached hereto as Exhibit E (“Landscape Plan”). Grantee shall also maintain the landscaping in good condition for two (2) years thereafter. Grantee shall also be responsible for removing and maintaining larger trees within the Utility Easement Premises to prevent any damage from falling trees or branches. The work shall be completed as promptly as weather permits, and if Grantee shall not promptly perform and complete the work, remove all dirt, rubbish, equipment and material, and put the Utility Easement Premises in the said condition, the City shall have, after demand to Grantee to cure and the passage of a reasonable period of time following the demand, but not to exceed five (5) days, the right to make the restoration at the expense of Grantee. Grantee shall pay to the City the cost of such work done for or performed by the City, including its administrative expenses and overhead. 5. Permission for Excavation. Grantee shall not open or disturb the surface of the Utility Easement Premises for any purpose without first providing the City with 3 days advance written notice, except where an emergency exists requiring the immediate repair of Utility System. In such event Grantee shall notify the City by telephone to the office designated by the City before opening or disturbing the Utility Easement Premises. 6. Termination. These Easements provided under this Agreement shall terminate if the Utility System is abandoned or relocated from the City Property. 7. Indemnification. Grantee shall indemnify, keep and hold the City, its elected officials, officers, employees, and agents free and harmless from any and all liability on account of injury or death of persons or damage to or depreciation in value of property occasioned by its negligence in the construction, maintenance, repair, inspection, operation, or abandonment of the Utility System in, on, over, under, or across the Utility Easement Premises. The City shall not be indemnified for losses or claims occasioned through its own negligence and/or the negligence of its contractors, agents, and employees. Notwithstanding the foregoing, the City’s limits of liability shall be subject to the limits of liability provided under Minn. Stat. Ch. 466. 8. Grantee to Defend Claims. In the event a suit is brought against the City under circumstances where this agreement to indemnify applies, Grantee at its sole cost and expense shall defend the City in such suit if written notice thereof is promptly given to Grantee within a period wherein Grantee is not prejudiced by lack of such notice. If Grantee is required to indemnify and defend, it will thereafter have control of such litigation, but Grantee may not settle such litigation without the consent of the City, which consent shall not be unreasonably withheld. This section is not, as to third parties, a waiver of any defense or immunity otherwise available to the City; and Grantee, in defending any action on behalf of the City, shall be entitled to assert in any action every defense or immunity that the City could assert in its own behalf. Page 38 of 445 237583v10 9. Compliance with Applicable Laws. Grantee shall at all times comply with all applicable laws, ordinances, rules, regulations, and codes, federal, state, and local, whether now or hereafter promulgated or enacted. 10. Failure to Exercise Rights. Grantee may exercise the rights conveyed herein from time to time as may be necessary and convenient, and Grantee’s failure to exercise said rights will not limit or extinguish said rights. Except as provided in Paragraph 6, Grantee’s rights can only be extinguished or modified by a written instrument executed by Grantee and filed of record. 11. Recitals. Recitals are incorporated and made a part of this Agreement. 12. Authority. The persons signing this Agreement have the real and apparent authority to bind the respective parties. 13. Counterparts. This Agreement may be executed in any number of counterparts, each of which will be deemed to be an original, but all of which, when taken together, constitute the same instrument. IN TESTIMONY WHEREOF, the Parties hereto have signed this document this 16th day of March 2026. [Remainder of Page Intentionally Left Blank] Page 39 of 445 237583v10 CITY OF LAKEVILLE By: Luke M. Hellier, Mayor And: Ann Orlofsky, City Clerk STATE OF MINNESOTA ) ) ss. COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this ____ day of _______________ 2026, by Luke M. Hellier and Ann Orlofsky, respectively the Mayor and City Clerk of the City of Lakeville, a Minnesota municipal corporation, City, on behalf of the corporation and pursuant to the authority granted by the City Council. ___________________________________ Notary Public Page 40 of 445 237583v10 GRANTEE: MINNESOTA ENERGY RESOURCES CORPORATION, a Delaware Corporation By: WEC Business Services LLC, Its Affiliate and Agent By: Kory J. Rentmeester, Manager Property Management STATE OF WISCONSIN ) ) ss. COUNTY OF BROWN ) The foregoing instrument was acknowledged before me this ____ day of _______________ 2026, the above named Kory J. Rentmeester, as Manager Property Management on behalf of Minnesota Energy Resources Corporation, known to me to be the person who executed the foregoing instrument and acknowledged the same on behalf of said corporation by its authority. ___________________________________ Notary Public THIS INSTRUMENT WAS DRAFTED BY: CAMPBELL KNUTSON Professional Association 317 Eagandale Office Center 1380 Corporate Center Curve Eagan, Minnesota 55121 Telephone: (651) 452-5000 Page 41 of 445 RExhibit A PARCEL ID 224445005091: Lots 4, 5, 6, 7, 8, and 9, Block 5, Fairfield, AND that part of the vacated right of way of Howland Avenue West, formerly known as Ruby Street accruing thereto, Dakota County, Minnesota. Said vacated right of way is described as follows: The West 20 feet of that part of Howland Avenue West, formerly known as Ruby Street, and originally platted as Cherry Street, Town of Fairfield, now Lakevi lle, commencing on the South line of the plat of the Towns of Fairfield, now Lakeville, and running thence North to the intersection of said Street with Upper 206th Street West, formerly Front Street, according to the plat thereof on file and of record in the office of the Register of Deeds within and for Dakota County, Minnesota. SHEET 1 of 1Page 42 of 445 RSHEET 1 of 1Exhibit B-1Page 43 of 445 XXXXXXXXXXXXRExhibit B-2SHEET 1 of 1Page 44 of 445 RExhibit C-1 PARCEL ID 224445005091: Lots 4, 5, 6, 7, 8, and 9, Block 5, Fairfield, AND that part of the vacated right of way of Howland Avenue West, formerly known as Ruby Street accruing thereto, Dakota County, Minnesota. Said vacated right of way is described as follows: The West 20 feet of that part of Howland Avenue West, formerly known as Ruby Street, and originally platted as Cherry Street, Town of Fairfield, now Lakevi lle, commencing on the South line of the plat of the Towns of Fairfield, now Lakeville, and running thence North to the intersection of said Street with Upper 206th Street West, formerly Front Street, according to the plat thereof on file and of record in the office of the Register of Deeds within and for Dakota County, Minnesota. SHEET 1 of 1Page 45 of 445 RExhibit C-2SHEET 1 of 1Parcel Boundary209th Street WHowland Ave.Designated parking stallnPage 46 of 445 RExhibit D-1 PARCEL ID 224445005091: Lots 4, 5, 6, 7, 8, and 9, Block 5, Fairfield, AND that part of the vacated right of way of Howland Avenue West, formerly known as Ruby Street accruing thereto, Dakota County, Minnesota. Said vacated right of way is described as follows: The West 20 feet of that part of Howland Avenue West, formerly known as Ruby Street, and originally platted as Cherry Street, Town of Fairfield, now Lakevi lle, commencing on the South line of the plat of the Towns of Fairfield, now Lakeville, and running thence North to the intersection of said Street with Upper 206th Street West, formerly Front Street, according to the plat thereof on file and of record in the office of the Register of Deeds within and for Dakota County, Minnesota. SHEET 1 of 1Page 47 of 445 RExhibit D-2SHEET 1 of 1Parcel Boundary209th Street WHowland Ave.n100'20'Temporary ConstructionEasementPage 48 of 445 XXXXXXXXXXBerckman's Golden Arborvitae(Typical) spaced approx. 4' on centerExhibit EExample picture of Berckman's Golden ArborvitaeSHEET 1 of 1Page 49 of 445 Date: 3/16/2026 Resolution Appointing Members to Advisory Boards, Committees and Commissions Proposed Action Staff recommends adoption of the following motion: Approve the resolution appointing members to advisory boards, committees, and commissions. Overview This resolution approves the appointment of members to advisory boards, committees, and commissions. These individuals were selected by the City Council following an interview process. Supporting Information 1. Resolution Appointing Members to Advisory Boards, Committees, and Commissions Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Taylor Snider Page 50 of 445 CITY OF LAKEVILLE RESOLUTION NO. 26- RESOLUTION APPOINTING MEMBERS TO ADVISORY BOARDS, COMMITTEES AND COMMISSIONS WHEREAS, advisory boards, committees, and commissions are comprised of knowledgeable, prominent and credible members in their field of expertise from within the Lakeville community that are responsible for providing non- binding professional and strategic advice to the City Council; and WHEREAS, the City Council annually reviews the membership of each board, committee and commission, advertises for open positions and considers appointment of new and existing members. NOW, THEREFORE, BE IT RESOLVED that the City Council hereby appoints members as listed on the attached Exhibit A effective April 1, 2026. ADOPTED by the Lakeville City Council this 16th day of March 2026. ______________________________ Luke Hellier, Mayor _________________________________ Ann Orlofsky, City Clerk EXHIBIT A Page 51 of 445 Lakeville Area Arts Center Board 3-year terms Diane Tran Chris Foss Linda Hanson 1-year term (alternate) Kelly Anderson Friends of the Lakeville Area Arts Center Appointment 1-year term (ex- officio) Bob Erickson Lakeville Area Chamber of Commerce Appointment 1-year term (ex- officio) Jeanne Hutter Economic Development Commission 3-year terms Roz Peterson Don Seiler John Ricketts Full member, term ending 2028 Anita Drentlaw Full member, term ending 2027 Joe Pannkuk 1-year term (alternate) Josh Melton Finance Committee 3-year terms Barry Fick Laird Hanson Drew Boxrud Parks, Recreation & Natural Resources Committee 3-year terms Angie Lueschen Rachel Bland Planning Commission 3-year terms Scott Einck Christine Zimmer Pat Kaluza 1-year terms (alternate) Erin Duckworth Bryce Schuenke Police Department Representative 1-year term (ex- officio) Kelli Coughlin Page 52 of 445 Date: 3/16/2026 Quote for Water Meters Proposed Action Staff recommends adoption of the following motion: Move to approve water meter purchase from Ferguson Waterworks. Overview Lakeville provides metered water service to residential, commercial, and industrial customers and currently maintains more than 25,000 meters in service. This purchase of 1" meters will replenish inventory needed for ongoing repairs, replacements, and new construction activities. 1" meters are typically used for larger residential units or small commercial units. The Utilities Division requested a quote from Ferguson Waterworks for Neptune water meters, which are compatible with the City’s fixed-base meter reading system. Lakeville has standardized on Neptune meters, and Ferguson Waterworks is the sole regional supplier. Ferguson Waterworks submitted a quote in the amount of $38,500.00. Supporting Information 1. Ferguson Meter Quote Financial Impact: $38,500.00 Budgeted: No Source: Water Fund Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Shane Quade, Utilities Superintendent Page 53 of 445 FERGUSON WATERWORKS #2518 1694 91ST AVE NE BLAINE, MN 55449-4311 Phone: 763-560-5200 Fax: 763-560-1799 Deliver To: From:Brian Rollins brian.rollins@ferguson.com Comments: HOW ARE WE DOING? WE WANT YOUR FEEDBACK! Scan the QR code or use the link below to complete a survey about your bids: https://survey.medallia.com/?bidsorder&fc=2518&on=24675 16:12:46 MAR 03 2026 FERGUSON WATERWORKS #2518 Price Quotation Phone: 763-560-5200 Fax: 763-560-1799 Bid No:B183146 Bid Date:03/03/26 Quoted By:BRR Cust Phone:952-985-4400 Terms:NET 10TH PROX Customer:CITY OF LAKEVILLE 18400 IPAVA AVE W ATTN: ACCOUNTS PAYABLE 20195 HOLYOKE AVE LAKEVILLE, MN 55044 Ship To:CITY OF LAKEVILLE 18400 IPAVA AVE W ATTN: ACCOUNTS PAYABLE 20195 HOLYOKE AVE LAKEVILLE, MN 55044 Cust PO#:1" METERS Job Name:METER ACCOUNT Page 1 of 1 Item Description Quantity Net Price UM Total NED2F11RPDG11 LF 1 T10 MTR P/C R900I USG 70 550.000 EA 38500.00 Net Total:$38500.00 Tax:$0.00 Freight:$0.00 Total:$38500.00 Quoted prices are based upon receipt of the total quantity for immediate shipment (48 hours). SHIPMENTS BEYOND 48 HOURS SHALL BE AT THE PRICE IN EFFECT AT TIME OF SHIPMENT UNLESS NOTED OTHERWISE. QUOTES FOR PRODUCTS SHIPPED FOR RESALE Due to the uncertain impact of potential tariffs, Ferguson's quotation/proposal has not included any provision or contingency for future tariffs or increase of existing tariffs. Ferguson reserves the right to adjust prices to reflect the impact of any new or increased tariffs that affect our costs at the time of shipment. Ferguson will provide notice of any such adjustments along with documentation supporting the changes. CONTRACTOR CUSTOMERS: IF YOU HAVE DBE/MBE/WBE//VBE/SDVBE/SBE GOOD FAITH EFFORTS DIVERSITY GOALS/ REQUIREMENTS ON A FEDERAL, STATE, LOCAL GOVERNMENT, PRIVATE SECTOR PROJECT, PLEASE CONTACT YOUR BRANCH SALES REPRESENATIVE IMMEDIATELY PRIOR TO RECEIVING A QUOTE/ORDER. ARE NOT FIRM UNLESS NOTED OTHERWISE. https://www.ferguson.com/content/website-info/terms-of-sale LEAD LAW WARNING: It is illegal to install products that are not "lead free" in accordance with US Federal or other applicable law in potable water systems anticipated for human consumption. Products with *NP in the description are NOT lead free and can only be installed in non-potable applications. Buyer is solely responsible for product selection. Seller not responsible for delays, lack of product or increase of pricing due to causes beyond our control, and/or based upon Local, State and Federal laws governing type of products that can be sold or put into commerce. This Quote is offered contingent upon the Buyer's acceptance of Seller's terms and conditions, which are incorporated by reference and found either following this document, or on the web at Govt Buyers: All items are open market unless noted otherwise. Page 54 of 445 Date: 3/16/2026 Resolution Calling a Public Hearing on Proposed Assessments for City Improvement Project 26-01 Proposed Action Staff recommends adoption of the following motion: Move to approve a resolution calling a public hearing on proposed assessments for the 2026 214th Street Reconstruction Project, City Project 26-01. Overview On December 1, 2025, the Lakeville City Council held a public hearing to notify property owners of the proposed 214th Street Reconstruction Project (City Project No. 26-01), including the estimated pending assessment amounts. At the conclusion of the hearing, the City Council ordered the improvement and authorized the preparation of the final plans and specifications. On February 26, 2026, the City received three bids for the construction of City Project No. 26- 01. Total project bids ranged from a low bid of $3,573,635.40 submitted by McNamara Contracting to a high bid of $4,201,097.82. The portion of the bids associated with the 214th Street Reconstruction ranged from a low bid of $484,831.45 (McNamara Contracting) to a high bid of $643,942.77. The Engineer’s construction estimate for the 214th Street portion of the project was $545,318, and the estimated construction cost presented in the Feasibility Report was $577,374. Staff has reviewed the bids and supporting documentation and recommends setting the assessment hearing date. Supporting Information 1. Resolution Financial Impact: $484,831.45 Budgeted: Yes Source: Multiple Sources Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Steve Ferraro, Public Works Coordinator Page 55 of 445 CITY OF LAKEVILLE RESOLUTION NO. 26- Resolution Calling a Public Hearing on Proposed Assessments for the 2026 214th Street Reconstruction, City Project 26-01 WHEREAS, pursuant to the direction of the City Council, the City Clerk prepared a proposed assessment roll on the cost of City Project 26-01 to include portions of roads located within the following developments and lands: Imperial First Addition, Airlake Industrial Park 1st Addition, and Airlake Development Addition, City Project 26-01; and NOW, THEREFORE, BE IT RESOLVED by the City Council of Lakeville, Minnesota: 1. A hearing shall be held on Monday, April 6, 2026 at the Lakeville Council Chambers, 20195 Holyoke Avenue, at 6:00 p.m. or as soon thereafter as the matter can be heard to pass upon such proposed assessment and, at such time and place, all persons owning property affected by such improvement will be given an opportunity to be heard with reference to such assessment. 2. The City Clerk is hereby directed to cause a notice of the hearing on the proposed assessment to be published once in the official newspaper at least two weeks prior to the hearing and shall state in the notice the total cost of the improvement. The City Clerk shall also cause mailed notice to be given to the owner of each parcel described in the assessment roll not less than two weeks prior to the hearing. 3. The owner of any property so assessed may, at any time prior to certification of the assessment to the county auditor, pay the whole of the assessment on such property, with interest accrued to the date of payment, to the City of Lakeville, except that no interest shall be charged if the entire assessment is paid on or before November 15, 2026. The first-year installment payments will include interest accrued from November 16, 2026 – December 31, 2026. The property owner may at any time thereafter, pay to the City of Lakeville the entire amount of the assessment remaining unpaid, with interest accrued to December 31 of the year in which such payment is made. Such payment must be made before November 15 or interest will be charged through December 31 of the succeeding year. ADOPTED by the Lakeville City Council this 16th day of March 2026. ______________________________ Luke M. Hellier, Mayor _________________________________ Ann Orlofsky, City Clerk Page 56 of 445 Date: 3/16/2026 Contract and Resolution for the 2026 Street Rehabilitation Project Proposed Action Staff recommends adoption of the following motion: Move to approve resolution and award a contract to McNamara, Inc, for the 2026 Street Rehabilitation Project, City Project 26-02. Overview Each year, the City programs streets for rehabilitation, such as mill and overlays, that have reached a condition where improvements are necessary to prevent further deterioration that could eventually require full reconstruction. These projects are intended to extend the life of the pavement and protect the City’s public infrastructure assets. The proposed improvements are located in the Dakota Heights neighborhood and include approximately 5.25 miles of local streets. Project work includes milling and overlaying the pavement, replacement of watermain hydrants and gate valves, selective curb and gutter replacement, sidewalk and ADA pedestrian ramp improvements, new storm sewer installation, replacement and lining of existing storm sewer pipes, and storm sewer basin maintenance. There are no assessments planned in association with this project. On February 25, 2026, at 10:30 a.m., the City received six bids for City Project No. 26-02, ranging from the low bid of $4,267,884.20 submitted by McNamara, Inc. to a high bid of $5,995,819.10. The project was designed by WSB & Associates and will be inspected and managed by City staff during the 2026 construction season. Including a 5% construction contingency with all the indirect project costs—such as engineering design, preliminary geotechnical investigation, materials testing, surveying, construction inspection, and project administration the total project costs are estimated at $5,252,286. These indirect costs are estimated at $984,402. Staff has reviewed all bids and supporting documentation and finds them acceptable. Staff recommends award of the contract to the lowest responsible bidder, McNamara, Inc. Supporting Information 1. Contract 2. Budget Resolution 3. Project Financing 4. Bid Tabulation 5. Project Location Exhibit 6. 2026 Street Rehab wsb Recommendation Letter Page 57 of 445 Financial Impact: $5,252,286 Budgeted: Yes Source: Multiple Sources Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Steve Ferraro, Public Works Coordinator Page 58 of 445 AGREEMENT BETWEEN OWNER AND CONTRACTOR FOR CONSTRUCTION CONTRACT 2026 STREET REHABILITATION PROJECT AGREEMENT CITY OF LAKEVILLE PROJECT NO. 26-02 WSB PROJECT NO. 031257-000 PAGE 1 THIS AGREEMENT is by and between the City of Lakeville (“Owner”) and McNamara Contracting, Inc. (“Contractor”). Terms used in this Agreement have the meanings stated in the General Conditions and the Supplementary Conditions. Owner and Contractor hereby agree as follows: ARTICLE - 1 WORK 1.01 Contractor shall complete all Work as specified or indicated in the Contract Documents. The Work is generally described as follows: The furnishing of all labor, materials, tools, and equipment necessary to complete the street construction, watermain, sanitary sewer, storm sewer, grading, pedestrian ramps, turf restoration, and appurtenant work as shown on the Plans and specified herein. ARTICLE - 2 THE PROJECT 2.01 The Project, of which the Work under the Contract Documents is a part, is generally described as follows: 2026 Street Rehabilitation Project for the City of Lakeville, City Project No. 26-02, WSB Project No. 031257-000. ARTICLE - 3 ENGINEER 3.01 The Owner has retained WSB LLC (“Engineer”) to act as Owner’s representative, assume all duties and responsibilities, and have the rights and authority assigned to Engineer in the Contract. 3.02 The part of the Project that pertains to the Work has been designed by WSB LLC. ARTICLE - 4 CONTRACT TIMES 4.01 Time is of the Essence A. All time limits for Milestones, if any, Substantial Completion, and completion and readiness for final payment as stated in the Contract Documents are of the essence of the Contract. 4.02 Contract Times: Dates A. The Work will be substantially completed on or before September 18, 2026, and completed and ready for final payment in accordance with Paragraph 15.06 of the General Conditions on or before October 9, 2026. 4.03 Liquidated Damages A. Contractor and Owner recognize that time is of the essence as stated in Paragraph 4.01 above and that Owner will suffer financial and other losses if the Work is not completed and Milestones not achieved within the Contract Times, as duly modified. The parties also recognize the delays, expense, and difficulties involved in proving, in a legal or arbitration proceeding, the actual loss suffered by Owner if the Work is not completed on time. Accordingly, instead of requiring any such proof, Owner and Contractor agree that as liquidated damages for delay (but not as a penalty): Page 59 of 445 2026 STREET REHABILITATION PROJECT AGREEMENT CITY OF LAKEVILLE PROJECT NO. 26-02 WSB PROJECT NO. 031257-000 PAGE 2 1. Substantial Completion: Contractor shall pay Owner liquidated damages in accordance with MnDOT Table 1807.1-1 for each Calendar Day that expires after the time (as duly adjusted pursuant to the Contract) specified above for Substantial Completion, until the Work is substantially complete. 2. Completion of Remaining Work: After Substantial Completion, if Contractor shall neglect, refuse, or fail to complete the remaining Work within the Contract Time (as duly adjusted pursuant to the Contract) for completion and readiness for final payment, Contractor shall pay Owner liquidated damages in accordance with MnDOT Table 1807.1-1 for each Calendar Day that expires after such time until the Work is completed and ready for final payment. 3. Liquidated damages for failing to timely attain Milestones, Substantial Completion and final completion are not additive and will not be imposed concurrently. ARTICLE - 5 CONTRACT PRICE 5.01 Owner shall pay Contractor for completion of the Work in accordance with the Contract Documents the amounts that follow, subject to adjustment under the Contract: A. Contract Price: Four Million Two Hundred Sixty-seven Thousand Eight Hundred Eighty-four and 20/100 Dollars ($4,267,884.20) for Base Bid and Alternate No. 1 subject to adjustment based on the provisions of the Contract. B. For all Unit Price Work, an amount equal to the sum of the extended prices (established for each separately identified item of Unit Price Work by multiplying the unit price times the actual quantity of that item). The extended prices for Unit Price Work set forth as of the Effective Date of the Contract are based on estimated quantities. As provided in Paragraph 13.03 of the General Conditions, estimated quantities are not guaranteed, and determinations of actual quantities and classifications are to be made by Engineer. C. The Contractor’s Bid, attached hereto as an exhibit, provides the basis for the extended prices for Unit Price Work. ARTICLE - 6 PAYMENT PROCEDURES 6.01 Submittal and Processing of Payments A. Contractor shall submit Applications for Payment in accordance with Article 15 of the General Conditions. Applications for Payment will be processed by Engineer as provided in the General Conditions. 6.02 Progress Payments; Retainage A. Owner shall make progress payments on the basis of Contractor’s Applications for Payment on or about the third Monday of each month during performance of the Work as provided in Paragraph 6.02.A.1 below, provided that such Applications for Payment have been submitted in a timely manner and otherwise meet the requirements of the Contract. All such payments will be measured by the Schedule of Values established as provided in the General Conditions (and in the case of Unit Price Work based on the number of units completed) or, in the event there is no Schedule of Values, as provided elsewhere in the Contract. 1. Prior to Substantial Completion, progress payments will be made in an amount equal to the percentage indicated below but, in each case, less the aggregate of payments previously made and less such amounts as Owner may withhold, including but not limited to liquidated damages, in accordance with the Contract. Page 60 of 445 2026 STREET REHABILITATION PROJECT AGREEMENT CITY OF LAKEVILLE PROJECT NO. 26-02 WSB PROJECT NO. 031257-000 PAGE 3 a. 95 percent of Work completed (with the balance being retainage). 1) If 50 percent or more of the Work has been completed, as determined by Engineer, and if the character and progress of the Work have been satisfactory to Owner and Engineer, then as long as the character and progress of the Work remain satisfactory to Owner and Engineer, there will be no additional retainage; and b. 95 percent of cost of materials and equipment not incorporated in the Work (with the balance being retainage). B. Upon Substantial Completion, Contractor shall submit to the Engineer an Application for Payment for the retainage amount less the following amounts: 1. 250 percent of the anticipated cost to correct or complete work known at the time of Substantial Completion, including any punch list items; and 2. the greater of $500 or 1 percent of the Contract price to ensure delivery of final paperwork which includes, but is not limited to operation manuals, payroll documents for projects subject to prevailing wage requirements, and the IC134 form. The Owner, upon certification from the Engineer, shall make payment of any undisputed amounts within 30 days of receipt of the Application for Payment. 6.03 Final Payment A. Upon final completion and acceptance of the Work, Owner shall pay the remainder of the Contract Price in accordance with Paragraph 15.06 of the General Conditions. 6.04 Consent of Surety A. Owner will not make final payment or return or release retainage at Substantial Completion or at any other time, unless Contractor submits written consent of the surety to such payment, return, or release. 6.05 Interest A. All amounts not paid when due shall bear interest at the rate of 0 percent per month. ARTICLE - 7 CONTRACT DOCUMENTS 7.01 Contents A. The Contract Documents consist of all of the following: 1. This Agreement. 2. Bonds: a. Performance bond (together with power of attorney). b. Payment bond (together with power of attorney). 3. General Conditions. 4. Supplementary Conditions. 5. Specifications as listed in the table of contents of the Project Manual. Page 61 of 445 2026 STREET REHABILITATION PROJECT AGREEMENT CITY OF LAKEVILLE PROJECT NO. 26-02 WSB PROJECT NO. 031257-000 PAGE 4 6. Drawings (not attached but incorporated by reference) consisting of 48 sheets with each sheet bearing the following general title: 2026 Street Rehabilitation Project, dated February 2, 2026. 7. Addenda (numbers 1 to 1 inclusive). 8. Exhibits to this Agreement (enumerated as follows): a. bidVAULT Bid Worksheet. b. Completed Bidder Information Form. c. Non-Collusion Affidavit. d. Responsible Contractor Verification and Certification of Compliance Form. 9. The following which may be delivered or issued on or after the Effective Date of the Contract and are not attached hereto: a. Notice to Proceed. b. Work Change Directives. c. Change Orders. d. Field Orders. e. Maintenance Bond. B. The Contract Documents listed in Paragraph 7.01.A are attached to this Agreement (except as expressly noted otherwise above). C. There are no Contract Documents other than those listed above in this Article 7. D. The Contract Documents may only be amended, modified, or supplemented as provided in the Contract. ARTICLE - 8 REPRESENTATIONS, CERTIFICATIONS, AND STIPULATIONS 8.01 Contractor’s Representations A. In order to induce the Owner to enter into this Contract, Contractor makes the following representations: 1. Contractor has examined and carefully studied the Contract Documents, including Addenda. 2. Contractor has visited the Site, conducted a thorough, alert visual examination of the Site and adjacent areas, and become familiar with the general, local, and Site conditions that may affect cost, progress, and performance of the Work. 3. Contractor is familiar with all Laws and Regulations that may affect cost, progress, and performance of the Work. 4. Contractor has carefully studied the reports of explorations and tests of subsurface conditions at or adjacent to the Site and the drawings of physical conditions relating to existing surface or subsurface structures at the Site that have been identified in the Supplementary Conditions, with respect to the Technical Data in such reports and drawings. 5. Contractor has carefully studied the reports and drawings relating to Hazardous Environmental Conditions, if any, at or adjacent to the Site that have been identified in the Supplementary Conditions, with respect to Technical Data in such reports and drawings. 6. Contractor has considered the information known to Contractor itself; information commonly known to contractors doing business in the locality of the Site; information and observations obtained from visits to the Site; the Contract Documents; and the Technical Page 62 of 445 2026 STREET REHABILITATION PROJECT AGREEMENT CITY OF LAKEVILLE PROJECT NO. 26-02 WSB PROJECT NO. 031257-000 PAGE 5 Data identified in the Supplementary Conditions or by definition, with respect to the effect of such information, observations, and Technical Data on (a) the cost, progress, and performance of the Work; (b) the means, methods, techniques, sequences, and procedures of construction to be employed by Contractor; and (c) Contractor’s safety precautions and programs. 7. Based on the information and observations referred to in the preceding paragraph, Contractor agrees that no further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions the Contract. 8. Contractor is aware of the general nature of work to be performed by Owner and others at the Site that relates to the Work as indicated in the Contract Documents. 9. Contractor has given Engineer written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and of discrepancies between Site conditions and the Contract Documents, and the written resolution thereof by Engineer is acceptable to Contractor. 10. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. 11. Contractor’s entry into this Contract constitutes an incontrovertible representation by Contractor that without exception all prices in the Agreement are premised upon performing and furnishing the Work required by the Contract Documents. 8.02 Contractor’s Certifications A. Contractor certifies that it has not engaged in corrupt, fraudulent, collusive, or coercive practices in competing for or in executing the Contract. B. The provisions of MINN. STAT. 16C.285 Responsible Contractor are imposed as a requirement of this Contract. This Contract may be terminated by the Owner at any time upon discovery by the Owner that the prime contractor or subcontractor has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in the Statute. C. The provisions of MINN. STAT. 471.425, subdivision 4a. are imposed as a requirement of this Contract. 1. Each contract of a municipality must require the prime contractor to pay any subcontractor within ten days of the prime contractor’s receipt of payment from the municipality for undisputed services provided by the subcontractor. The contract must require the prime contractor to pay interest of 1.5 percent per month or any part of a month to the subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100 or more is $10. For an unpaid balance of less than $100, the prime contractor shall pay the actual penalty due to the subcontractor. A Subcontractor who prevails in a civil action to collect interest penalties from a prime contractor must be awarded its costs and disbursements, including attorney’s fees, incurred in bringing the action. 8.03 Standard General Conditions A. Owner stipulates that if the General Conditions that are made a part of this Contract are EJCDC® C-700, Standard General Conditions for the Construction Contract (2018), published by the Engineer’s Joint Contract Documents Committee, and if Owner is the party that has furnished said General Conditions, then Owner has plainly shown all modifications to the standard wording of such published document to the Contractor, through a process such as highlighting or “track changes” (redline/strikeout), or in the Supplementary Conditions. Page 63 of 445 2026 STREET REHABILITATION PROJECT AGREEMENT CITY OF LAKEVILLE PROJECT NO. 26-02 WSB PROJECT NO. 031257-000 PAGE 6 IN WITNESS WHEREOF, Owner and Contractor have signed this Agreement. This Agreement will be effective on March 16, 2026 (which is the Effective Date of the Contract). Owner: Contractor: City of Lakeville McNamara Contracting, Inc. By: By: Date: Date: Name: Name: Title: Title: (If Contractor is a corporation, a partnership, or a joint venture, attach evidence of authority to sign.) Attest: Attest: Title: Title: Address for giving notices: Address for giving notices: 20195 Holyoke Avenue 16700 Chippendale Avenue Lakeville, MN 55044 Rosemount, MN 55068 Designated Representative: Designated Representative: Name: Name: Title: Title: Address: Address: Page 64 of 445 CITY OF LAKEVILLE RESOLUTION NO. 26- Resolution Authorizing Funding and 2026 Budget Amendments and Transfers 2026 Street Reconstruction/Rehabilitation Project, City Project 26-02 WHEREAS, 2026 Street Reconstruction/Rehabilitation, City project 26-02, is programmed in the adopted Lakeville 5-year Capital Improvement Plan (2026-2030). NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Lakeville, Minnesota: The estimated project cost is $5,252,286 and anticipated funding sources are listed below. City staff is hereby authorized to amend the 2026 budgets (if needed as the project is completed) and make the appropriate transfers between funds with respect to the project funding sources up to 10% above the estimated costs. Funding transfers may include loans between funds to cover engineering and other costs incurred on the project in advance of receiving other funding. ADOPTED by the Lakeville City Council this 16th day of March 2026. ______________________________ Luke M. Hellier, Mayor _________________________________ Taylor Snider, Deputy City Clerk Funding Sources Total Ci ty of Lake vil le (prope rty taxes)3,166,535$ Speci al Asse ssme nts - Wate r Ope rati ng Fund 1,251,447 Sani tary Se we r Fund 171,816 Stormwate r Inf rastructure Fund 504,382 Total 5,252,286$ Page 65 of 445 Project Financing Funding for the project was programmed in the 2026-2030 CIP. The following is a breakdown of the anticipated costs. • Project Costs: Total Cost Type Amount Construction Contract $ 4,267,884 Engineering/design/survey costs 674,818 Bonding costs 91,549 Contingency (5% of contract) 213,400 Other costs 4,635 $ 5,252,286 • Project Costs: Financing Funding Sources Total City of Lakeville (property taxes) $ 3,166,535 Special Assessments - Water Operating Fund 1,251,447 Sanitary Sewer Fund 171,816 Stormwater Infrastructure Fund 504,382 Total $ 5,252,286 Funding Sources CIP Total Actual Total Variance City of Lakeville (property taxes) $ 3,580,000 $ 3,166,535 (413,465) -11.5% Water Operating Fund 470,000 1,251,447 781,447 166.3% Sanitary Sewer Fund 250,000 171,816 (78,184) -31.3% Stormwater Infrastructure Fund 105,000 504,382 399,382 380.4% Total $ 4,905,000 $ 5,094,179 189,179 3.9% • Project Costs: 2026 Feasibility vs. Estimated Costs Feasibility Actual Difference City of Lakeville (property taxes) $ 3,831,691 $ 3,166,535 -17.4% Water Operating Fund 1,110,733 1,251,447 12.7% Sanitary Sewer Fund 190,214 171,816 -9.7% Storm Sewer Infrastructure Fund 642,750 504,382 -21.5% Environmental Resources Fund 132,219 158,107 19.6% Total $ 5,907,607 $ 5,252,286 -11.1% The estimated costs shown in the tables above include contingency (5%) and indirect costs. Page 66 of 445 This project has estimated costs higher than CIP amounts for the Water Operating Fund & Environmental Resources Fund due to unforeseen circumstances with the existing utility infrastructure replacement needs. Aside from those areas, project costs are in line with adopted 2026 CIP/Budget amounts for the project. Page 67 of 445 Bid Bond 5%Non-CollusionResponsible ContractorBase Bid Bid Alt 1 Total BidXXX$4,059,333.45$208,550.75$4,267,884.20X X X $4,733,115.12 $206,382.27 $4,939,497.39X X X $4,764,869.71 $212,086.36 $4,976,956.07X X X $4,828,560.44 $207,880.51 $5,036,440.95X X X $4,965,737.85 $212,902.75 $5,178,640.60X X X $5,668,446.10 $327,373.00 $5,995,819.10GMH Asphalt Corporation XBituminous Roadways, Inc. XA-1 Excavating LLC XMcNamara Contracting XValley Paving Inc. XNorthwest Asphalt, Inc. XContractorAcknowledge Addendums2026 Street Rehabilitation ProjectCity Project # 26-02Bid Opening SummaryFebruary 25th, 2026 10:30 amPage 68 of 445 Delta Removal Channel Excavation/ Delta Removal178thStW 178thStW Iceland Trl 176th St W Ira Ln J a r l C t Inland Loop175th St W 175th St W 175th St W 175th St W 175th St W Impala PathIxonia Path Jaguar CtJasmineAveJacobite CtIngrid CtI n l a n d CtItaly CtJag u a r C i r J a g u a r P a t h Jaguar PathJa g u a r P a t hJaguarPath IxoniaCtJa s m i n e C t 177th Cir W Ixonia AveI ta ly AveUpper 178th St WUpper178th St W Ionia PathIten Ct NJadeTer Ionia CtIxoniaAveIsleton Ct Jas p e r C t Jalisc o C t Jalisco Way 1 76thCirW ImpalaPathIrons CtJaliscoLnJavelin CtJunelleCtJunelle P a t h Jonquil AveJava Ct NJersey WayIten Ct SJ a c q u a r d P a t h Ipava AveIpava AveIpava AveJava Ct SJamaicaCirJamaicaPathIkariaTrl176th St W ItalyPathItalyPathItalyPathIronstone WayIsleAve176th CtIrvineLnIsletonAveJay Ct Ireglen PathDakota Heights Conservation Area Dakota HeightsPark Raven Lake Conservation Area Document Path: J:\gis\city\LKVL\Maps\LKVLProposal\26-02 2026 Street Rehabilitation Project Date Saved: 11/25/2025¯1 inch = 400 feet 0 400 Feet26-02 2026 Street Rehabilitation Project and Miscellaneous Pond Work City of Lakeville, Minnesota Project Location Map Proposed Mill & Overlay Proposed Pond Work Parcel Boundaries Page 69 of 445 C:\ACC\ACCDocs\WSB\031257-000\Project Files\02_Correspondence\Meetings\Award Contract Council Meeting 03162026\031527-000 2026 SIP LOR- 03112026.docx 540 GATEWAY BLVD | BURNSVILLE, MN | 55337 | 952.737.4660 | WSBENG.COM March 11, 2026 Honorable Mayor and City Council City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Re: 2026 Street Rehabilitation Project City of Lakeville Project No. 26-02 WSB Project No. 031257-000 Dear Mayor and Council Members: Electronic bids were received for the above-referenced project on Wednesday, February 25, 2026, and were opened and read aloud. Six bids were received. The bids were checked for mathematical accuracy and tabulated by City of Lakeville staff. Please find enclosed the bid tabulation indicating McNamara Contracting, Inc., of Rosemount, Minnesota, as the low bidder with a base bid total amount of $4,059,333.45, and a grand total bid amount, that includes bid alternate 1 of $4,267,884.20. The Engineer’s Estimate for the total project was $4,674,435.84. We recommend that the City Council consider these bids and award a contract in the grand total bid in the amount of $4,267,884.20 to McNamara Contracting, Inc., based on the results of the bids received. If you have any questions, please contact me at 612.523.7374. Sincerely, WSB Jeff Oliver, PE Sr. Project Manager Attachment Page 70 of 445 Date: 3/16/2026 Contract for Cracksealing, Pavement Marking Project and Trail Fog Seal Proposed Action Staff recommends adoption of the following motion: Move to award a contract to Allied Blacktop Company for the 2026 Crackseal, Fog Sealing and Pavement Markings Project, Project No. 26-14. Overview Annually, the City programs pavement maintenance into the CIP which includes cracksealing of both streets and trails, fog sealing of trails, and re-striping pavement markings. These tasks are just a part of the overall pavement management program. Lakeville has historically been a part of the South Metro JPA and this work previously mentioned is generally included as part of that annual JPA contract. Last year the South Metro JPA had dissolved and Lakeville staff was tasked with bidding out this work independently as a City. The sealing of cracks within trail and road surfaces help to reduce the amount of water from traveling through the cracks and saturating the pavement base which then is susceptible to freeze/thaw conditions and ultimately premature deterioration of the pavement. The cracksealing operations go hand in hand with the annual surface sealing project to extend the life of streets. Pavement striping is required to be refreshed annually to keep up with the mandated retro- reflectivity stipulations. On Thursday, March 5, 2026, at 11:00 a.m. the City received four bids from contractors ranging from $346,700 to $562,620. The low bid was deemed void due to the contractor not meeting project specifications as laid out for bidding. Therefore, the next lowest bidder, Allied Blacktop Company, with a bid of $363,420 became the valid low bidder. This bid is still under the Engineers Estimate of $530,000. Staff reviewed all the submitted bids and recommends award of the construction contract to Allied Blacktop Company. Supporting Information 1. Contract 2. Bid Tabulation Financial Impact: $363,420 Budgeted: Yes Source: Multiple Sources Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Steve Ferraro, Public Works Coordinator Page 71 of 445 Page 72 of 445 Page 73 of 445 Page 74 of 445 Page 75 of 445 Page 76 of 445 Page 77 of 445 Page 78 of 445 Page 79 of 445 Avgerage AverageItem Description Estimated Unit Total Unit Total Unit Total Unit Total Unit Total Unit Total# Quantity Units Price Price Price Price Price Price Price Price Price Price Price Price1 BITUMINOUS MATERIAL FOR FOG SEAL (CSS-1h) - TRAILS 8,000 GAL $5.00 $40,000.00 $4.65 $37,200.00 $3.84 $30,720.00 $4.10 $32,800.00 $9.89 $79,120.00 $5.62 $44,960.002 CRACK SEALING - MN/DOT 3723 - ROUT & SEAL (STREETS) 200,000 LF $1.25 $250,000.00 $0.59 $118,000.00 $0.75 $150,000.00 $0.75 $150,000.00 $1.35 $270,000.00 $0.86 $172,000.003 CRACK SEALING - MN/DOT 3723 - CLEAN & SEAL (TRAILS) 50,000 LF $1.00 $50,000.00 $0.50 $25,000.00 $0.49 $24,500.00 $0.75 $37,500.00 $1.15 $57,500.00 $0.72 $36,125.004 LONG LINE STREET MARKINGS 3,000 GAL $40.00 $120,000.00 $33.90 $101,700.00 $31.00 $93,000.00 $31.92 $95,760.00 $30.40 $91,200.00 $31.81 $95,415.005 SYMBOL MARKINGS 400 GAL $175.00 $70,000.00 $162.00 $64,800.00 $163.00 $65,200.00 $170.10 $68,040.00 $162.00 $64,800.00 $164.28 $65,710.00TOTALS$530,000.00*$346,700.00 $363,420.00 $384,100.00 $562,620.00 $414,210.00*Apparent low did not meet project specifications as defined.Apparent Low Bid Apparent 2nd Low Apparent 3rd Low2026 Lakeville Annual Crack seal, Sealcoat & Markings ProjectBid Tabulation and ComparisonPearson Brothers Allied Blacktop CompanyEngineer's Estimate Asphalt Surface Technologies Corp. Fahrner Asphalt Sealers, LLCPrepared by Lehman, Nicholas 3/5/26 Page 1Page 80 of 445 Date: 3/16/2026 Contract for 2026 Inflow and Infiltration Improvement Project Proposed Action Staff recommends adoption of the following motion: Move to award contract to Hydro-Klean, LLC. for the 2026 Inflow and Infiltration Improvement project, City Project 26-13. Overview The City of Lakeville conveys wastewater to the Empire Wastewater Treatment Plant, which is operated by Metropolitan Council Environmental Services (MCES). MCES monitors the volume of wastewater discharged from Lakeville and bills the City based on that flow. To reduce unnecessary treatment of groundwater, the City maintains an annual program to identify and eliminate groundwater infiltration through aging, cracked, or separated sanitary sewer pipes. Lining these pipes also seals joints and prevents tree roots from penetrating the system and potentially causing sewer backups. In addition, MCES may impose surcharges if excessive clear water enters the City’s sanitary sewer system. To reduce inflow and infiltration (I/I) in the sanitary sewer system, approximately 13,320 linear feet of sewer pipe is programmed to be rehabilitated using the cured-In-place pipe (CIPP) lining method. This work includes lining deteriorating 8-inch and 9-inch vitrified clay pipe (VCP) as well as 12-inch reinforced concrete pipe (RCP). The result is a continuous interior liner with structural characteristics comparable to a new pipe. On February 24, 2026, at 10:30 a.m., the City received three bids for the project. Bids ranged from a low bid of $524,891.99 submitted by Hydro-Klean, LLC to a high bid of $631,765.00. The engineer’s estimate for the project was $574,885.00. The total project cost is within the budget allocated for Sanitary Sewer Inflow and Infiltration Maintenance in the current Capital Improvement Program (CIP). Hydro-Klean, LLC has previously completed sewer lining projects in Lakeville, and their work has been satisfactory. Staff has reviewed the bids and supporting documentation and recommends awarding the contract to Hydro-Klean, LLC. Supporting Information 1. Bid Summary 2. Contract Financial Impact: $524,891.99 Budgeted: Yes Source: Sewer Fund Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Kyle Hanson, Utilities Supervisor Page 81 of 445 Page 82 of 445 Bid Bond 5%Non-CollusionResponsible ContractorBase Bid Total Bidxxx$524,891.99$524,891.99xxx$533,934.00$533,934.00xxx$557,666.60$557,666.60xxx$567,558.00$567,558.00xxx$631,765.00$631,765.00SAK Construction, LLCN/AVisu-Sewer, Inc.N/AHydro-Klean LLC N/AVortex Services MN, LLCN/AInsituform Tech USA, LLCN/AContractorAcknowledge Addendums2026 City of Lakeville Street Rehabilitation ProjectCity Project # 26-13Bid Opening SummaryFebruary 24th, 2026 10:30 amPage 83 of 445 Page 84 of 445 Page 85 of 445 Page 86 of 445 Page 87 of 445 Page 88 of 445 Page 89 of 445 Page 90 of 445 Date: 3/16/2026 Approval of Professional Services Agreement with Hosington Koegler Group, Inc (HKGI) Proposed Action Staff recommends adoption of the following motion: Move to approve a Professional Services Agreement with HKGI to prepare the 2050 Comprehensive Plan Overview On January 16, 2026 city staff prepared a request for proposal for the 2050 Comprehensive Plan Update and received nine proposals. The RFP encompasses the public engagement efforts, land use, housing plan, climate and coordination with transportation and utility plans (to be prepared by other consultants). After reviewing and scoring of the proposals, HKGI was selected to best meet the needs of the city. HKGI has extensive experience working on similar projects in comparable sized communities to Lakeville. HKGI also has a long history of working on planning related projects in Lakeville and is currently updating the city’s Park System Master Plan. Cost of the study is $200,000. Supporting Information 1. PROFESSIONAL_SERVICES_AGREEMENT_HKGi_2050_COMP_PLAN 2. Attachment A 2050 Comp Plan Scope Lakeville Financial Impact: $200,000 Budgeted: Yes Source: General Fund Envision Lakeville Community Values: Diversified Economic Development Report Completed by: Tina Goodroad, Community Development Director Page 91 of 445 1 238661v3 PROFESSIONAL SERVICES AGREEMENT AGREEMENT made this _______ day of ___________________, 2026, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation ("City") and HOISINGTON KOEGLER GROUP, INC., a Minnesota corporation ("Consultant"). IN CONSIDERATION OF THEIR MUTUAL COVENANTS, THE PARTIES AGREE AS FOLLOWS: 1. CONTRACT DOCUMENTS. The Contract consists of the following documents. In the event of conflict among the documents, the conflict shall be resolved by the order in which they are listed, with the document listed first having the first priority and the document listed last having the last priority: A. This Professional Services Agreement; B. City’s Request for Proposals for 2050 Comprehensive Plan Update C. Consultant’s Proposal dated February 13, 2026, as modified by Exhibit A, dated March 3, 2026 (“Proposal”). In the event of conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts. Contract Document “A” has the first priority and Contract Document “C” has the last priority. 2. SCOPE OF SERVICES. The City retains Consultant to assist with the preparation, engagement, and adoption of a city-wide update to the City’s Comprehensive Plan with a planning horizon to the year 2050 in compliance with Minnesota Statutes § 473.858 and the City of Lakeville’s System Statement as provided in the Contract Documents. Consultant agrees to complete the services under this Agreement substantially within the time frames identified in the Contract Documents. 3. COMPENSATION. Consultant shall be paid in accordance with the fee schedule included with the Proposal, but in no event shall the total amount paid to Consultant for services exceed Two Hundred Thousand and No/100 Dollars ($200,000.00), which amount is inclusive of reimbursables, expenses, taxes and other charges. The fee shall not be adjusted if the estimated hours to perform a task, the number of estimated required meetings or any other estimate or assumption are exceeded. Consultant shall provide the City with detailed invoices on a monthly basis. The City will pay an invoice within 35 days of receipt. 4. CHANGE ORDERS. All change orders, regardless of amount, must be approved in advance and in writing by the City. No payment will be due or made for work done in advance of such approval. 5. DOCUMENTS. All reports, plans, models, software, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. The City shall be the copyright owner. The vesting of the City’s ownership of the copyright in materials created by the Consultant shall be contingent upon the City’s fulfillment of its payment obligations hereunder. The Consultant shall be allowed to use a description of the services provided hereunder, including the name of the City, and photographs or Page 92 of 445 2 238661v3 renderings of any projects which develop from the planning or other services provided by the Consultant, in the normal course of its marketing activities. 6. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Consultant shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 7. STANDARD OF CARE. Consultant shall exercise the same degrees of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a professional consultant under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Consultant’s services. 8. INDEMNIFICATION. Consultant shall indemnify and hold harmless the City, its officers, agents, and employees, of and from any and all claims, demands, actions, causes of action, including costs and attorney's fees, arising out of or by reason of the negligent acts, errors, or omissions relating to work or services provided for herein and further agrees to defend at its sole cost and expense any action or proceeding commenced for the purpose of asserting any claim of whatsoever character arising hereunder. 9. INSURANCE. Prior to the start of the project, Consultant shall furnish to the City a certificate of insurance showing proof of the required insurance required under this Paragraph. Consultant shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, such insurance as shall protect Consultant and the City for work covered by the Contract including workers’ compensation claims and property damage, bodily and personal injury which may arise from operations under this Contract, whether such operations are by Consultant or anyone directly or indirectly employed by either of them. The minimum amounts of insurance shall be as follows: Commercial General Liability (or in combination with an umbrella policy) $2,000,000 Each Occurrence $2,000,000 Products/Completed Operations Aggregate $2,000,000 Annual Aggregate The following coverages shall be included: Premises and Operations Bodily Injury and Property Damage Personal and Advertising Injury Blanket Contractual Liability Products and Completed Operations Liability Automobile Liability $2,000,000 Combined Single Limit – Bodily Injury & Property Damage Including Owned, Hired & Non-Owned Automobiles Workers Compensation Except as provided below, Consultant must provide Workers’ Compensation insurance for all its employees and, in case any work is subcontracted, Consultant will require the subcontractor to provide Workers’ Compensation insurance in accordance with the statutory requirements of the State of Minnesota, including Coverage B, Employer’s Liability. Insurance minimum limits are as follows: Page 93 of 445 3 238661v3 $500,000 – Bodily Injury by Disease per employee $500,000 – Bodily Injury by Disease aggregate $500,000 – Bodily Injury by Accident If Minnesota Statute 176.041 exempts Consultant from Workers’ Compensation insurance or if the Consultant has no employees in the City, Consultant must provide a written statement, signed by an authorized representative, indicating the qualifying exemption that excludes Consultant from the Minnesota Workers’ Compensation requirements. If during the course of the contract the Consultant becomes eligible for Workers’ Compensation, the Consultant must comply with the Workers’ Compensation insurance requirements herein and provide the City with a certificate of insurance. Professional/Technical (Errors and Omissions) Liability Insurance This policy will provide coverage for all claims the Consultant may become legally obligated to pay resulting from any actual or alleged negligent act, error, or omission related to Consultant’s professional services required under the contract. Consultant is required to carry the following minimum limits: $1,000,000 – per claim or event $2,000,000 – annual aggregate Any deductible will be the sole responsibility of the Consultant and may not exceed $50,000 without the written approval of the City. If the Consultant desires authority from the City to have a deductible in a higher amount, the Consultant shall so request in writing, specifying the amount of the desired deductible and providing financial documentation by submitting the most current audited financial statements so that the City can ascertain the ability of the Consultant to cover the deductible from its own resources. The retroactive or prior acts date of such coverage shall not be after the effective date of this Contract and Consultant shall maintain such insurance for a period of at least three (3) years, following completion of the work. If such insurance is discontinued, extended reporting period coverage must be obtained by Consultant to fulfill this requirement. The Consultant’s insurance must be “Primary and Non-Contributory”. All insurance policies (or riders) required by this Contract shall be (i) taken out by and maintained with responsible insurance companies organized under the laws of one of the states of the United States and qualified to do business in the State of Minnesota, (ii) shall name the City, its employees and agents as additional insureds (CGL and umbrella only) by endorsement which shall be filed with the City. A copy of the endorsement must be submitted with the certificate of insurance. Consultant’s policies and Certificate of Insurance shall contain a provision that coverage afforded under the policies shall not be cancelled without at least thirty (30) days’ advanced written notice to the City, or ten (10) days’ notice for non-payment of premium. An Umbrella or Excess Liability insurance policy may be used to supplement Consultant’s policy limits on a follow-form basis to satisfy the full policy limits required by this Contract. 10. INDEPENDENT CONTRACTOR. The City hereby retains Consultant as an independent contractor upon the terms and conditions set forth in this Agreement. Consultant is not an employee of the City and is free to contract with other entities as provided herein. Consultant shall be responsible for selecting the means and methods of performing the work. Consultant shall furnish any and all supplies, Page 94 of 445 4 238661v3 equipment, and incidentals necessary for Consultant's performance under this Agreement. City and Consultant agree that Consultant shall not at any time or in any manner represent that Consultant or any of Consultant's agents or employees are in any manner agents or employees of the City. Consultant shall be exclusively responsible under this Agreement for Consultant's own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 11. SUBCONTRACTORS. With the exception of the individuals identified in the Proposal, Consultant shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Consultant shall comply with Minnesota Statutes §471.425. Consultant must pay subcontractors for all undisputed services provided by subcontractors within ten (10) days of Consultant’s receipt of payment from City. Consultant must pay interest of one and five-tenths (1.5%) percent per month or any part of a month to subcontractors on any undisputed amount not paid on time to subcontractors. The minimum monthly interest penalty payment for an unpaid balance of One Hundred Dollars ($100.00) or more is Ten Dollars ($10.00). 12. ASSIGNMENT. Neither party shall assign this Agreement, nor any interest arising herein, without the written consent of the other party. 13. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 14. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 15. CONTROLLING LAW/VENUE. This Agreement shall be governed by and construed in accordance with the laws of the State of Minnesota. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Dakota County. 16. COPYRIGHT. Consultant shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. 17. PATENTED DEVICES, MATERIALS AND PROCESES. If the contract requires, or Consultant desires, the use of any design, devise, material or process covered by letters, patent or copyright, trademark or trade name, Consultant shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the City. If no such agreement is made or filed as noted, Consultant shall indemnify and hold harmless the City from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the services agreed to be performed under the contract, and shall indemnify and defend the City for any costs, liability, expenses and attorney's fees that result from any such infringement. 18. RECORDS. Consultant shall maintain complete and accurate records of time and expense involved in the performance of services. Page 95 of 445 5 238661v3 19. AUDIT DISCLOSURE AND DATA PRACTICES. Any reports, information, data, etc. given to, or prepared or assembled by the Consultant under this Agreement which the City requests to be kept confidential, shall not be made available to any individual or organization without the City’s prior written approval. The books, records, documents and accounting procedures and practices of the Consultant or other parties relevant to this Agreement are subject to examination by the City and either the Legislative Auditor or the State Auditor for a period of six (6) years after the effective date of this Agreement. Pursuant to Minnesota Statutes § 13.05, Subd. 11, all of the data created, collected, received, stored, used, maintained, or disseminated by the Contractor in performing this Contract is subject to the requirements of the Minnesota Government Data Practices Act, Minnesota Statutes Chapter 13, and the Contractor must comply with those requirements as if it were a government entity. The remedies in Minnesota Statutes § 13.08 apply to the Contractor. The Contractor does not have a duty to provide access to public data to the public if the public data are available from the City, except as required by the terms of the Contract. All subcontracts entered into by Consultant in relation to this Agreement shall contain similar Data Practices Act compliance language. All subcontracts entered into by Consultant in relation to this Agreement shall contain similar Data Practices Act compliance language. 20. NON-DISCRIMINATION. The Consultant agrees during the life of this Agreement not to discriminate against any employee, application for employment, or other individual because of race, color, sex, age, creed, national origin, sexual preference, or any other basis prohibited by federal, state, or local law. The Consultant will include a similar provision in all subcontracts entered into for performance of this Agreement. 21. TERMINATION OF THE AGREEMENT. The City may terminate this Agreement or any part thereof at any time, upon written notice to Consultant, effective upon delivery including delivery by facsimile or email. In such event, Consultant will be entitled to compensation for work performed up to the date of termination or, in the case of a lump sum contract, based upon a pro rata basis. 22. NOTICES. All notices, demands or requests required or permitted to be made pursuant to or under this Agreement must be in writing and deemed valid if sent by registered mail, return receipt requested, or delivered by overnight delivery service providing written evidence of delivery, or by hand delivery by a reputable independent courier providing written evidence of delivery, addressed as follows: CITY: City of Lakeville 20195 Holyoke Avenue Lakeville MN 55044 Attention: City Administrator CONSULTANT: HKGi 800 Washington Ave. N. #207 Minneapolis, MN 55401 Attention: Brad Scheib Either party may change the designated recipient of notice by so notifying the other party in writing. [Remainder of page intentionally left blank] [Signature pages to follow] Page 96 of 445 6 238661v3 IN WITNESS WHEREOF, the parties have executed this Agreement on the date first above written. By the signature of its representative below, each party affirms that it has taken all necessary action to authorize said representative to execute the Agreement. CITY OF LAKEVILLE BY: _______________________________________ Luke M. Hellier, Mayor AND Ann Orlofsky, City Clerk HOISINGTON KOEGLER GROUP INC BY: _______________________________ Brad Scheib, Vice President Page 97 of 445 Attachment A Lakeville Comprehensive Plan Update Scope of Work Phase One: Create the 2050 Comprehensive Plan TASK 1 – TAKE THE PULSE AND ESTABLISH THE VISION Task 1 is focused on establishing the foundation for the 2050 Comprehensive Plan. Task 1 will focus on developing an understanding of the community’s existing context, gathering input on community needs, and establishing a shared community vision for Lakeville through 2050. In addition to updating base mapping and demographics, the planning process will include an audit of the 2040 Comprehensive Plan and a review of how the direction established by the Metropolitan Council in Imagine 2050 will need to be incorporated into the 2050 Comprehensive Plan. 1.1 Conduct a kick-off workshop with Planning Staff to confirm the scope and schedule, gather background information, and collaboratively prepare the community engagement plan. 1.2 Prepare base mapping and update demographic, housing, and economic information to create a succinct summary for the community and to update the Community Context (Existing Conditions and Trends). 1.3 Review any studies, reports, or Comprehensive Plan amendments prepared since completion of the 2040 Comprehensive Plan, particularly the Envision Lakeville 2023 plan. 1.4 Evaluate the city’s system statement and checklist from the Metropolitan Council to determine what needs to be updated and what topics potentially require additional discussion with Staff, policymakers, and the community. 1.5 Facilitate a meeting with Key Staff (e.g. parks, engineering, public works), and engineering consultants as needed, to officially kick off the project: a. Discuss what worked and what didn’t work with the 2040 Comprehensive Plan and introduce upcoming meetings to audit the 2040 Comprehensive Plan. b. Discuss issues and opportunities. c. Confirm background information received to date. d. Review and refine draft community engagement materials. e. Discuss approach for updates to Transportation and Water Resources chapters. 1.6 Conduct virtual meetings with Key Staff to audit individual chapters of the 2040 Comprehensive Plan to understand what potential updates are needed to address the Metropolitan Council direction. 1.7 Conduct Kick Off Event with advisory boards, commissions and Council (Planning Commission, Park, Recreation and Natural Resources Commission, Arts Center Advisory Board, Economic Development Commission, Youth Advisory Commission and City Council) to provide background on comprehensive planning, provide highlights about Lakeville today, preview the upcoming community engagement outreach, and solicit initial input. 1.8 Conduct Engagement Round 1 (Inform and Listen). Round 1 of the community engagement will have two primary purposes. First, we will use it to communicate the project to the community “Inform.” Secondly, we will use this phase to identify key elements of the community vision Page 98 of 445 Attachment A | Lakeville 2050 Comprehensive Plan Update Scope of Work March 3, 2026 Page 2 and community needs that should be considered “Listen”. It is anticipated that this round of engagement will include the preparation of materials for posting on the project website and inclusion in City communications; preparation of an online engagement tool; attendance at community pop-up events; and the preparation of an engagement summary. This round of engagement will also include the development of a survey that can be distributed to the business community and other targeted stakeholder groups. To ensure a broad audience is engaged, this round of engagement will extend for up to four months to enable the consulting team and Planning Staff to participate in a range of events. While the consultant team will participate in up to three events, the consultant team will ensure Planning Staff will have the materials needed to attend additional events. 1.9 Meet with Planning Staff to review a draft community engagement summary and community context chapter, as well as to confirm additional community outreach events. 1.10 Prepare a quarterly update to the City Council and boards and commission describing the current project status and next steps. Deliverables: o Detailed project schedule and milestones o Project branding and preliminary document template structure (print and online) o Updated Community Background (Existing Conditions and Trends) o Comprehensive plan audit findings presentation (including minimum requirements review) o Summary of foundational principles and plans to carry forward into updated plan o Community engagement strategy and plan o Phase 1 engagement materials, summary reporting, and presentation of findings o Meeting agendas and communication/presentation materials TASK 2 – SHAPE THE PLAN Building on the findings from Task 1, HKGi will collaborate with Key Staff to identify key directions for each chapter of the Comprehensive Plan. This will include recommended refinements to existing goals and policies, as well as the development of new goals and policies for the Metropolitan Council’s new requirements regarding climate and natural systems. Task 2 will also focus on exploring key land use changes and potential impacts of those changes on infrastructure. Community Engagement Round 2 will focus on a community wide event and seeking input with targeted stakeholders on areas of change and areas of topical expertise (sustainability, arts and culture, etc). 2.1 Collaborate with Key Staff, and city consultants as needed, on the key plan directions (vision), as well as preliminary land use changes and infrastructure system improvements needed. This exploration is anticipated to extend up to three staff meetings and will include the development of diagrams and illustrations. Preliminary data will also be quantified as needed to enable high-level evaluation of land use concepts for special areas, redevelopment areas, and potential annexation areas. 2.2 Meet with the Planning Commission to review community input from Task 1 and discuss the key directions being explored (Vision). Page 99 of 445 Attachment A | Lakeville 2050 Comprehensive Plan Update Scope of Work March 3, 2026 Page 3 2.3 Refine key directions based on input from the Planning Commission and prepare for Joint Meeting. 2.4 Conduct a Joint Meeting where advisory boards, commissions and City Council are invited to distill and discuss the findings from the 1st round of community engagement, confirm the community vision, and discuss key plan directions. 2.5 Revise community vision and key plan directions to prepare for Community Engagement Round 2. 2.6 Conduct Community Engagement Round 2. The 2nd round of community engagement will seek input from targeted stakeholders regarding key directions. This may include a community wide event and focused meetings with neighborhood groups or community organizations. While the consultant team will participate in up to 3 events, the consultant team will ensure Planning Staff will have the materials needed to attend additional events. 2.7 Prepare a quarterly update to the City Council and boards and commission describing the current project status and next steps. Deliverables: o Meeting agendas and communication/presentation materials for all meetings o Draft memo documenting community vision (values and goals) o Vignettes and Diagrams illustrating updates/changes to key special areas, redevelopment nodes, or potential growth/annexation areas o For focus area project boards will be created with land use and development form changes. They will be presented in both two-dimensional plan view and three- dimensional illustrations of key areas. o Quantification of housing units and commercial square footage assumptions, land use acreages, and density analysis for subsequent infrastructure and TAZ analysis and incorporation into the comprehensive plan (GIS files and Excel Spreadsheet) o Concept narrative and implementation strategies. o Housing needs assessment and implementation plan o Demonstration of forecast consistency (2030, 2040 and 2050) o Evaluation matrix/tool to facilitate stakeholder input to concepts and ideas. o Engagement materials and summary for Phase 2 engagement o Quarterly update materials TASK 3 – PREPARE THE PLAN Task 3 will use community input and the key directions from Task 2 to prepare a full draft of the 2050 Comprehensive Plan in collaboration with Staff. A review draft will be presented to the Planning Commission and City Council. Then, HKGi will facilitate Community Engagement Round 3. Input from the reviews and community engagement will be used to create a final draft that will be considered for approval by the Planning Commission and preliminary approval by the City Council in Task 4. 3.1 Prepare draft of the 2050 Comprehensive Plan in collaboration with Staff. 3.2 Present the draft 2050 Comprehensive Plan to the Planning Commission. Page 100 of 445 Attachment A | Lakeville 2050 Comprehensive Plan Update Scope of Work March 3, 2026 Page 4 3.3 Present the draft 2050 Comprehensive Plan to the City Council. 3.4 Conduct Community Engagement Round 3. Round 3 of Community Engagement will include the posting of the draft 2050 Comprehensive Plan online for broad community review and comment. The draft will also be sent to the advisory boards and commissions for review and comment. 3.5 Prepare a quarterly update the City Council and boards and commission describing the current project status and next steps. Deliverables: o Meeting agendas and communication/presentation materials for all meetings o Working Draft 1 of the 2050 Comprehensive Plan Update o Engagement materials for Phase 3 engagement o Quarterly update materials TASK 4 – SEEK APPROVALS The final task of this phase will begin with the preparation of the final draft of the 2050 Comprehensive Plan based on the review and community input in Task 3. The final draft will then be presented to the Planning Commission at a public hearing. The City Council will consider approving the draft for distribution to adjacent and affected agencies for review. 4.1 Prepare draft 2 (public hearing draft) of the 2050 Comprehensive Plan. 4.2 Conduct the Planning Commission Public Hearing. 4.3 Make final revisions to the plan (draft 3 – distribution draft) based on Planning Commission recommendation. 4.4 Present 2050 Comprehensive Plan to the City Council for authorization to distribute to adjacent and affected agencies. Deliverables: o Meeting agendas, notices, and communication/presentation materials for all meetings o Draft 2 and Draft 3 of the 2050 Comprehensive Plan Phase Two: Distribute the Plan for Review TASK 5 – DISTRIBUTE THE PLAN FOR 6-MONTH REVIEW Comprehensive Plans are required to be distributed to adjacent and affected jurisdictions for a minimum of six months, or until comments from all agencies are received. Depending on timing, the Metropolitan Council also allows communities to submit the draft Comprehensive Plan for optional preliminary review. Subtasks for this task include: 5.1 Assemble electronic version of Comprehensive Plan for distribution. Page 101 of 445 Attachment A | Lakeville 2050 Comprehensive Plan Update Scope of Work March 3, 2026 Page 5 5.2 Support review by adjacent and affected jurisdictions by preparing an email with a response form and a link to the 2050 Comprehensive Plan for Planning Staff to distribute to the required list of affected and affected jurisdictions. 5.3 Submit the 2050 Comprehensive Plan for Metropolitan Council preliminary plan review. 5.4 Summarize comments received and prepare revisions as needed from adjacent and affected jurisdictions, as well as the Metropolitan Council. 5.5 Present revised 2050 Comprehensive Plan to the City Council for authorization to submit it to the Metropolitan Council. Deliverables: o Compilation of 2050 Comprehensive Plan items for distributions to agencies and jurisdictions including review and response form and email distribution list. o Compilation of comments received and recommended revisions. o Materials for Council review and authorizing resolution to submit to Metropolitan Council for official review. Phase Three: Metropolitan Council Review and Final Adoption Task 6 – FACILITATE METROPOLITAN COUNCIL REVIEW Task 6 will focus on seeking approval from the Metropolitan Council for the 2050 Comprehensive Plan. This will involve making revisions until the Metropolitan Council deems it complete and supporting Planning Staff through the approval process. 6.1 Prepare and submit the 2050 Comprehensive Plan for Metropolitan Council formal review. 6.2 Revise the 2050 Comprehensive Plan as needed to address completeness issues identified by the Metropolitan Council. 6.3 Support Planning Staff through the Metropolitan Council approval process. Deliverables: o Compilation of required submittal materials for official Metropolitan Council submission o Revisions to plan as needed by the Metropolitan Council review requirements. Task 7 – ADOPT THE PLAN The final task will support the final adoption of the 2050 Comprehensive Plan by the City Council following approval by the Metropolitan Council. 7.1 Prepare final 2050 Comprehensive Plan for City Council adoption including an executive summary. 7.2 Support Planning Staff with the City Council’s adoption. 7.3 Submit the 2050 Comprehensive Plan and all required documentation to the Metropolitan Council. 7.4 Provide Planning Staff with the final electronic files. Page 102 of 445 Attachment A | Lakeville 2050 Comprehensive Plan Update Scope of Work March 3, 2026 Page 6 Deliverables: o Final 2050 Comprehensive Plan Full PDF Plan o Summary document formatted for easier online review o Final Engagement Report assembling all engagement materials in input o All Electronic Files associated with the Plan. Page 103 of 445 Date: 3/16/2026 First Amendment to the Amelia Meadows Development Contract Proposed Action Staff recommends adoption of the following motion: Move to approve the First Amendment to the Amelia Meadows Development Contract. Overview The Amelia Meadows final plat and Development Contract was approved by the City Council on June 16, 2025. Throughout the platting process, the Metropolitan Council worked collaboratively with the City and Developer to include the construction of a new sanitary sewer meter station into the development project. This facility is necessary to measure wastewater flow from the subdivision and future upstream growth and will be installed on the City's sanitary sewer system to support long-term wastewater billing and system planning. The attached First Amendment updates the Development Contract so that it incorporates the Metropolitan Council sanitary sewer facilities and accurately reflects the project responsibilities, financial adjustments and reimbursement procedures. Supporting Information 1. 2026.03.16 First Amendment to Amelia Meadows Development Contract Financial Impact: $0 Budgeted: No Source: N/A Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Jonathan Nelson, Assistant City Engineer Page 104 of 445 1 238218v2 (reserved for recording information) FIRST AMENDMENT TO DEVELOPMENT CONTRACT AMELIA MEADOWS THIS FIRST AMENDMENT TO DEVELOPMENT CONTRACT (“Amendment”) is made this 16th day of March 2026, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation (“City”) and U.S. HOME, LLC, a Delaware limited liability company (hereinafter referred to as the "Developer"). RECITALS A. The City and Developer previously entered into a Development Contract dated June 16, 2025, and recorded in the Office of the County Recorder, Dakota County, Minnesota on August 13, 2025, as Document No. 3687580 for the property to be platted as Amelia Meadows, Dakota County, Minnesota (“Development Contract”). B. City and Developer desire to modify the terms of the Development Contract to reflect Developer responsibility to construct a meter station within the development. Page 105 of 445 2 238218v2 NOW, THEREFORE, THE PARTIES AGREE AS FOLLOWS: 1. EFFECT OF DEVELOPMENT CONTRACT. The Development Contract shall remain in full force and effect except as specifically amended herein. 2. AMENDMENT TO PARAGRAPH 7. Paragraph 7 of the Development Contract is amended to add Plan G to read as follows: Plan G: Metropolitan Council Plans and Specifications for Council Project as provided in the Reimbursement Agreement defined under Paragraph 4 of this Amendment. 3. AMENDMENT TO PARAGRAPH 33. Paragraph 33 of the Development Contract is amended to read as follows: 33. SUMMARY OF CASH REQUIREMENTS. The following is a summary of the cash requirements under this Contract which must be furnished to the City prior to the City Council signing the final plat: A. Park Dedication $285,768.00 B. Sanitary Sewer Availability Charge 16,023.00 C. Storm Sewer Charge 137,027.07 D. MS4 Administration Fee 39,989.66 E. Traffic Control Signs 5,525.00 F. Streetlight Operating Fee 1,983.52 G. Environmental Resources Management Fee 3,014.48 H. Property Data and Asset/Infrastructure Management Fee 4,860.00 I. City Engineering Administration (3% for letters of credit) 132,530.16 SUBTOTAL CASH REQUIREMENTS $626,720.89 Page 106 of 445 3 238218v2 CREDITS TO THE CASH REQUIREMENTS Meter Station Reimbursement $157,089.00 Trunk Watermain Oversizing Credit $39,535.00 Trunk Sanitary Sewer Oversizing Credit 329,430.60 City 3/8 Trail Cost – 200th Street and Cedar Avenue $30,331.50 SUBTOTAL – CREDITS TO THE CASH REQUIREMENTS $556,386.10 TOTAL CASH REQUIREMENTS $70,443.79 4. AMENDMENT TO DEVELOPMENT CONTRACT. The Development Contract is amended to add the following: The Metropolitan Council (“Council”) has coordinated with the Developer to place a meter station within the development. The meter station will be maintained by the Metropolitan Council and will be located north of and adjacent to Lot 1, Block 5 within Outlot C. The Metropolitan Council has reviewed and approved the re-alignment of the sewer. The City and Metropolitan Council have entered into an Agreement for Reimbursement for the construction and reimbursement of costs for meter station with the development of the plat (“Reimbursement Agreement”). The Developer shall be responsible for compliance with all obligations and stipulations required by the Met Council of U.S. Home as referenced in the Reimbursement Agreement and shall take no action or fail to take any action that would place the City in default of the Reimbursement Agreement. The Developer shall receive a reimbursement from the Metropolitan Council, through the City, for the Metropolitan Council cost as identified in Exhibit B of the Reimbursement Agreement upon reimbursement from the Metropolitan Council. The Metropolitan Council’s fiscal contribution for the project will be limited to the installation of the meter instrumentation and RTU Cabinet. The Developer shall hire a pre-qualified contractor to relocate and construct the meter station housing shell and installation of instrumentation. Page 107 of 445 4 238218v2 The City and Developer agree to split the costs identified to be paid by Others in Exhibit B of the Reimbursement Agreement. The City shall reimburse Developer $157,089 of cash requirements due in the Reimbursement Agreement to satisfy the cash requirements for City. In the event that the costs for the meter construction and installation exceed the estimated costs identified in the Reimbursement Agreement, the City and Developer will negotiate in good faith to determine an equitable adjustment in the reimbursement to the Developer. No grading shall commence adjacent to the existing meter station on the parent parcel until the new meter is operational, as authorized by the Metropolitan Council. Developer and its contractors must: i. Perform the Council Project in strict accordance with the Council Project Construction Documents; and ii. Not interrupt Council’s existing sewer service at any time without the prior written consent of the Council’s authorized representative; and iii. During construction of the Council Project, there will be no interruptions to the sanitary sewer transport system that will affect the Council’s billing process and procedures without the written consent of the Council; and iv. At all times maintain unrestricted access for the Council and its representatives to the Council’s existing gravity sewer and any other Council facilities. Developer shall incorporate the foregoing terms in all construction contracts for construction of the Council Project. Developer and its contractors shall defend, indemnify and hold harmless the Council and the City, their officers, agents and employees from claims, suits, demands, judgments, costs, interest, expenses (including reasonable attorney fees and disbursements) arising out of or by reason of the acts or omissions of Developer, its officers, employees, agents or subcontractors related to the Council Project. Page 108 of 445 5 238218v2 Developer and its contractors must provide and maintain insurance in the amounts and terms specified in Paragraph 38(i) of the Development Contract and name the Council and the City as additional insureds by endorsement for the Council Project and shall provide Certificates of Insurance to the City and Council evidencing the required insurance. Developer and its contractors are independent contractors for the purpose of completing the work on the Council Project. If hazardous wastes, pollutants or contaminants as those terms are defined in law exist on the Council Project site or within the development property, Developer will be solely responsible for any response or remedial action, monitoring or reporting under the law. The Developer shall promptly notify the City and the Council of any discovery or suspected presence of such substances, apply for and obtain all required environmental regulatory approvals, no-association letters, no- further actions letters, or other assurance letters, and have the Council and City expressly named as a beneficiary or protected party in each such document. Developer shall perform or cause to be performed all necessary Phase I and Phase II environmental investigations and promptly deliver copies to the Council and the City. This paragraph survives the termination of Development Contract as amended by this Amendment. IN WITNESS WHEREOF, the parties have caused this Amendment to be executed on or as of the date first above written. [Remainder of page is intentionally left blank. Signature pages follow. Page 109 of 445 6 238218v2 CITY OF LAKEVILLE BY: ___________________________________________ Luke M. Hellier, Mayor (SEAL) AND __________________________________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) )ss. COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this ________ day of ______________, 2026, by Luke M. Hellier and by Ann Orlofsky, the Mayor and City Clerk of the City of Lakeville, a Minnesota municipal corporation, on behalf of the corporation and pursuant to the authority granted by its City Council. ______________________________________________ NOTARY PUBLIC Page 110 of 445 Page 111 of 445 Date: 3/16/2026 Cooperative Reimbursement Agreement with the Metropolitan Council for Sanitary Sewer Meter M657 Construction Proposed Action Staff recommends adoption of the following motion: Move to approve Agreement for Reimbursement of Meter Vault Installation with the Metropolitan Council for the construction of sanitary sewer meter M657. Overview The Amelia Meadows development requires installation of a sanitary sewer meter vault to measure wastewater flow from the subdivision and future upstream growth. The Metropolitan Council Environmental Services (MCES) is responsible for metering wastewater entering its regional system, and the new meter (M657) will be installed on the City's sanitary sewer system to support long-term wastewater billing and system planning. The meter vault will be constructed as part of the developer's public improvement work. MCES prepared a reimbursement agreement that allows the City to include the meter vault work in the Amelia Meadows project and receive reimbursement for eligible construction costs. The estimated project cost is $1,208,530 and includes a local cost participation cost of $314,178 that will be shared equally between the City and the Amelia Meadows developer. As the lead agency, the full amount of the project cost is shown in this memo; the City's estimated net cost is $157,089. Supporting Information 1. Cooperative Reimbursement Agreement for Meter M657 (Met Council No. 24I025) 2. Exhibits A-E (Met Council No. 24I025) Financial Impact: $1,208,530 Budgeted: Yes Source: Sanitary Sewer Trunk Fund Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Jonathan Nelson, Assistant City Engineer Page 112 of 445 AGREEMENT FOR REIMBURSEMENT OF METER VAULT INSTALLATION This Agreement is between the Metropolitan Council, a public corporation and political subdivision of the State of Minnesota (“Council”) and the City of Lakeville, a municipal corporation under the laws of the State of Minnesota (“City”), each a “Party” and collectively the “Parties”. BACKGROUND RECITALS 1. The City has approved plans for the Amelia Meadows Development in Lakeville at the intersection of Cedar Ave (CSAH 23) and 200th Street W. (CSAH 64) referred to as the (“City Project”). The City Project is being constructed by U.S. Home, LLC (“U.S. Home”). 2. To facilitate future development within Lakeville’s Farmington Outlet Meter District as outlined in the City’s 2040 Comprehensive Plan, the City desires to extend sewer from the Council’s Interceptor 8007 (into Lakeville). The Council plans to install a wastewater meter on the City’s sanitary sewer line that will be used for measuring wastewater volume from Lakeville’s Farmington Outlet Meter District and allocating municipal wastewater charges. The meter installation on the City’s sanitary sewer pipe is hereinafter referred to as the “Council Project” as specified in Exhibit D. 3. Both Council and City desire that the Council Project be constructed with City’s Project which is more fully described in Article I of this Agreement. 4. The term “Council's Authorized Representative or ‘CAR’” (hereinafter referred to as “CAR”) means the person designated in writing by Council’s General Manager of Metropolitan Council Environmental Services (“MCES”), as the Council’s authorized representative assigned to manage this Agreement. 5. Council is not staffed or equipped to construct the Council Project at this time. 6. Therefore, Council desires to have the City facilitate the necessary construction of the Council Project as part of the City Project, which is being performed by the developer, U.S. Home, under the Development Contract for Amelia Meadows (“Development Contract”), attached hereto as Exhibit E. 7. The City shall cause U.S. Home to construct the Council Project with the City Project through the Development Contract, including any amendments to the Development Contract as necessary. 8. All references to U.S. Homes shall include U.S. Home’s contractors where contractors are used in the services of this Agreement, whether or not such contractors are expressly referenced in this Agreement. 9. Pursuant to Minnesota Statutes, Section 473.504, subd. 12, Council is authorized Page 113 of 445 to contract with any local government unit for the performance on Council’s behalf of any service on such terms as may be agreed upon by the contracting parties. 10. The recitals set forth above are incorporated herein by reference and made part of this Agreement. NOW, THEREFORE, for mutual consideration, the receipt and sufficiency of which is hereby acknowledged by the Parties, the Parties agree as follows: AGREEMENT I. Purpose of Agreement 1. The purpose of this Agreement is to set forth the terms and conditions and responsibilities of each of the Parties to this Agreement for the construction of the Council Project. The Council hereby appoints the City as its agent to construct the Council Project in accordance with the Council Project construction documents and the terms and conditions of this Agreement. 2. For purposes of this Agreement the scope of the Council Project is as follows: Install a new 10-ft diameter polymer concrete meter vault with a 6-inch Parshall flume, 37 linear feet of 27-inch CCFRPMP, and a bituminous pavement driveway. 3. The location of the City Project and the Council Project is shown on the attached Exhibit A. II. Construction Documents 1. The Council will prepare and submit to the City for review and acceptance, a design document, including plans, and specifications for the Council Project (“Council Project Construction Documents”). City agrees that it will review the Council Project Construction Document in a timely manner and will not unreasonably withhold acceptance of the Council Project Construction Document. 2. The City shall be responsible for ensuring that the Council Project requirements are met. The City will require, through its development contract with U.S. Home that U.S. Home, as the developer and contracting entity for the City Project, incorporate the approved Council Project Construction Documents into the overall construction document for the City Project. The City, through U.S. Home shall be responsible for bidding, awarding, and administering all construction contracts necessary to complete both the City Project and the Council Project in accordance with Minnesota Statutes, Section 471.435, also known as the Uniform Municipal Contracting Law. 3. Prior to the start of construction of the Council Project, the City will cause U.S. Home to submit to the City the construction schedule proposed by U.S. Home’s contractor for the Council Project portion of the work. The City will promptly forward to the Council the Page 114 of 445 schedule, and the Council will have fourteen days to review and accept or reasonably reject the proposed schedule. Once accepted by the Council, the schedule will be incorporated into and become part of the Council Project Construction Documents. Throughout construction, the City will cause U.S. Home to submit to the City, and subsequently from the City to the Council, any proposed changes to the accepted schedule for the Council’s Project for Council’s review and acceptance, which will not be unreasonably withheld or delayed. 4. The City will require, through its development contract with U.S. Home that the construction contracts entered into by U.S. Home for the City Project incorporate the Council’s Project and expressly provide that U.S. Home and its contractor(s) must: i. Perform the Council Project in strict accordance with the Council Project Construction Documents; ii. Not interrupt Council’s existing sewer service at any time without the prior written consent of the CAR; iii. During construction of the Council Project, there will be no interruptions to the sanitary sewer transport system that will affect the Council’s billing process and procedures without the written consent of the Council; and iv. At all times maintain unrestricted access for the Council and its representatives to the Council’s existing gravity sewer and any other Council facilities. 5. The City will use best efforts, but no less than the same level of effort the City would use for its project, to enforce the obligations described in paragraphs 2, 3, and 4 above against U.S. Home and its contractor(s) for the benefit of the Council. III. Reserved. IV. Easements and Permits 1. City, at its expense, will acquire all permanent and temporary permits, easements and property interests necessary for the Council Project. 2. As of the date of this Agreement, no additional property acquisition is required for construction and installation of the Council Project within the City Project. Council will be responsible for all land acquisitions outside of the City Project under this Agreement necessary to install the Council Project. 3. City will be responsible to obtain all other permits associated for the construction of the Council Project. V. Reserved Page 115 of 445 VI. Construction and Contract Administration 1. The City shall require U.S. Home to administer all construction contracts for the City Project, including the Council Project, and that U.S. Home provide construction staking, field supervision, and all other construction administration services necessary for the proper completion of the Council Project in accordance with the Council Project Construction Documents. 2. The CAR will have the right, at all reasonable times, to inspect the work on the Council Project. The City will cause U.S. Home to provide the following on a regular basis: a. Weekly in-person construction meetings for the Council Project; b. 3-week construction schedule look ahead at each construction meeting; c. All testing and inspection reports related to the Council Project; and d. Monthly pay applications or progress payment documentation showing quantities and work completed on the Council Project. e. The Council Project may be inspected by the CAR, but the Council's Authorized Representative will not have responsibility for supervision of the work. The City will provide to the CAR weekly construction reports indicating construction progress, testing results, and bid item pay quantities for the purposes of monthly estimates. The CAR will notify the City immediately of U.S. Home’s failure to comply with the Council Project Construction Documents during the performance of the Council Project work and inform the City of the specific reasons for non-conformance. The City will immediately forward such notice to U.S. Home and will use best efforts, but no less than the same level of effort the City would use for its project, to cause U.S. Home and its contractor to correct the non-compliance. Upon completion of the Council Project, Council will inform the City in writing either that the Council’s Project has been constructed and conforms to the Council Project Construction Documents and is fully operational, or that Council’s Project has not been constructed in accordance with the Council Project Construction Documents and is not operational. 3. Upon substantial completion of the Council Project, the City will cause U.S. Home to notify the Council in writing that the Council Project is ready for final inspection and acceptance. Within a reasonable time thereafter, the Council will inspect the Council Project and will notify the City in writing either: a. that the Council Project has been constructed in substantial conformance with the Council Project Construction Documents and is fully operational and accepted by the Council; or b. that the Council Project does not conform to the Council Project Construction Documents, specifying the deficiencies and the corrective work required. Page 116 of 445 The City will require U.S. Home to promptly complete all corrective work identified by the Council. The final decision on conformance of Council’s Project to the Council Project Construction Documents will be made by Council. The Council will accept the work on the Council Project in writing. 4. The City will require U.S. Home and its contractors to submit all shop drawings, product data, and other submittals required by the Council Project Construction Documents directly to the CAR. The Council will provide written comments within fourteen days. Primary responsibility for ensuring that all submittals conform to the overall design intent and are compatible with the Council Project Construction Documents will remain with U.S. Home and its contractor. 5. The City will use best efforts, but no less than the same level of effort the City would use for its own project, to enforce, for the benefit of the Council, all obligations of U.S. Home and its contractors under the development contract and construction contracts relating to the proper and timely completion of the Council Project in accordance with the Council Project Construction Documents. VII. Modifications to Construction Documents 1. Neither the City nor U.S. Home will implement, and the City will require U.S. Home to ensure that its contractor does not implement, any amendment to or material change in the approved Council Project Construction Documents without the Council’s prior written acceptance. City will submit any amendments to or material changes to the Council Project Construction Documents to the Council for review and acceptance, which acceptance will not be unreasonably withheld and will be communicated by notice from Council to City within fourteen calendar days of receipt. Requests for amendments or material changes (“Change Order”) to the Council Project Construction Documents must be submitted to the CAR at least fourteen calendar days prior to implementation. No work implementing such amendment or material change may proceed until the City has received written acceptance signed by the General Manager of Metropolitan Council Environmental Services or their designee. 2. The Council may, by written directive from the CAR, require changes or modifications to the scope, design, or details of the Council Project. The City will promptly cause U.S. Home to cause its contractor to perform such changes or modifications, provided that: a. All direct additional costs reasonable incurred as a result of such Council-directed changes will be promptly reimbursed by the Council to the party that actually incurs the cost upon receipt of a detailed invoice; and b. If the Council directed change will materially increase the cost of or delay the scheduled completion of the City Project, the Parties will negotiate in good faith an equitable adjustment to the City Project schedule and or reimbursement to the City or U.S. Home before the change is implemented. VIII. Page 117 of 445 Entry Onto Easements 1. The City hereby grants to Council the right to enter onto its property and any easements and right-of-way that it may have obtained for construction of the Council Project for the purpose of Council fulfilling its obligations under this Agreement. 2. Council hereby grants to the City the right to enter onto its property and any easements and right-of-way that it may have obtained for the Council Project for the purpose of the City fulfilling its obligations under this Agreement. IX. Cost Participation 1. Council will reimburse the City for construction of the Council Project. An estimated itemization of reimbursement of the construction costs is set forth in the attached Exhibit B. 2. The Parties further agree that the project costs stated above in this Article IX and more specifically shown on Exhibit B to this Agreement are an estimate of the construction costs for the contract work on the Council Project. The unit prices and bid items for the Council Project that are contained in the construction contracts entered into by U.S. Home and the final quantities of work actually performed on the Council Project, as measured and certified by U.S. Home and verified by the City Engineer or the City’s designated representative. The City Engineer’s designated representatives will govern in computing the total final contract construction cost, including the cost of amendments and Change Order(s) as provided in Article VII of this Agreement, for determination of the final Council Project construction and administration costs for reimbursement to the City by Council, which shall not exceed the amount of $983,787.20 without an amendment to this Agreement. 3. All payments to U.S. Home or work performed on the Council Project will be made by the City. X. Payment and Record Drawings 1. During construction of the Council Project, the City will submit invoices to the Council for reimbursement of Council Project costs after the City has received from U.S. Home a properly executed pay voucher accompanied by partial or final lien waivers that specifically identify completed Council Project work. The Council will pay the City within 35 calendar days after it receives the invoice. If the Council disputes any portion of an invoice, it will give the City notice of the dispute within 14 calendar days after the Council receives the invoice. If the Council disputes any portion of an invoice, the Council will pay the undisputed portion of the invoice within 35 calendar days after receipt of the invoice, and it will pay the remainder of any amount due within 35 calendar days after the dispute is resolved. 2. In the event the calculations show that Council has advanced funds in greater amount than is due the City, the City will refund without interest the amount to Council. Page 118 of 445 3. Payment by Council will be adjusted by any Change Order(s) approved by Council as provided in Section VII of this Agreement. 4. Upon completion of the construction of the Council Project and acceptance of the Council Project by Council, the City will cause U.S. Home to prepare and provide to City and Council (i) electronic file as-built drawings of the Council Project and (ii) deliver copies of and assign to Council any warranties of labor or materials for the Council Project. XI. Ownership/Maintenance/Warranties 1. Upon completion of the construction of the Council Project and acceptance of the Council Project by Council pursuant to this Agreement, the Council Project will become property of the Council. All associated warranties and guarantees provided by the construction contractors and subcontractors associated with the Council Project will become the property of Council, and shall be assigned to the Council. 2. Upon Council becoming the owner of the Council Project, Council will be responsible for operation and maintenance of the Council Project including the connection structure. The City will own and be responsible for the gravity sewer upstream of interceptor 8007 MH 33. The Council will grant the City periodic access to the Council connection structure for operational purposes. XII. Liability 1. To the extent authorized by law each Party is responsible only for its own acts and the results of its acts. The Council’s and City’s liability is governed by the provisions of Minnesota Statutes, Chapter 466. 2. The Council and City each warrant that they have an insurance or self-insurance program with minimum coverage consistent with the liability limits in Minnesota Statutes, Chapter 466. Nothing in this Agreement is a waiver or limitation of any immunity or limitation of liability by the Council or City. 3. The City will ensure that the construction contract associated with the Council Project includes clauses that: a. the City will cause U.S. Homes and their contractor to defend, indemnify, and hold harmless the Council, its officers, agents and employees from claims, suits, demands, damages, judgments, costs, interest, expenses (including reasonable attorney’s fees, witness fees and disbursements) arising out of or by reason of the acts or omissions of U.S. Home, its officers, employees, agents or subcontractors; b. the City will cause U.S. Home to require the contractor to provide and maintain insurance in the amounts specified in the attached Exhibit E, which is incorporated into this Agreement, and name the Council as an additional insured under Section 38.I of the Amelia Meadows Development Contract; Page 119 of 445 c. require the contractor to be an independent contractor for the purposes of completing the work on the Council Project; and d. require the City’s contractor to provide to City and Council the contractor’s Certificate of Insurance that shows the Council as additionally insured for work covered by the contract. XIII. General Provisions 1. All records kept by the Council and City with respect to the Council Project are subject to examination by representatives of each Party. All data collected, created, received, maintained or disseminated for any purpose by the Council and City under this Agreement are governed by Minnesota Statutes, Chapter 13 (“Act”), and the Minnesota Rules implementing the Act. 2. The City agrees to comply with all laws applicable to the City relating to nondiscrimination, affirmative action, public purchases, contracting, employment, workers’ compensation, prompt payment under Minnesota statutes Section 471.425 subd. 4a., and surety deposits required for construction contracts. Minnesota Statutes, Section 181.59 and any applicable local ordinance relating to civil rights and discrimination and the Affirmative Action Policy statement of the Council is considered a part of this Agreement. 3. The employees of the Parties, and all other persons engaged by each Party will not be considered employees of the other Party. Each Party is solely responsible for all claims arising from its employees including claims under the Worker’s Compensation Act, the Minnesota Economic Security Law and all third party claim resulting from an act or omission of an employee. 4. If hazardous wastes, pollutants or contaminants as those terms are defined in law exist on the Combined Project site, the City will require, through its development contract with U.S. Home, that U.S. Home be solely responsible for any response or remedial action, monitoring or reporting under the law. The City will cause U.S. Home to promptly notify the City and the Council of any discovery or suspected presence of such substances, apply for and obtain all required environmental regulatory approvals, no-association letters, no-further actions letters, or other assurance letters, and have the Council expressly named as a beneficiary or protected party in each such document. The City will cause U.S. Home to perform or cause to be performed all necessary Phase I and Phase II environmental investigations and promptly deliver copies to Council. This paragraph survives the termination of this Agreement. 5. This Agreement is the entire agreement between the Parties and supersedes all oral agreements and negotiations between the Parties relating to this Agreement. All exhibits and attachments to this Agreement are incorporated into the Agreement. If there is a conflict between the terms of this Agreement and any of the exhibits, the Agreement governs. 6. The provisions of this Agreement are severable. If a court finds any part of this Agreement void, invalid, or unenforceable, it will not affect the validity and enforceability of the Page 120 of 445 remainder of this Agreement. A waiver by a Party of any part of this Agreement is not a waiver of any other part of the Agreement or of a future breach of the Agreement. 7. Any modifications to this Agreement will be in writing as a formal amendment. 8. This Agreement is binding upon and for the benefit of the Parties and their successors and assigns. This Agreement is not intended to benefit any third-party. 9. Except as otherwise provided for in this Agreement, this Agreement may be terminated by the mutual agreement of the Parties. 10. If a force majeure event occurs, neither Party is responsible for a failure to perform or a delay in performance due to the force majeure event. A force majeure event is an unforeseen event beyond a Party’s reasonable control, such as unusually severe weather, fire, floods, other acts of God, labor disputes, acts of war or terrorism, or public health emergencies. 11. Under Minnesota Statutes, Section 16C.05, subdivision 5, the Parties agree that the books, records, documents, and accounting procedures and practices relevant to this Agreement are subject to examination by either Party and the state auditor or legislative auditor, as appropriate, for at least six years from the end of this Agreement. 12. A Party will send all notices or demands under this Agreement either by: a. certified mail; b. e-mail, as long as the recipient acknowledges receipt by e-mail or otherwise in writing; or c. delivered in person to the other Party addressed to the following authorized representatives: Daniel Chouinard Metropolitan Council Environmental Services 3565 Kennebec Drive Eagan, MN 55122 Zach Johnson City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 13. The Parties will use a dispute resolution process for any unresolved dispute between the Parties before exercising any legal remedies. The dispute resolution process is a three level dispute resolution ladder that escalates a dispute from the project management level through the executive management level. At each level of the dispute resolution process, the Parties’ representatives will meet and explore resolution until either Party determines that effective resolution is not possible at the current level, and notifies the other Party that the process is elevated to the next level. The Parties designate the following dispute resolution representatives: City Representative Metropolitan Council Representative Page 121 of 445 Level 1 Zach Johnson, City Engineer Interceptor Engineering Manager Level 2 Paul Oehme, Public Works Director Assistant General Manager Level 3 Justin Miller, City Administrator General Manager, Environmental Services The Parties will complete the dispute resolution process in good faith before resorting to any other legal process or remedy. 14. The City is authorized to enter into this Agreement pursuant to the City Resolution No. ___, approved on _____. The Council is authorized to enter this Agreement pursuant to Business Item 2024-226, approved on September 25, 2024. 15. This Agreement will be effective when all Parties have signed it. The date of this Agreement will be the date this Agreement is signed by the last Party to sign it (as indicated by the date associated with that Party’s signature). 16. The following list of exhibits are an integral part of this Agreement and deemed incorporated by reference herein. a) Exhibit A: Project Limits b) Exhibit B: Cost Estimates c) Exhibit C: Contractor Insurance Certificate as required in Section XII and this Agreement (to be provided to the Council when construction contract is awarded) d) Exhibit D: Council Project Plans and Specifications (or “Council Project”) e) Exhibit E: Development Contract between the City of Lakeville and U.S. Home, LLC for Amelia Meadows Each Party is signing this Agreement on the date stated below that Party’s signature. METROPOLITAN COUNCIL, A public corporation and political subdivision of the State of Minnesota By: Name, Title:________________________________ Page 122 of 445 Date: CITY OF LAKEVILLE A municipal corporation of the State of Minnesota By: Luke M. Hellier, Mayor Date: and Ann Orlofsky, City Clerk Date: [The remainder of this page is intentionally blank.] Page 123 of 445 Exhibit A Project Limits (see next page) Council No. 24I025 Page 124 of 445 5(912'$7( '5:15(0$5.6'(6,*1('%< '<RXQJEORRG'5$:1%< '<RXQJEORRG6+((7&+. '%< '<RXQJEORRG&5266&+. '%< 6 :ROVIHOG$33529('%< '<RXQJEORRG6+((712352-(&712;;;;;;;;;;),/(1$0(0B&RRSHUDWLYH$JUHHPHQW&+.'1HZ/DNHYLOOH)DUPLQJWRQ0HWHU0(63URMHFW'$7($XJXVW6RXUFHV(VUL+(5(*DUPLQ86*6,QWHUPDS,1&5(0(17315&DQ(VUL‘…ƒŽ‡¯6FDOH3DJH2ULHQWDWLRQ1RWHV'LUHFWLRQRIVHZHUIORZLVJHQHUDOO\ZHVWWRHDVW6SDWLDOGDWDLVIURPWKH0&(6JHRGDWDEDVHREWDLQHG-DQXDU\/HJHQG'RFXPHQW3DWK‹&'060,7+$//5,*+765(6(59('5(86(2)'2&80(1767+(6('2&80(176$1''(6,*163529,'('%<352)(66,21$/6(59,&(,1&25325$7('+(5(,1$5(7+(3523(57<2)&'060,7+$1'$5(12772%(86(',1:+2/(253$57)25$1<27+(5352-(&7:,7+2877+(:5,77(1$87+25,=$7,212)&'060,7+&XUUHOO%OYG8QLW:RRGEXU\0LQQHVRWD!(!(!(!(!(!(!(0+0+0+0+0+0+0+6RXUFH(VUL0D[DU(DUWKVWDU*HRJUDSKLFVDQGWKH*,68VHU&RPPXQLW\°LQFK IHHWʹͲͲ–Š–”‡‡–Ȁ ‹‰Š™ƒ›͸Ͷ),*!(0DLQWHQDQFH+ROH0&(6,QWHUFHSWRU([KLELW$3URMHFW/LPLWV0HW&RXQFLO&RQWUDFW1R,ͷͲˆ–‡”ƒ‡–ƒ•‡‡–‡–‡”‡†‘‡™‡”‹’‡Ž‹‡‹–›‡™‡”‡†ƒ”˜‡—‡0+0+0+”‘Œ‡…–‘…ƒ–‹‘‡™‡–‡”ƒ—Ž–Page 125 of 445 Council No. 24I025Exhibit A (continued) - Project LimitsPage 126 of 445 Exhibit B Cost Estimates (see next page) Council No. 24I025 Page 127 of 445 Metropolitan Council Environmental Services No.Item Unit Est. Qty.Unit Price MCES Est. Qty* Others Estimated Qty MCES Extended Others Extended Total 1 Mobilization LS 1 $37,800.00 1 0 $37,800.00 $0.00 $37,800.00 2 Dewatering LS 1 $16,600.00 1 0 $16,600.00 $0.00 $16,600.00 3 Temporary Conveyance LS 1 $39,400.00 0 1 $0.00 $39,400.00 $39,400.00 4 Bollards EA 6 $2,210.00 6 0 $13,260.00 $0.00 $13,260.00 5 Bituminous Pavement SY 140 $105.00 140 0 $14,700.00 $0.00 $14,700.00 6 Excavation CY 3000 $5.00 1900 1100 $9,500.00 $5,500.00 $15,000.00 7 Sheeting and Shoring SF 5500 $12.38 2400 3100 $29,712.00 $38,378.00 $68,090.00 8 24-in CCFR Pipe LF 100 $1,050.00 0 100 $0.00 $105,000.00 $105,000.00 9 27-in CCFR Pipe LF 37 $1,160.00 37 0 $42,920.00 $0.00 $42,920.00 10 48-in Manhole (New)LS 1 $98,400.00 0 1 $0.00 $98,400.00 $98,400.00 11 48-in Manhole Extension to Grade LS 1 $27,500.00 0 1 $0.00 $27,500.00 $27,500.00 12 120-in Polymer Concrete Meter Vault LS 1 $484,000.00 1 0 $484,000.00 $0.00 $484,000.00 13 Parshall Flume (6-in Throat)LS 1 $85,800.00 1 0 $85,800.00 $0.00 $85,800.00 14 RTU Cabinet and Base LS 1 $26,400.00 1 0 $26,400.00 $0.00 $26,400.00 15 Backfill CY 2900 $5.40 2900 0 $15,660.00 $0.00 $15,660.00 16 Erosion Control / Stabilization LS 1 $3,000.00 1 0 $3,000.00 $0.00 $3,000.00 17 Survey - Sathre Bergquist LS 1 $5,000.00 1 0 $5,000.00 $0.00 $5,000.00 18 Geotechnical Inspections LS 1 $10,000.00 1 0 $10,000.00 $0.00 $10,000.00 19 CAR Directed Time and Material Allowance EA 100000 $1.00 100000 0 $100,000.00 $0.00 $100,000.00 *After Council Project is complete, as-built quantities will be used to update MCES Est. Qty, and invoice will be sent to Met Council Subtotal $1,208,530.00 Others Construction Cost $314,178.00 Met Council Construction Cost $894,352.00 Contract Administration (10%) $89,435.20 TOTAL Met Council Cost $983,787.20 MET COUNCIL ENVIRONMENTAL SERVICES Project 805609 LAKEVILLE AGREEMENT FOR REIMBURSEMENT Exhibit B - Cost Estimates 801 of 1 10/20/2025 Council No. 24I025 Page 128 of 445 Exhibit C Contractor Insurance Certificate (see next page) Council No. 24I025 Page 129 of 445 Exhibit D Council Project Plans and Specifications (see next page) Council No. 24I025 Page 130 of 445 VOLUME 1 OF 1SHEETS 1 - 12MCES PROJECT 805609JUNE 2025LAKEVILLE FARMINGTON M657METROPOLITAN COUNCIL CONTRACT 24I025FINAL DESIGN652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.comCouncil No. 24I025, Exhibit D, Page. 1 of 1Page 131 of 445 MCES PROJECT 805609VICINITY MAPNO SCALELOCATION MAPNO SCALEMETROPOLITAN COUNCIL CONTRACT 24I025LAKEVILLE FARMINGTON M657 652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.comNONPUBLIC DATA112C:\PW_PL1\CLAYTONDD\D4323544\G001.DWGSHEET INDEXDISCIPLINESHEETNUMBERDRAWINGNUMBERSHEET TITLE DESCRIPTIONGENERAL1 G1 TITLE SHEET2 G2 GENERAL NOTES AND ABBREVIATIONS3 G3 GENERAL LEGEND4 G4 GENERAL ABBREVIATIONSCIVIL5 C1 CIVIL LEGEND6 C2 PLAN AND PROFILE7 C3 DETAILS8 C4 DETAILS9 C5 DETAILSPROCESS10 D1 PLAN AND SECTION11 D2 DETAILS12 D3 DETAILSM657PROJECT LOCATIONLAKEVILLEFARMINGTON M657PROJECT LOCATION200 ST W2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 132 of 445 GENERAL NOTES:1. LOCATIONS OF EXISTING PROPERTY LINES, ABOVE GRADESTRUCTURES, SUBSURFACE STRUCTURES, AND SOIL CONDITIONS AREBASED ON BEST AVAILABLE INFORMATION AND ARE APPROXIMATE.ACCURACY IS NOT GUARANTEED. CONTRACTOR SHALL FIELD VERIFYLOCATIONS AND DIMENSIONS OF ALL PERTINENT EXISTING ITEMSPRIOR TO CONSTRUCTION.2. ALL CONSTRUCTION ACTIVITIES ARE TO BE CONFINED TO EXISTINGRIGHT OF WAY, EASEMENTS, AND ACCESS PERMIT AREAS UNLESSOTHERWISE AUTHORIZED BY PROPERTY OWNER. CONTRACTOR SHALLPROVIDE ALL SHORING AND PROTECTION AS NECESSARY TO KEEPEXCAVATION LIMITS WITHIN EXISTING RIGHT OF WAY AND EASEMENTS.3. CONTRACTOR SHALL CONTACT GOPHER STATE ONE CALL(800-252-1166 OR 651-454-0002) AT LEAST 48 HOURS PRIOR TO STARTOF ANY EXCAVATION ACTIVITIES.4. HORIZONTAL AND VERTICAL LOCATIONS OF EXISTING UTILITIES ASSHOWN ARE APPROXIMATE AND FOR INFORMATIONAL PURPOSESONLY. CONTRACTOR SHALL FIELD VERIFY THE LOCATION OF ALLUTILITIES PRIOR TO CONSTRUCTION AND COORDINATE WITH UTILITIESCONSTRUCTED FOR THE RESIDENTIAL DEVELOPMENT. CONTRACTORSHALL VERIFY AND RECORD THE HORIZONTAL AND VERTICALLOCATIONS OF ALL UTILITIES ENCOUNTERED IN THE FIELD ANDRECORD ANY CHANGES ON THE RECORD DRAWINGS.5. CONTRACTOR SHALL CONTACT UTILITY OWNERS AND/ OR PERFORMEXPLORATORY EXCAVATIONS TO DETERMINE THE EXACT LOCATIONSOF UNDERGROUND UTILITIES, FACILITIES AND OTHER ITEMS ASNECESSARY. IF ITEMS NEED RELOCATION, THE CONTRACTOR SHALLNOTIFY THE CAR AND SUBMIT A PLAN FOR APPROVAL WELL INADVANCE OF RELOCATING ANY ITEMS. CONTRACTOR SHALL BERESPONSIBLE FOR MAKING ALL ARRANGEMENTS, INCLUDINGAPPROVAL AND COORDINATION, WITH FACILITY OWNER FORRELOCATION OF AN ITEM.6. CONTRACTOR SHALL SUPPORT ALL EXISTING UTILITY PIPING ANDCONDUIT EXPOSED DURING CONSTRUCTION BY MEANS ACCEPTABLETO UTILITY OWNER. THE CONTRACTOR SHALL PROTECT ANY EXISTINGTHRUST BLOCKS ENCOUNTERED THAT MAY BE RESTRAINING EXISTINGUTILITIES AND SHALL NOT UNDERMINE THEM.7. VERIFY AND DOCUMENT LOCATIONS AND SIZES OF ALL ACTIVEEXISTING MANHOLE CONNECTIONS.8. COORDINATE TRAFFIC CONTROLS WITH ACTIVE CONSTRUCTION ATTHE DEVELOPMENT.9. EASEMENT IS NOT PAVED. ESTABLISH TEMPORARY ACCESS ASNEEDED TO MOBILIZE EQUIPMENT TO WORK AREAS.10. CONTRACTOR SHALL WARRANTY WORK FOR 1 YEAR AFTER FINALCOMPLETION.11. SITE SURVEY BEARINGS ARE BASED ON THE DAKOTA COUNTYCOORDINATE SYSTEM (NAD 83 - 1986 ADJ.)SANITARY SEWER NOTES:1. ALL BACKFILL FOR SEWER EXCAVATIONS SHALL BE COMPACTED TO AMINIMUM OF 95% OF MAXIMUM DENSITY.REMOVALS, EROSION CONTROL, AND RESTORATIONNOTES:1. CONTRACTOR SHALL BE RESPONSIBLE FOR PROTECTING ALLEXISTING ITEMS, UTILITIES, AND STRUCTURES FROM DAMAGE DURINGCONSTRUCTION. THE CONTRACTOR SHALL RESTORE ALL PROPERTYINCLUDING, BUT NOT LIMITED TO, DRAINAGE SWALES, GRADING,LANDSCAPING, AND VEGETATION IN COORDINATION WITH THEDEVELOPMENT'S LANDSCAPING PLANS.2. CONTRACTOR SHALL BE RESPONSIBLE FOR REMOVAL AND DISPOSALOF ALL EXCESS EXCAVATED MATERIAL, SOILS, AND DEMOLITIONDEBRIS TO AN OFF-SITE LOCATION OR ON-SITE LOCATION IDENTIFIEDBY THE DEVELOPER. EXCAVATED SOIL USED FOR BACKFILLING SHALLBE TEMPORARILY STOCKPILED AND SHALL NOT CONTAIN ANYCONSTRUCTION DEBRIS, ROCK OR OTHER DELETERIOUS MATERIAL.3. CONTRACTOR SHALL AVOID DAMAGE TO EXISTING ROADWAYS ANDPAVEMENT BY OBSERVING ALL LOAD LIMITS AND OFF-LOADING OFEQUIPMENT IN ACCORDANCE WITH CITY, COUNTY AND MNDOTSTANDARDS. CONTRACTOR SHALL NOT DISTURB TRAFFIC EXCEPT ASPREVIOUSLY APPROVED TO DO SO BY THE APPLICABLE ROADWAYAUTHORITY AND CAR.4. PROVIDE ROCK CONSTRUCTION ENTRANCE TO PREVENTTRANSPORTING SEDIMENT INTO THE ROAD.5. ALL DISTURBED NON-PAVED AREAS SHALL BE RESTORED TO EXISTINGGRADE. DISTURBED AREAS SHALL BE RESTORED IN COORDINATIONWITH THE DEVELOPMENT'S LANDSCAPING PLANS.6. APPROPRIATE EROSION CONTROL SHALL BE PROVIDED AT ALL TIMESIN AREAS OF CONSTRUCTION, INCLUDING BUT NOT LIMITED TO:ADDITIONAL SILT FENCE, ROCK CONSTRUCTION ENTRANCES, INLETPROTECTION, AND SEDIMENT TRAPS.7. CONTRACTOR IS RESPONSIBLE FOR MAINTAINING COMPLIANCE WITHALL EROSION CONTROL REQUIREMENTS AND PERMITS, INCLUDINGBUT NOT LIMITED TO: NPDES GENERAL CONSTRUCTION STORMWATERPERMIT, CITY PERMITS, AND WATERSHED DISTRICT PERMITS.8. ALL EROSION CONTROL DEVICES SHALL MEET THE STANDARDS FORTHE GENERAL PERMIT AUTHORIZATION TO DISCHARGE STORM WATERASSOCIATED WITH CONSTRUCTION ACTIVITY UNDER THE NATIONALPOLLUTANT DISCHARGE ELIMINATION SYSTEM, PERMIT MN R100001,ISSUED BY THE MINNESOTA POLLUTION CONTROL AGENCY.9. EROSION CONTROL DEVICES SHALL BE MAINTAINED OR REPLACEDPER DISCRETION OF THE DEVELOPER TO REMAIN IN COMPLIANCEWITH THE OVERALL SWPPP FOR THE DEVELOPMENT.10. CONTRACTOR SHALL PLACE ALL DOWN GRADIENT BEST MANAGEMENTPRACTICES (BMPS) PRIOR TO STARTING ANY WORK ACTIVITIES.CONTRACTOR SHALL PLACE PERMANENT SITE RESTORATION BMPSIMMEDIATELY DURING WORK ACTIVITIES, UNLESS THE AREA IS TO BERE-DISTURBED. CONTRACTOR SHALL UTILIZE TEMPORARY BMPS,SUCH AS BLANKET, PLASTIC SHEETING, MULCH, ETC., TO MINIMIZEEROSION UNTIL PERMANENT SITE RESTORATION BMPS ARE PLACEDACCORDING THE PERMIT. THE CONTRACTOR SHALL ADJUST BMPSACCORDINGLY TO AVOID ABOVE AND BELOW GROUND UTILITIES.11. REMOVE ALL SOILS AND SEDIMENTS DEPOSITED ONTO PUBLIC AND/ORPRIVATE PAVEMENT AREAS.12. INSTALL INLET PROTECTION IN ALL DOWNSTREAM CATCH BASINSWHICH RECEIVE RUNOFF FROM THE DISTURBED AREA. CATCH BASININSERTS ARE REQUIRED AT ALL LOCATIONS NOT WITHIN THEDISTURBED AREA WHICH RECEIVE RUNOFF (MNDOT TYPE C INLETPROTECTION). NOTE, HAY BALES AND SILT FENCE WRAPPED GRATESARE NOT EFFECTIVE AND ARE NOT APPROVED FOR USE AS INLETPROTECTION DEVICES.13. TEMPORARY STOCKPILES LOCATED ON PAVED SURFACES MUST BE ATLEAST 2 FEET OR MORE AWAY FROM THE DRAINAGE/GUTTER LINERAND SHALL BE COVERED IF REMAINING MORE THAN 24 HOURS. AT NOTIME SHALL ANY STOCK PILE REMAIN IN PLACE FOR MORE THAN 5DAYS. ANY STOCKPILES REMAINING MORE THAN 24 HOURS WITHPOSITIVE CONTINUOUS DRAINAGE TO THE WETLAND, OR ANY OTHERCRITICAL AREAS, SHALL HAVE SUPER DUTY SILT FENCE INSTALLED.14. MAINTAIN ALL TEMPORARY EROSION CONTROL DEVICES IN PLACEUNTIL THE CONTRIBUTING DRAINAGE AREA HAS BEEN STABILIZED.INSPECT TEMPORARY EROSION AND SEDIMENT CONTROL DEVICESONCE EVERY 7 DAYS DURING ACTIVE CONSTRUCTION AND WITHIN 24HOURS AFTER A RAINFALL EVENT GREATER THAN 0.5 INCHES BY THECONTRACTOR AND REPLACE DETERIORATED, DAMAGED, OR ROTTEDEROSION CONTROL DEVICES IMMEDIATELY. TEMPORARY ANDPERMANENT SEEDING WILL BE OBSERVED FOR GROWTH ANDWASHOUTS. BMPS WILL BE CLEANED/MAINTAINED PER THE PERMIT.SEE SECTION IV.E. OF THE PERMIT FOR ADDITIONAL INSPECTIONREQUIREMENTS.15. MAINTENANCE OF EROSION AND SEDIMENT CONTROL DEVICES SHALLBE PERFORMED WHENEVER THE DEVICE IS 30% FULL. FAILURE TOMAINTAIN EROSION CONTROL DEVICES MAY LEAD TO FURTHERENFORCEMENT ACTION.16. READY MIXED CONCRETE AND BATCH PLANT WASHOUTS PROHIBITEDWITHIN THE PUBLIC RIGHT OF WAY. ALL CONSTRUCTION SITE WASTE,INCLUDING BUT NOT LIMITED TO: DISCARDED BUILDING MATERIALS,CONCRETE TRUCK WASHOUT, CHEMICALS, LITTER AND SANITARYWASTE SHALL BE PROPERLY MANAGED AND DISPOSED OF AS TO NOTHAVE AN ADVERSE IMPACT ON WATER QUALITY AND SHALL MEET ALLREQUIREMENTS OF THE GENERAL PERMIT.17. IF DEWATERING IS REQUIRED FOR ANY WORK, THE CONTRACTORSHALL PREPARE A DEWATERING PLAN FOR CAR APPROVAL PRIOR TOSTARTING ANY WORK ACTIVITIES. DISCHARGED WATER SHALL BETREATED PRIOR TO ENTERING SURFACE WATER OR LEAVING THE SITE.CONTRACTOR SHALL ACQUIRE A WATER APPROPRIATIONS PERMITFROM THE MNDNR FOR DEWATERING EXCEEDING 10,000 GALLONS PERDAY OR A TOTAL EXCEEDING 1 MILLION GALLONS PER YEAR.18. TEMPORARILY OR PERMANENTLY STABILIZE ALL DISTURBED AREASWITHIN 7 DAYS. USE SEEDING AND MULCHING WITH EROSIONCONTROL BLANKETING IN WOODED AREAS, SODDING AND STAKEDSODDING IN PARKS AND TURFED AREAS, AND EARLY APPLICATION OFGRAVEL BASE FOR AREAS DESIGNATED FOR PAVED SURFACING.19. REMOVE ALL TEMPORARY SYNTHETIC, STRUCTURAL, ANDNON-BIODEGRADABLE EROSION AND SEDIMENT CONTROL AFTER THESITE HAS UNDERGONE FINAL STABILIZATION AND PERMANENTVEGETATION HAS BEEN ESTABLISHED. MINIMUM VEGETATION COVEROF 70% REQUIRED. ALL TEMPORARY EROSION AND SEDIMENTCONTROL DEVICES SHALL BE MAINTAINED UNTIL THE SITE HAS 70%ESTABLISHED VEGETATIVE COVER AND ALL PAVED AREAS HAVE BEENSTABILIZED WITH THE SELECTED PAVEMENT TYPE OR TEMPORARYPAVEMENT.20.DESIGN DOCUMENTS DO NOT SHOW DEVELOPMENT-WIDE GRADINGPLAN OR POST-CONSTRUCTION LANDSCAPING PLAN. CONTRACTORSHALL RESTORE THE SITE IN ACCORDANCE WITH THESE PLANSPREPARED BY THE DEVELOPER.TEMPORARY CONVEYANCE NOTES:1. PROVIDE PUMPED TEMPORARY CONVEYANCE TO MAINTAINCONTINUAL SANITARY SERVICE DURING CONSTRUCTION.2. PROVIDE TEMPORARY CONVEYANCE SYSTEM PER SPECIFICATIONS.ASSUME A PEAK CONVEYANCE OF 100 GPM. CONTRACTOR SHALLMONITOR FLOW IN THE EVENT ADDITIONAL DEVELOPMENT SOUTH OF200TH STREET ADDS FLOW TO THE SYSTEM THAT MUST BE CONVEYEDDURING CONSTRUCTION.PRECAST VAULT NOTES:1. PRECAST VAULT SHALL BE OF POLYMER CONCRETE DESIGNED TOMITIGATE BUOYANCY ASSUMING GROUNDWATER IS AT GRADE. SEESPECIFICATION FOR REQUIREMENTS.2. CONTRACTOR SHALL MEET ALL REQUIREMENTS OUTLINED BYSPECIFICATIONS OF THE OWNER. IN ADDITION, THE FOLLOWING TWOSPECS ARE INCLUDED WITH THE CONTRACT DOCUMENTS: 02605 -GRAVITY SEWER MAINTENANCE HOLES AND 15152 - PARSHALL FLUMEFLOWMETERS.UTILITY CONTACT INFORMATION:PURSUANT TO THE REQUIREMENTS OF M.S. 216D.04, THE STATE ONE CALLNOTIFICATION CENTER WAS CONTACTED IN FALL 2024. SUBSURFACEUTILITY INFORMATION IN THIS PLAN IS UTILITY QUALITY LEVEL D. THISQUALITY LEVEL WAS DETERMINED ACCORDING TO THE GUIDELINES OFCI/ASCE 38-.2, ENTITLED "STANDARD GUIDELINES FOR THE COLLECTIONAND DEPICTION OF EXISTING SUBSURFACE UTILITY DATA." THISINFORMATION MAY NOT BE RELIED ON AS WARRANTING THE ACTUALPRESENCE, CHARACTERISTICS, OR LOCATION OF THE UNDERGROUNDFACILITIES, AND DOES NOT RELIVE ANY PERSON FROM COMPLYING W/STATE NOTIFICATION AND LOCATION. NOT ALL SANITARY SEWER SERVICESAND WATER SERVICES ARE SHOWN.CONTACT INFORMATION FOR UTILITIESCENTER POINT ENERGY 406-541-9571CENTURYLINK 855-742-6062MCES 651-602-4511MNDOT 651-366-5750XCEL 800-848-7558GOPHER STATE ONE CALL LOCATE REQUESTS: WEB ADDRESS:CALL 811 OR 651-454-0002 OR 800-252-1166WWW.GOPHERSTATEONECALL.ORG/SUBMITNONPUBLIC DATAC:\PW_PL1\CLAYTONDD\D4323544\G002.DWG212652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 133 of 445 1NO SCALEDETAIL TITLECU2.215CU2.2NO SCALESECTIONCU2.21 6ITEM NUMBERKEYNOTE DESIGNATORTITLE BLOCK FOR INTERCEPTOR PROJECTS CU - DISCIPLINE DESIGNATOR0001 - FILENAME SEQUENCE NUMBERTITLE BLOCK FOR MULTIPLE SITE INTERCEPTOR PROJECTSDETAIL TITLESECTION "CUT" SYMBOLREVISION TITLE BLOCKSECTION TITLEREVISION NUMBERREVISION DESIGNATOR CS - DISCIPLINE DESIGNATOR 02 - SITE NUMBER0001 - FILENAME SEQUENCE NUMBER12NO SCALEDETAIL TITLECU215CU2NO SCALESECTIONCU21DISCIPLINE DESIGNATORSITE NUMBERSECTION CUT NUMBERDRAWING NUMBER CONTAINING SECTIONDIVISION BETWEEN SITE & DRAWING NUMBERDISCIPLINE DESIGNATORSITE NUMBERSECTION CUT NUMBERDRAWING NUMBER CONTAINING SECTIONDIVISION BETWEEN SITE & DRAWING NUMBERDISCIPLINE DESIGNATORSITE NUMBERDETAIL NUMBERDRAWING NUMBER CONTAINING DETAILDIVISION BETWEEN SITE & DRAWING NUMBERDISCIPLINE DESIGNATORDETAIL NUMBERDRAWING NUMBER CONTAINING DETAILDISCIPLINE DESIGNATORSECTION CUT NUMBERDRAWING NUMBER CONTAINING SECTIONDISCIPLINE DESIGNATORSECTION CUT NUMBERDRAWING NUMBER CONTAINING SECTIONDISCIPLINE DESIGNATORSITE NUMBERDIVISION BETWEEN SITE & DRAWING NUMBERDRAWING NUMBERINTERCEPTOR PROJECTSMULTIPLE SITE INTERCEPTOR PROJECTSINTERCEPTOR PROJECTSMULTIPLE SITE INTERCEPTOR PROJECTSINTERCEPTOR PROJECTSMULTIPLE SITE INTERCEPTOR PROJECTS823823SHEET NUMBERTOTAL NUMBER OF SHEETS IN PROJECT SETDRAWING NUMBERSHEET NUMBERTOTAL NUMBER OF SHEETS IN PROJECT SETDISCIPLINE DESIGNATORNONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.comC:\PW_PL1\CLAYTONDD\D4323544\G003.DWG3122025-07-0947071Doug J Youngblood&RXQFLO1R,([KLELW'3DJHRIPage 134 of 445 GENERAL ABBREVIATIONSANCHOR BOLTASPHALT CONCRETEADHESIVE CLARIFIER RETURNADHESIVE CLARIFIER SUPPLYADDITIONALARCHITECT/ENGINEERABOVE FINISHED FLOORAGGREGATEALUMINUMALTERNATEANCHORAPPROXIMATEBLIND FLANGEBRAKE HORSEPOWERBITUMINOUSBUILDINGBLOCKBLOCKINGBOTTOM OF DUCTBIOLOGICAL OXYGEN DEMAND (FIVE DAY)BOTTOMBUILT UP ROOFBELL AND SPIGOTCOUNCIL'S AUTHORIZED REPRESENTATIVECATCH BASINCARBONACEUOS BIOLOGICAL OXYGEN DEMAND(FIVE DAY)CUBIC FEETCUBIC FEET PER HOURCUBIC FEET PER MINUTECUBIC FEET PER SECONDCAST IRON PIPECURED IN PLACE PIPECHEMICAL INDUCTIONCONSTRUCTION JOINTCENTERLINECLEARANCE, CENTERLINECLEARCONCRETE MASONRY UNIT, CONCRETE BLOCKCLEAN OUTCONCRETECONNECTIONCONTINUED, CONTINUOUSCOMPUTERCHLORINATED POLYVINYL CHLORIDEDAY, DIAMETERDEGREEDEMOLITION, DEMOLISHDETAIL, DETECTORDUCTILE IRON PIPEDISCONNECTDISTRIBUTION, DISTANCEDOWNDRAWINGEASTECCENTRICEACH FACEEXPANSION JOINTELEVATIONEMBEDDEDEQUALEQUIPMENTEXTRA STRONG VITRIFIED CLAYEACH WAYEACH WAY EACH FACEEXPANSION, PIPE EXPANSIONEXPANSION JOINTEXISTINGEXTERIOR, EXTRACTOREXTENSIONFLOOR DRAINFLOW METERFACE TO FACEFINISH, FINISHEDFINISHED FLOORFLANGEFLOORFIBERGLASS REINFORCED PLASTICFLOW SENSORFOOT, FEETABACACRACSADDLA/EAFFAGGRAL/ALUMALTANCAPPROXBFBHPBITUMBLDGBLKBLKGBODBOTBURB&SCARCBCBODCFCFHCFMCFSCIPCIPPCIUCJCLCLCLRCMUCOCONCCONNCONTCPUCPVCDDEGDEMODETDIPDISDISTDNDWGEECCEFEJELEMBDEQEQUIPESVCPEWEWEFEXPEXP JTEXSTEXTEXTNFDFEF/FFINFIN FLRFLGFLRFRPFSFTGAGALVGPDGPMGRTGGSPGTGYP BDHHBHMHNDRLHORIZHPHRIDININSULINVIPSJTKKLFKPLKSFKSIKVLBLB/DLB/HRLCVLFLSMAXMCUMECHMGDMG/LMHMINMISCMJMLSSMODMSSNNANCNH3-NNICNONOMNTSOCODOPNGOSHAPBPBDPCFPERFPLPLCPLFPNLPREFABPRVPSPSFPSIPSIGPVCPVGAUGEGALVANIZEDGALLONS PER DAYGALLONS PER MINUTEGRATINGGALVANIZED STEEL PIPEGROUT, GREASE TRAPGYPSUM BOARDHEIGHTHOSE BIBHOLLOW METALHANDRAILHORIZONTALHIGH PRESSURE, HORSEPOWERHOURINSIDE DIAMETER, IDENTIFICATIONINCH, INCHESINSULATIONINVERTIRON PIPE SIZEJOINTKIP (1000 POUNDS)KIPS PER LINEAR FOOTKICK PLATEKIPS PER SQUARE FOOTKIPS PER SQUARE INCHTIME (K) CONTROLLED VALVEPOUNDPOUNDS PER DAYPOUNDS PER HOURLEVEL CONTROL VALVELINEAR FOOTLUMP SUMMAXIMUMMASTER CONTROL UNITMECHANICALMILLION GALLONS PER DAYMILLIGRAMS PER LITERMAINTENANCE HOLEMINIMUM, MINUTEMISCELLANEOUSMECHANICAL JOINTMIXED LIQUOR SUSPENDED SOLIDSMODIFIED, MODULE, MODULAR, MOTOR OPERATEDDAMPENERMANUFACTURERS' STANDARDIZATION SOCIETY,MOTOR START SWITCHNORTHNOT APPLICABLENORMALLY CLOSEDAMMONIA NITROGENNOT IN CONTRACTNUMBER, NORMALLY OPENNOMINALNOT SCALEON CENTEROUTSIDE DIAMETEROPENINGOCCUPATIONAL SAFETY AND HEALTH ACTPULL BOX, PUSH BUTTON (ELECTRICAL)PANELBOARD, PARTICLE BOARDPOUNDS PER CUBIC FOOTPERFORATEDPLATEPROGRAMMABLE LOGIC CONTROLLERPOUNDS PER LINEAR FOOTPANEL (CONTROL, PURGE, CABINET, CONSOLE, ETCPANELBOARD)PREFABRICATED (REPLACE OR ADD)PRESSURE RELIEF VALVE, PRESSURE REDUCINGVALVE, POWER ROOF VENTILATORPRESSURE SWITCH, PRESSURE SENSORPOUNDS PER SQUARE FOOTPOUNDS PER SQUARE INCHPOUNDS PER SQUARE INCH GAGEPOLYVINYL CHLORIDEPLUG VALVE, PAVEDRADRCPRDREDREINFREQDREVROROFRNDRSTRTDRTRPSSANSBSECTSFSIMSLSPECSPRTSP/SPASQ FTSQ INSSTSTASTDSTLSTRUCTSUBSTTTBT&BTCTEMPTFTHDTHRUTJTKNTNTOTOWTPTRTDTSLTSTTYPVERTVOLVSVTRWW/WDWHWHTRW/OWRWWFYHRADIUSREINFORCED CONCRETE PIPEROOF DRAINREDUCERREINFORCE, REINFORCED, REINFORCINGREINFORCEMENTREQUIREDREVISE/REVISIONROUGH OPENINGRATE OF FLOWROUNDRESETRESISTANCE TEMPERATURE DETECTORREINFORCED THERMOSETTING RESIN PIPESOUTHSANITARYSOIL BORINGSECTIONSQUARE FEETSIMILARSLOPE, SLIDE, SLIDINGSPECIFICATIONSUPPORTSPACE, SPACES, SPACINGSQUARE FEETSQUARE INCHESSTAINLESS STEELSTATIONSTANDARDSTEELSTRUCTURALSUBSTATION (UNIT, SECONDARY, ETC)TREAD, TANK, TEE, TUNNEL, THERMOSTATTOP OF BEAM, TERMINAL BOX, BOARD, OR CABINET(ELECTRICAL, INSTRUMENTATION, TELEPHONE)TOP AND BOTTOMTOP OF CONCRETETEMPERATURE, TEMPORARYTOP OF FOOTINGTHREAD, THREADEDTHROUGHTOP OF JOISTTOTAL KJELDAHL NITROGENTOTAL NITROGENTOP OFTOP OF WALLTANGENT POINT, TOTAL PHOSPHOROUS, TOP OFPAVEMENT, TOTAL PRESSURETREATEDTOP OF SLABTOP OF STEELTYPICALVERTICALVOLUMEVARIABLE SPEEDVENT THROUGH ROOFWIDTH, WALL, WITH, WEST, WIREWITHWOOD, WIDE, WIDTHWALL HUNG, WALL HYDRANT, WATT-HOURWATER HEATERWITHOUTWATER RESISTANTWELDED WIRE FABRICYARD HYDRANT1. SCREENED (LIGHT) DELINEATION SHOWN ONSHEETS DENOTES EXISTING FACILITIES.SCREENED EXISTING FACILITIES INFORMATIONTAKEN FROM PREVIOUS CONSTRUCTIONSHEETS AND FIELD SURVEYS, IS FORREFERENCE ONLY, AND SHALL BE FIELDVERIFIED BY THE CONTRACTOR PRIOR TO THEORDERING OF MATERIALS AND BEGINNINGCONSTRUCTION. NON SCREENED (BOLD)DELINEATION IS PROPOSED WORK TO BECOMPLETED UNDER THIS CONTRACT.EQUIPMENT IDENTIFICATION SYSTEMEQUIPMENT - PROPOSED AREASDIS = AREA CODENAOCL = PROCESS STREAMP = EQUIPMENT PREFIX01 = EQUIPMENT NUMBEREQUIPMENT - EXISTING NUMBERING RETAINEDPSP = EQUIPMENT PREFIX1 = EQUIPMENT NUMBERVALVES - PROPOSEDDIS = AREA CODENAOCL = PROCESS STREAMV = VALVE01 = VALVE NUMBERVALVES - EXISTING NUMBERING RETAINEDV = VALVE100 = VALVE NUMBEREQUIPMENT PREFIXES - NEWACCAHUBLBSCARDCIUCOLCPEFFGATEGCGSHCHEXHWBMXOCUORDPRECSCALESCGSCPSGSIGNSLGSPSTSTRTWHVESWCWHAIR CONDITIONING CONDENSERAIR HANDLING UNITBLOWERBAR SCREENCARD READERCHEMICAL INDUCTION UNITCOLLECTOR MECHANISMAIR COMPRESSOREXHAUST FANFANARM GATEGRIT CLASSIFIERGRIT CYCLONEHOSE CABINETHEAT EXCHANGERBOILERMIXERODOR CONTROL UNITODOR SCRUBBERPUMPRECEIVERWEIGH SCALESCUM GRINDERSCUM PUMPSLUICE GATESIGNAGESLIDE GATESUMP PUMPSTORAGE TANKSTRAINERTANKLESS WATER HEATERVESSELWASHER/COMPACTORWATER HEATERGENERAL NOTES:BLBLRDWEFERPFGSGCHRUMAUNWPCPSPQCRASPSCSCPSGGSGSESPSTWPTSPWASPWWCHBLOWERBOILERDE-WATERING WELLEXHAUST FANPLANT WATER PUMPSFANGRIT CLASSIFIERGRIT CYCLONEHEAT RECOVERY UNITMAKE-UP AIR UNITMONITORING WELLPRIMARY CLARIFIERPRIMARY SLUDGE PUMPCOMPRESSORRETURN SLUDGE PUMPSECONDARY CLARIFIERSCUM PUMPSCUM GRINDERSLUICE GATESEWAGE EJECTORSCREW PUMPDRAINAGE PUMPTHICKENED SLUDGE PUMPWASTE SLUDGE PUMPCHILLEREQUIPMENT PREFIXES - EXISTINGDIS-NAOCL-P01PSP-1V100DIS-NACOL-VO1NONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.comC:\PW_PL1\CLAYTONDD\D4323544\G004.DWG4122025-07-0947071Doug J Youngbloodsee next page)see next page)&RXQFLO1R,([KLELW'3DJHRIPage 135 of 445 CONCRETE PAVEMENTGRADEAGGREGATE FILLCONCRETE GROUTBITUMINOUS PAVEMENTAGGREGATE PAVEMENTSANDCOMPACTED FILLOBJECT HATCHREMOVALWPE (WATER PLANT EFFLUENT)ACMSEFDGSPDDSWSCDRNRCYTPICHMSCSWPERASATAFEDWMLACM (AIR COMPRESSED)SCS (SCUM SECONDARY)ML (MIXED LIQUOR)DW (DEWATERING)SEF (SECONDARY EFFLUENT)DG (DIGESTER)SPD (SUMP PUMP DISCHARGE)DS (DIGESTED SLUDGE)WSC (WATER SCRUBBER)DRN (DRAIN)RCY (PLANT RECYCLE)FE (FINAL EFFLUENT)RAS (RETURN ACTIVATED SLUDGE)CHM (CHEMICAL)ATA (AERATION)TPI (TOTAL PLANT INFLUENT)UTILITIES LINE TYPE NAME &DESCRIPTIONPROPOSED PLANTLINE TYPE1/4 SECTION CORNER9 119 21 11 0001PARCEL 33PARCEL DESCRIPTION NUMBERPROPERTY DESCRIPTION NUMBERCONTROL HORIZONTALCONTROL VERTICALSECTION CORNERPROPERTY CORNER MONUMENTPROPOSED SURVEYSYMBOLSSYMBOL DESCRIPTIONMHBUILDING STRUCTURESB-47SOIL BORING INDICATORCONTOUR MAJORWATER HYDRANTWATER GATE VALVE870CURB & GUTTERREMOVAL OF EXISTING TREESSTORM MAINTENANCE HOLESDSANITARY MAINTENANCE HOLECATCH BASIN (PAVEMENT AREA)CATCH BASIN (CURB AREA)BENCHMARKSIGNBOLLARDCONTOUR MINOR869885.03SPOT ELEVATIONCATCH BASIN (GRASSY AREA)GUY WIREPOWER POLEDECIDUOUSCONIFEROUSBUSH LINETREESMHMHCBCBCB868CONTOUR DEPRESSIONWWATER MAINTENANCE HOLEGASGAS VALVEUTILITY POLEUPBMCULVERTDYHWVCABLE TV PEDESTALTELEPROPOSED SYMBOLSSYMBOL DESCRIPTIONCTVEOHEUGCTV (CABLE TV)EOH (ELECTRICAL OVERHEAD)EUG (ELECTRICAL UNDERGROUND)>SAN (SANITARY SEWER)STRM (STORM SEWER)WATR (WATERMAIN)FM (FORCEMAIN)GAS (GAS)>>WFMFOT (TELEPHONE FIBER OPTIC)GFOTTOH (TELEPHONE OVERHEAD)TUG (TELEPHONE UNDERGROUND)TOHTUGDOUBLE LINE - UTILITIES 18" & OVER(DRAWN TO OUTSIDE DIAMETER)ENCASED PIPE 18" & OVER(DRAWN TO OUTSIDE DIAMETER)JACKED/TUNNELED PIPE 18" & OVER(DRAWN TO OUTSIDE DIAMETER)PROPOSED UTILITIESLINE TYPESLINE TYPE NAME & DESCRIPTIONw24" PIPEWAS (WASTE ACTIVATED SLUDGE)WASRAS (RETURN ACTIVATED SLUDGE)GTS (GRAVITY THICKENED SLUDGE)RASGTSWET (WETLAND)WETDASHED2 (PERMANENT EASEMENT)DASH4 (TEMPORARY EASEMENT)PHANTOM2 (ASSUMED RIGHT OF WAY)DASHED (CONSTRUCTION LIMITS)XBXCXEXSXWDXB (FENCE-BARBED)XC (FENCE-CHAIN LINK)XE (FENCE-ELECTRIC)XS (FENCE-SILTATION)XWD (FENCE-WOOD).........SPRT (SPECIAL STRUCTURAL SUPPORT)LINE TYPE NAME & DESCRIPTIONSITE LINE TYPESCENTERBUILDING GRID LINECENTER2CENTER LINEHIDDEN2FUTURE WORKGENERAL LINE TYPESLINE TYPE NAME COMMON USAGEMATCH LINEMATCH LINE1GENERAL SYMBOLS1C2DETAIL 1/4" = 1'-0"DETAIL TITLEDETAILNUMBERSCALESHEET NUMBERSECTION CUT NUMBER5M2SHEETNUMBER1C1DETAILNUMBERSHEETNUMBERSECTION CALLOUT DETAIL TITLEPH 1G4SHEETNUMBER1KEYNOTEITEM NUMBERPHOTOGRAPH CALLOUTPHOTOGRAPHNUMBERREVISION NUMBER DETAIL CALLOUTSYMBOLSLINE TYPESNONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.comHATCH PATTERNSC:\PW_PL1\CLAYTONDD\D4323552\C001.DWG5122025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 136 of 445 10+0011+00SEE D1 FOR DETAILSSTA=11+06.83N 169074.01E 528441.16980985977978979981982983984986987988980985979981982983984986980977978979981981981982983MH-2MH-33100 LF 24" S-FRPM @ 0.10%37 LF 27" S-FRPM @ 0.11%27" S24" S-DI (BY OTHERS)8" S-PVCBP: 9+50N 169087.95E 528285.62EP: 12+03N 169095.64E 528532.09PI: 10+00N 169076.87E 528334.37PI: 11+51N 169072.87E 528485.40RTU PADMH-33STA 11+51RIM 976.88INV IN 949.50 27" S-FRPM WINV OUT 949.50 27" S NE39 LF 27" S-FRPM@ 0.11% SLOPE 27"S102 LF 24" S-FRPM@ 0.10% SLOPEMH-2STA 10+00RIM 987.86INV IN 950.77 24" S-DI WINV IN 966.93 8" S-PVC SINV IN 950.77 8" S-PVC NINV OUT 950.67 24" S-FRPM ESTA 11+11.58EL 949.55STA 11+01.83EL 950.57EXISTING GRADEAS OF NOVERMBER 2024FINISHED GRADE(BY OTHERS)SEE D1 FOR DETAILS24" S-DI (BY OTHERS)EL 983.62EL 981.67FINISHED GRADENONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com612C:\PW_PL1\CLAYTONDD\D4323552\C002.DWG9309409509609709809909201000930940950960970980990920100010+00 11+00 12+0001"=20'20 40 6024" CAP FOR FUTURE 24" PIPEKEY NOTES:1. BOLLARDS (TYP 6) PER DETAIL C/C3.2. RAISE MANHOLE TO GRADE. DEMOLISH CONE AND TOP SLAB. ADDNEW WALL, CONE AND FRAME. MANHOLE SHALL BE IN ACCORDANCEWITH MCES STANDARDS. SEE DETAIL B/C3.3. REPLACE MANHOLE PER LAKEVILLE PLATE LF-SS-3 SHOWN ONSHEET A/C3.4. 12-FT WIDE BITUMINOUS DRIVEWAY. SEE DETAIL D/C4.5. INVERT ELEVATION BASED ON RECORD DRAWINGS AND CANNOT BEVERIFIED BECAUSE MANHOLE IS BURIED. FIELD VERIFY PRIOR TOEXCAVATION TO CONFIRM INFLUENT PIPE INVERT ELEVATION.REPORT ELEVATION TO MET COUNCIL REPRESENTATIVE SODRAWINGS CAN BE REVISED FOR KEY ELEVATIONS. ADJUST INVERTSACCORDINGLY TO MAINTAIN A MINIMUM 0.1% SLOPE AND SUFFICIENTDROP THROUGH THE FLUME. PIPE PENETRATION CURRENTLY FOR A27-IN HDPE PIPE. MODIFY AND SEAL FOR 27-IN FRP PIPE.6. PROVIDE FIBERGLASS REINFORCED POLYMER MORTAR (FRPM) PIPEBY HOBAS PIPE. PIPE SHALL BE STIFFNESS CLASS SN 72, PRESSURECLASS PN 25, CCFRPM OR FW, FWC PIPE.7. COORDINATE EXCAVATION BEYOND THE IMMEDIATE PROPERTYBOUNDS WITH RESIDENTIAL DEVELOPMENT CONSTRUCTION TOAVOID INGRESS ON ADJACENT CONSTRUCTION SITES.8. GRADE AROUND TOP SLAB AT 12% TO MEET FINISHED GRADE.9. ROUTE POWER TO A NEW UTILITY POLE NEAR THE RTU CABINET.COORDINATE POWER ROUTING WITH OTHER ELECTRICAL UTILITIESCONSTRUCTED IN THE DEVELOPMENT.10. PROVIDE DRIVEWAY APRON PER LAKEVILLE STANDARD DETAILLV-2T-4 AS SHOWN ON SHEET C3.11. PROVIDE FIBERGLASS INTERMEDIATE PLATFORM AT EL 963.62.DESIGN PLATFORM SO PASS THROUGH BY LADDER IS POSSIBLEWITHOUT REMOVING SECTIONS OF THE PLATFORM. PROVIDE 24-IN X23-IN HINGED PANEL IN GRATING ALIGNED WITH THE MANHOLELOCATED IN CENTER OF TOP SLAB. SEE DRAWING D1 ANDSPECIFICATION 02605 FOR ADDITIONAL INFORMATION.32515" ST (BY OTHERS)15" ST (BY OTHERS)24" CAP FORFUTURE 24" PIPEHYDRANT (BY OTHERS)12" WM (BY OTHERS)15" ST (BY OTHERS)CB (BY OTHERS)ROAD (BY OTHERS)TO MH-2ROW1412'DETENTION POND(BY OTHERS)15" ST (BY OTHERS)13+0014+0066877GENERAL NOTES:1. METER STATION WILL BE INCORPORATED INTO THE OVERALLRESIDENTIAL DEVELOPMENT PLAN. WORK SHALL COORDINATE WITHTHE OVERALL DEVELOPMENT'S GRADING PLAN, LANDSCAPING PLAN,SWPPP AND TRAFFIC CONTROL PLAN.2. WORK SHOWN HEREIN IS LIMITED TO RECONSTRUCTION OF MH-2,RECONSTRUCTION OF THE SEWER WEST TO EAST FROM MH-2 TOMH-33, RAISING MH-33 TO GRADE, CONSTRUCTION OF METERSTATION M657 AND CONSTRUCTION OF AN ACCESS DRIVEWAY.OTHER WORK IS DETAILED IN THE RESIDENTIAL DEVELOPMENTPLAN.3. EXISTING SANITARY SEWER ALIGNED SOUTH TO NORTH AT MH-2 ISACTIVE. PROVIDE TEMPORARY CONVEYANCE TO MAINTAINSANITARY SEWER FLOW DURING CONSTRUCTION.4. DEVELOPER WILL BE GRADING IN AND AROUND THE PROJECT AREA.EXISTING GRADE SHOWN ON THIS SHEET MAY NOT BE ACCURATE ATTHE TIME OF CONSTRUCTION. FIELD VERIFY AS NEEDED.5. SANITARY SEWERS SHOWN AT SUE QUALITY LEVEL B. ALL OTHERUNDERGROUND UTILITIES ARE PLANNED LOCATIONS TO BECONSTRUCTED BY OTHERS.910112025-07-09see next page)e)&RXQFLO1R,([KLELW'3DJHRIPage 137 of 445 D-GRADE RINGS AND CASTING DETAILNO SCALEADROP MANHOLE DETAILNO SCALE4" MAX27" ØB-T-LOCK MH RECONSTRUCTIONNO SCALE12"3'-6"3'-6"VARIES27"KEY NOTES:1. INSTALL BOLLARD (TYPICAL ALLMAINTENANCE HOLES) EXCEPT WITHINROADWAY R/W.2. DOMED TOP WITH TROWELED FINISH.3. PRIME AND PAINT YELLOW.4. 6" DIA. SCHEDULE 40 STEEL PIPE X 7'-0"FILLED WITH CONCRETE.5. SLOPE TOP TO DRAIN.6. 18" DIA. 4000 PSI PORTLAND CEMENTCONCRETE BASE.7. 4" MIN. THICKNESSGENERAL NOTES:1. USE 4" DIA. SCHEDULE 40 GALVANIZED PIPEWITH 8" DIA. CONCRETE FOR MANHOLEBOLLARDS (TYP - 1 EACH NON-ROADWAYLOCATION).2. USE BOLLARDS TO PROTECT VULNERABLEEQUIPMENT - SHOW ON PLAN.4523761KEY NOTES:1. CUT BELL AND SPIGOT ENDS OFF FOR FLUSH CONNECTION.2. CORROSION RESISTANT RCP WITH T-LOK MANHOLE.DIMENSIONS VARY.3. SHIPLAP BUTYL MASTIC JOINT ALL AROUND, GATORWRAP ORAPPROVED OTHER PER MCES STANDARD DETAIL.4. INSTALL CASTING AND COVER PER DETAIL D (SHEET C3) ANDMCES STANDARD DETAIL - GRADE RINGS AND CASTING DETAILNUMBER - 02D132.5. INSTALL 14 GAGE 316 GRADE 12-INCH WIDE STAINLESS STEELBAND AROUND CIRCUMFERENCE OF MANHOLE AFTER SIKASILTAFLEX 1A IS APPLIED. COVER TOP OF T-LOCK. DO NOTCOVER POLYMER MANHOLE. BAND SHALL CONSIST OF TWOPIECES AND EACH SHALL BE SECURED WITH FOUR DRILLED ANDEPOXY ANCHORED STAINLESS STEEL 316 GRADE BOLTS.6. APPLY 1/4-INCH BEAD OF SIKA SILTAFLEX 1A ALL AROUND TOPEDGE OF T-LOCK.7. FURNISH AND INSTALL CONCRETE CONE AND RISER WITHFACTORY APPLIED SUREGRIP CONCRETE PROTECTIVE LINER ORAPPROVED ALTERNATIVE (FOLLOW MCES 09900 CONCRETECORROSION RESISTANT COATING SPEC).4713561356135613567212345GENERAL NOTES:1. USE SLOPED AND OR 1/4-INCHADJUSTMENT RINGS TO MATCHGRADE AND CROWN OF ROAD.2. PAVEMENT AND MANICUREDAREAS: ADJUST TO 1/4-INCHBELOW FINISHED SURFACEELEVATION.3. NON-SURFACED AREAS: ADJUSTTO WITHIN 6-INCHES TO18-INCHES ABOVE FINISHEDGRADE, AND INSTALL MCESSUPPLIED FIBERGLASS STAKE.KEY NOTES:1. MH FRAME AND COVER. NEENAH R-1733 OR EASTJORDAN1205Z FRAME AND 1205AGS COVER. PROVIDEGASKETED SOLID LID WITH TWO CONCEALED PICKHOLES AND 3/4" RAISED LETTERS READING"INTERCEPTOR SANITARY SEWER".2. ADJUSTING RINGS. PRO-RING BY CRETEX, HDPELIFESAVER MANHOLE ADJUSTMENT UNIT BY IPEX, ORHDPE MANHOLE RING BY LADTECH. MAXIMUMADJUSTING HEIGHT 4-INCHES. RINGS TO EXTEND TOEDGE OF MH SHOULDER TO PROVIDE LOAD TRANSFERAS REQUIRED TO MAINTAIN MH LOAD RATING, BUTSHALL NOT EXTEND MORE THAN 6-INCHES BEYONDSHOULDER.3. PROVIDE TWO ROWS OF PRO-STIK BUTYL SEALANT ORAPPROVED EQUAL BETWEEN TOP ADJUSTMENT RINGAND FRAME.4. PROVIDE TWO ROWS OF ADJUSTMENT RINGMANUFACTURER APPROVED SEALANT BETWEEN ALLRINGS AND CONE.5. BOTTOM HDPE ADJUSTMENT RING REQUIRES 1/4-INCHSOLID RING BELOW BOTTOM RING.*OMIT KEYNOTE #5 WHEN USING PRO-RING BY CRETEXE-DRIVEWAY APRON DETAILNO SCALENONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com712C:\PW_PL1\CLAYTONDD\D4323552\C003.DWG2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 138 of 445 A-SILTATION FENCENO SCALEWHEN DISTANCE EXCEEDS 150', OR DRAINAGE AREA EXCEEDS 2 ACRES,USE HEAVY DUTY SILTATION FENCE WITHOUT BALE BACKING.NOTES:2 ACRES MAXIMUM DRAINAGE AREAPER FENCE SEGMENT600' MAXIMUM LENGTHPRE-ASSEMBLED SILTATIONFENCE PLACED ON CONTOURMAXIMUM 7 1/2' ON CENTERSPACING OF POSTSTURN ENDS UPSLOPE TOPREVENT FLOW BYPASSPRE-ASSEMBLED6"x6" EARTH FILL ORPLOWED IN MINIMUMIN 6" FABRICMINIMUM 6" BURYCOMPACTED SUBGRADE6" HORIZONTAL MINIMUM1 1/2"x1 1/2"x4'-0" WOOD POSTSMINIMUM 1'-6" EMBEDMENT2 1/2'MINRUNOFF 150' MAXIMUM 1.960959958PRE-ASSEMBLEDB-FENCE, STRAW/HAY BALENO SCALECOMPRESSED STRAW OR HAY 1'-4"x1'-4"x4'-0" TIED WITH 2 BANDSCOMPOSITE OF NET BACKING, POSTS, GEOTEXTILE ANDFASTENERS ASSEMBLED ON SITE3" DIAMETER WOOD OR METAL POSTSMINIMUM 5x1 1/2" STAPLES PER POST FASTENERS**KEY NOTES:FLOWHEAVY DUTY SILTATION FENCEWITH BALE BACKING FULLWIDTH, PLUS 2' VERTICALON SIDE SLOPESTAGGERED ROWS OF BALES1 TO 4 BALES PER ROW AS REQUIREDTO CROSS 2/3 OF DITCH BOTTOMHEAVY DUTY6"x6" COARSEMINIMUM BURY5' POSTS - 8' MAXIMUMON CENTER AND 2'MINIMUM EMBEDMENTSTRAW OR HAY BALE BACKING OF SILTATION FENCE REQUIREDAT LOCATIONS SHOWN.BALE6" EARTH FILL12' DEEP PENETRATIONMINIMUMMINIMUM 2 WOODSTAKES PER BALE3'MAXAGGREGATE - 6"211 1/2"x1 1/2"x2'-6"GENERAL NOTE:1.STRAW/HAY BALEBARRIER PLACEMENTHEAVY DUTY SILT FENCESWALE, CHANNEL OR DITCH PROTECTIONHEAVY DUTY SILTATIONFLOW6"BURY AND 6" MINIMUM APRONFENCE MATERIAL - 6" MINIMUM12PIPE BEDDING/TRENCH BACKFILL DETAILWITH ROCK STABILIZATION/TRENCH DEWATERINGGRANULAR MATERIALBEDDING MATERIALLAP GEOTEXTILEFABRIC, 24" (MIN)ROCK STABILIZATIONWITH GEOTEXTILE FABRICCOMPACTEDNOTE:CONTRACTOR SHALL CONSTRUCT TRENCH AND PROVIDE PROTECTIVEMEASURES AS REQUIRED TO COMPLY WITH OSHA REGULATIONS.BDPAY WIDTH FOR SURFACEREPLACEMENT (BD + H)HPIPE ZONEFINALBACKFILLC-WITH GEOTEXTILE FABRICNO SCALESUITABLEMATERIALS1'-0"OD/4OD/44" MINOD/412" MIN12" FOR 12"-46"Ø18" FOR 54"-66"Ø24" FOR 72"-96"ØFINISHEDGROUNDLINESUBGRADEPIPE STABILIZATIONA-SILTATION FENCENO SCALED-BITUMINUOUS DRIVEWAYNO SCALENONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com812C:\PW_PL1\CLAYTONDD\D4323552\C004.DWG2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 139 of 445 TO POWER POLEDISCONNECTSWITCH (60 AMP)2'-0"4'-0"6'-0"PEDESTAL OPNG#4 @ 1'-0" OC, EWPEDESTAL ACCESS OPNG6" REINF CONCRETE SLAB-ON-GRADE W/ #4BARS @ 12" OC, EW, REINFORCING SHALLBE CENTERED IN SLAB DEPTH. APPLYMEDIUM BROOM FINISH TO TOP SURFACE1/2" DIA. x 5-1/2" LONG GALV.EXPANSION ANCHORS, WITH 4"EMBEDMENT (TYP OF 4 LOCATIONS)COORDINATE SPACING ANDORIENTATION OF CONDUIT(S) WITHELEC CODE AND ELEC INSPECTOR3'-0"4'-0"2'-6"6"8"x 8" PEDESTALOPNGREMOTE TELEMETRY UNIT (RTU) CABINET ENCLOSURE PLAN VIEW4"2'-0"2'-0"1 5/8" X 1 5/8" X 12 GAUGESTRUT (GALV.) WITH 90 DEGPLATE CONNECTORS WITH 2BOLTS EACH LEG (GALV.)1 5/8" X 1 5/8" X 12 GAUGESTRUT (GALV.) WITH 90 DEGPLATE CONNECTORS WITH 2BOLTS EACH LEG (GALV.)(2) 1/2" DIA EXPANSIONANCHOR (GALV.) WITH 3"EMBEDMENT, TYP. EACH SIDE1 5/8" X 1 5/8" X 12 GAUGESTRUT (GALV.) WITH 90 DEGPLATE CONNECTORS WITH 2BOLTS EACH LEG (GALV.)(2) 1/2" DIA EXPANSIONANCHORS (GALV.) WITH 3"EMBEDMENT, TYP. EACH SIDE1 5/8" X 1 5/8" X 12GAUGE X 3'-0" LONGSTRUT (GALV.)1 5/8" X 1 5/8" X 12GAUGE X 3'-0" LONGSTRUT (GALV.)2'-0" LONGADDITIONAL BARSAT SLAB OPENINGSLEEVED HOLE FOR INCOMINGPOWER LINE UP WITH METERPOWER TO RTU CABINET(4) 1/2" DIA EXPANSIONANCHORS (GALV.) WITH3" EMBEDMENT, TYP.METER ANDDISCONNECT SWITCHTO BE MOUNTEDSEPARATE FROM RTU(NOT SHOWN). FEEDTO GO FROM FEED TOGO FROM METERDISCONNECT SWITCHTO CABINET.2'-0"2'-0"METER COORDINATERECONNECTION WITH UTILITY1 5/8" X 1 5/8" X 12 GAUGESTRUT (GALV.) WITH 45 DEGPLATE CONNECTORS WITH 2BOLTS EACH LEG (GALV.)TO ELECTRIC PROVIDER2" SCH. 80 HDPETRANSITION TO RIGID METALCONDUIT BELOW GRADEAND UP TO METERKEY NOTES:1. MOUNT RTU ENCLOSURE ON PAD.2. IN VAULT PROVIDE THREE (3) 1" SCH 80 PVC CONDUIT WITH PULLSTRING. NO LB FITTINGS IN TOP OF VAULT. TRANSITION FROM PVCTO RIGID STEEL CONDUIT FROM VAULT TO RTU PEDESTAL. SEALPIPE WITH DUCT PUTTY. INSIDE VAULT EXTEND ONE CONDUIT TOFLUME CHANNEL AND ONE TO LIGHT. COORDINATE WITH OTHERSFOR CONDUIT PENETRATIONS THROUGH NEW SLAB FOR RTU ANDWALL OF VAULT.3. 60 AMP, 2 POLE SERVICE ENTRANCE RATED FUSED DISCONNECTSWITCH WITH NEMA 4X ENCLOSURE.4. METER SOCKET WITH INTERNAL BYPASS SWITCH IN ACCORDANCEWITH UTILITY (ELECTRIC PROVIDER) REQUIREMENTS.5. INCOMING ELECTRIC FEED BY CONTRACTOR TO RUN THROUGHMETER AND BE TERMINATED AT SAFETY SWITCH. DOCUMENTFINAL ROUTING. COORDINATE WITH UTILITY TO ENSURE PROPERCONSTRUCTION TIME. MCES ELECTRICIAN SHALL MAKE FINALCONNECTION BETWEEN SAFETY SWITCH AND RTU CABINET.6. UTILIZE 20A SINGLE BOLE BREAKER TO FEED LIGHTING. PROVIDELIGHT SWITCH IN RTU.GENERAL NOTES:1. MCES TO FURNISH RTU CABINET, METER AND SAFETY SWITCH. CONTRACTOR SHALLPICKUP EQUIPMENT AT MCES REGIONAL MAINTENANCE FACILITY LOCATED AT 3565KENNEBEC DRIVE, EGAN, RTU CABINET SHALL BE SET BY CONTRACTOR ON RTU BASE SLAB.2. PROVIDE ALL ELECTRICAL EQUIPMENT, CONDUIT AND WIRE AS REQUIRED TO PROVIDE ACOMPLETE AND FUNCTIONAL SYSTEM3. COORDINATE INSTALLATION OF RISER ON UTILITY POWER POLE OR BURIED SERVICE (ASDIRECTED BY XCEL AND LENNAR) TO MEET XCEL ENERGY REQUIREMENTS. PROVIDEWEATHER PROOF SERVICE HEAD AND SLACK CABLE AS REQUIRED.4. WIRING METHODS WITHIN THE PARTIAL FLUME METERING VAULTS SHALL CONFORM TOCLASS 1, DIVISION 1 HAZARDOUS AREA LOCATION REQUIREMENTS. PROVIDE TWOSEAL-OFF FITTINGS IN THE RACEWAY BETWEEN THE RTU AND THE VAULT PER NEC.5. STRUT STEEL SHALL HAVE A MINIMUM YIELD STRENGTH OF 33 KSI (ASTM A653) WITHMINIMUM MATERIAL THICKNESS OF 12 GUAGE. STRUT STEEL SHALL BE PRE-GALVANIZED.6. CONNECTOR PLATES SHALL HAVE A MINIMUM YEILD STRENGTH OF 33 KSI (ASTM 1011 GR33) AND HAVE DOUBLE BOLT CONNECTIONS. MINIMUM PLATE THICKNESS SHALL BE 1/4". ALLCONNECTOR PLATES SHALL BE PRE-GALVANIZED.7. FASTENERS SHALL BE HEX HEAD BOLTS WITH CHANNEL NUTS MEETING OR EXCEEDINGASTM A576 GR 1015. ALL FASTENERS SHALL BE GALVANIZED.8. EXPANSION ANCHOR SHALL MEET OR EXCEED ASTM F1941 WITH HEX NUTS MEETING OREXCEEDING ASTM A563 GR. A. WASHERS SHALL MEET OR EXCEED ASTM F844.9. COORDINATE WITH ELECTRICAL UTILITY FOR LOCATION OF SERVICE. PROVIDE CONDUITAND GROUND AS REQUIRED BY THE CITY AND UTILITY. PROVIDE 2-IN SCH 80 HDPE WITH (3)#3 XHHW-2 + #8 GND TO UTILITY TRANSFORMER. WIRE FEED ROUTE SHALL STAY WITHINTHE RIGHT OF WAY.10. COORDINATE WITH UTILITY FOR MAIN BREAKER REQUIREMENTS. BOND GROUND TOVAULT.11. MARK ALL FINAL WIRING ROUTING WITH FLAGS AND COORDINATE WITH MCES FOR SURVEYOF UTILITY POST CONSTRUCTION.PVC CONDUITSLEEVE THRU SLABPEDESTALACCESSOPENING#6 COPPER3/4"x10" GROUND RODFINISHEDGROUNDLINE48"x48"x12"CONCRETE SLABUNISTRUT STANDA-RTU PADNO SCALE41METER SOCKETDISCONNECTSWITCH365RTU CABINETNONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com912C:\PW_PL1\CLAYTONDD\D4323552\C005.DWG2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 140 of 445 10 12C:\PW_PL1\CLAYTONDD\D4323573\D001.DWGNONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com1-SECTION1/2" = 1'-0"NOTES:1. LEVEL CALIBRATION POLE TO BEINSTALLED BY OTHERS. HOLEWILL BE CUT IN GRATING BYOTHERS FOR RADAR AND TOALLOW HATCH TO OPEN WITHOUTDISTURBING THE RADAR DEVICE.2. STAFF GAUGE ON THE INSIDE OFTHE FLUME TO BE PROVIDED BYFLUME MANUFACTURER.KEY NOTES:1. PROVIDE POLYMER CONCRETE PRECAST STRUCTURE.2. 12-IN DIAMETER STILLING WELL PER DETAIL A/D2 WITH 2-IN PVCPIPE CONNECTION TO FLUME CHANNEL. STILLING WELL COVERSHALL BE VINYLESTER GRATING GS-1 PER DETAIL A/D2.BUBBLER TUBE WILL BE PROVIDED BY OTHERS.3. PROVIDE 10-IN SCHEDULE 80 VENT, 316 SS PIPE CLAMPS AND316 SS HARDWARE FOR SUPPORTS. PROVIDE BLIND FLANGEAPPROXIMATELY 3" ABOVE GRADE.4. 1.5" THICK VINYLESTER GRATING GS-4 TYPE PER DETAIL B/D2AND C/D3. PROVIDE PANEL PIECES THAT HAVE SUFFICIENTSTIFFNESS TO MAINTAIN LOAD BEARING CAPACITY AND ALSOTHAT CAN BE DISASSEMBLED AND REMOVED THROUGH ACCESSPOINTS. SUBMIT SHOP DRAWING FOR VERIFICATION OFGRATING PIECE SIZE AND ORIENTATION. GRATING PANELWEIGHT SHALL NOT EXCEED 50 LBS EACH.5. PROVIDE 6-IN STANDARD SIZE FIBERGLASS PARSHALL FLUMEPER ASTM D1941.6. PARSHALL FLUME CURB ON BOTH SIDES OF THE CHANNEL PERDETAIL B/D2.7. PROVIDE 10-IN DIAMETER SCHEDULE 80 PVC PIPE PER DETAILA/D3. PROVIDE 316SS PIPE CLAMPS AND 316 SS HARDWARE FORSUPPORTS. PROVIDE CAP AT GRADE. VENT WILL BE USED FORCONNECTION TO PORTABLE VENTILATION FAN PROVIDED BYOTHERS. SEAL AT TOP SLAB PER DETAIL A/D3. PROVIDE NEENAH1910D FRAME AND COVER CAST INTO TOP SLAB.8. DESIGN AND LOCATE AND CONNECT END ADAPTOR RELATIVETO THE FLUME AS RECOMMENDED BY THE FLUMEMANUFACTURER TO ENSURE ACCURATE FLOW MEASUREMENT.PROVIDE FLEXIBLE SLEEVE COUPLINGS OR HOBAS FWCCOUPLING ASSEMBLY OR OTHER MEANS OF CONNECTION ASRECOMMENDED BY MANUFACTURER. SEAL PIPE AND ENDADAPTORS TO PROVIDE NO GAP AND A WATERTIGHTCONNECTION.9. THREE 2-IN PVC CONDUIT AT EL 982.00. EXTEND 12-IN OUTSIDEOF THE STRUCTURE AND CAP.10. FIBERGLASS TRANSITION SECTION. PROVIDED BY FLUME MFG.11. FLUME SILL INVERT TO BE SET TWO INCHES ABOVE INFLUENTPIPE'S INVERT. COORDINATE INVERT DIMENSION WITH DESIGNOF CUSTOM END ADAPTER PIECE TO PROVIDE GRADUALINCREASE TO FLUME.12. COORDINATE CONNECTOR AND SEAL WITH STRUCTUREFABRICATOR AND FLUME MANUFACTURER TO ENSURE AWATERTIGHT CONNECTION.13. 10'Ø PRECAST MANHOLE.14. 38-IN DIA MH COVER AND FRAME. COM3800 DUROSTREETCOMPOSITE MANHOLE ASSEMBLY. CAST INTO POLYMERCONCRETE TOP SLAB.15. ALUMINUM LADDER. SEE DETAIL B/D3. COAT AL SURFACES INCONTACT WITH CONCRETE WITH BITUMINOUS COATING.16. DBI SALA DAVIT BASE WITH CAP. CAST INTO TOP SLAB.17. 4-IN CONCRETE SLOPE FLOOR 1/4-IN / 1 FT TOWARDS CHANNELON BOTH SIDES OF FLUME WITH BROOM FINISH.18. NEENAH R-1733 MH COVER AND FRAME CAST INTO POLYMERCONCRETE TOP SLAB.19. MOUNT LIGHTING AT EL 960.83. LIGHTING SHALL BE LEDDIALIGHT LSC3C4M3GEX 4FT LED LINEAR FIXTURE SUITABLEWITH CL1 / DIV1 MOUNTING BRACKET. FIXTURE AND MINIMUM1,000. FIELD ROUTE CONDUIT AND AFFIX CONDUIT TO WALLWITH 316-SS HARDWARE. INSTALL LIGHTING SWITCH IN RTUPANEL.20. PROVIDE FLEXIBLE JOINTS AND LOCATE AS RECOMMENDED BYVAULT MANUFACTURER TO PROTECT PIPE FROM SETTLEMENTOF THE VAULT.1PLAN AT EL 952.831/2" = 1'-0"1-1-3'-0"2'-0"1'-0"2'-0"24" FRP27" FRPINV 949.541'-0"24" FRPINV 950.57EL 950.73EL 950.35EL 950.48FIBERGLASS FLUME11HAUNCH (TYPBOTH ENDS)1:127" FRPFLOWFLOWFLOW6"1'-3 5/8"1'-3 1/2"712'-0"1'-0"2'-0"2'-0"TOCONC EL 983.62371045112-3"℄ OF MH1212215131312122-SECTION1/2" = 1'-0"2-141515CONCRETE BASE12" PVC STILLINGWELL (BY FLUME MFR)2" PVC500 PSI MINCLSM GROUT3337161492PLAN AT EL 983.621/2" = 1'-0"TOCONC EL 983.62TOCONC EL 952.83TOCONC EL 952.83POLYMERCONC (TYP)91-1-2-2-17MIN 1'-0" COMPACTED AGGREGATEBEDDING MNDOT SPEC 3149.2HMODIFIED. NATIVE SOILS COMPACTTO 98% MIN PROCTORMIN 1'-0" COMPACTED AGGREGATEBEDDING MNDOT SPEC 3149.2HMODIFIED. NATIVE SOILS COMPACTTO 98% MIN PROCTOR181819202088NOTCH (RECESS)2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 141 of 445 A-PARSHALL FLUME STILLING WELL / BUBBLER TUBE NO SCALE12" Ø PVC STILLING12" Ø PVC STILLING WELLCONCRETE BASEWELL (BY FLUME MFR)FLOWABLE FILL ALLVOID AREASFLUME LINER2" ID PVC PIPE, NPTCONCRETE BASE12" x 12" MINEL XXX.952.83 MINUS GRATING THICKNESSB-PARSHALL FLUME CURBNO SCALE1/4" EXPANSION JOINT8" CONCRETE WALLCAP4"4"6" FIBERGLASSPARSHALL FLUMED-WATERTIGHT PIPE CONNECTIONSNO SCALEPOSITIVE MECHANICAL SEAL(KOR-N-SEAL OR EQUAL)CLAMP WITH DRAW BOLTSAND NUTSSTAINLESS STEEL EXTERNALTYPE BSTAINLESS STEEL EXTERNALCLAMP WITH DRAW BOLTSAND NUTSINTEGRALLY CASTSLEEVE SEALTYPE A4" POLYMERCONCRETE CAP4" POLYMERCONCRETE CAPFRP GRATING PER DETAILC/D2 AND KEY NOTE 4/D14" POLYMERCONCRETE CAP SLABFLOWABLEFILL OR SAND4" POLYMERCONCRETE CAPFLOWABLE FILL(MINIMUM 500 PSI)NOTES:1. EXTEND GRATING CONTINUOUSLY OVERGATE GUIDES AND GATES.2. NOTCH GRATING SUPPORTS AT GATES ASREQUIRED.3. GRATING SPAN SEE PLAN.4. MATERIAL FOR SUPPORTS OF STEEL ANDALUMINUM GRATING TO BE SAME ASGRATING, EXCEPT METAL SUPPORTSTHAT ARE TO BE EMBEDDED INCONCRETE SHALL BE TYPE 316 STAINLESSSTEEL.5. PROVIDE MISCELLANEOUS GRATINGFASTENERS AS REQUIRED.6. BAND ALL EDGES AND OPENINGSGREATER THAN 4" WITH 3/16 x DEPTH OFBEARING BAR.7. THE HORIZONTAL CLEARANCE BETWEENTHE GRATING AND GRATING SUPPORTSSHALL NOT BE LESS THAN 1/4" NORGREATER THAN 1/2" AND AS SPECIFIED.8. TOP OF GRATING TO BE FLUSH WITHADJACENT FLOOR.9. ALL SAW CUT SURFACES MUST BEPROTECTED WITH CORROSIONRESISTANT COATING OR PANELING10. PROVIDE HINGES ON GRATINGS FOR THEFOLLOWING APPLICATIONS:- STILLING WELL- SUMP PITGS-3GS-2GS-15/8"x6" STAINLESSSTEEL ANCHOR BOLTS@ 1'-6" CENTERSL3 x 3 x 1/4 LLV,316 STAINLESS STEEL;USE ONLY FOR FOOTTRAFFIC GRATINGMINIMUM BEARINGDIMENSION, SEE ABOVE1/4" BAR WELD TOSUPPORT BEAM. OMITWHERE GRATING ISCONTINUOUS OVERSUPPORT BEAMMINIMUM BEARINGDIMENSION, SEE ABOVESUPPORT BEAM,FOR SIZE AND ENDCONDITIONS, SEE PLANBANDING BARTRIM 1/4" THICKVERTICAL LEG ASREQUIRED FORGRATING THICKNESS3/8"x6" ANCHORS@ 1'-6" CENTERSBEARING BAR1/4" PLATE WELDEDAT OPEN ENDEDSUPPORTS (TYP)MINIMUM BEARINGHORIZONTAL DIMENSION= 1" FOR GRATING DEPTH2 1/4" OR LESS= 2" FOR GRATING DEPTHGREATER THAN 2 1/4"GREATERTHICKNESSSUPPORTS, TYP.CONCRETE WALLFIBERGLASS GRATINGOVER CHANNELTOP OF VAULTFLOOR1-1/2"2"FRP CONCRETEEMBEDMENT ANGLECLEAN FIBERGLASS EDGEGS-4HINGED GRATINGC-GRATING SUPPORTNO SCALE11 12C:\PW_PL1\CLAYTONDD\D4323573\D002.DWGNONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 142 of 445 A-VENT PIPE SECTION-PVC VENT TYPE SECTION DETAILNO SCALEB-ALUMINUM ACCESS LADDERNO SCALE7" MINSTANDOFF UNO0'-6" MAXPER CODE REQUIREMENTS4' MAX12"9"UNO18"12"MAX18"12"12"6"ALUMINUM STATIC GRAB BARALUMINUM ACCESS LADDERNOTE:1. CONTRACTOR SHALL VERIFY DIMENSION AGAINST SITE ANDMANUFACTURER REQUIREMENTS3" MINPROVIDE NEENAH 1910D COVERAND FRAME WITH SOLID LID.FRAME TO BE CAST INTOPOLYMER CONCRETE TOP SLABPROVIDE PRECASTREINFORCEDCONCRETE SLABPROVIDE 10" PVCVENT PIPEVENT PIPE MUST BECENTERED AND HAVE A 3"CLEARANCE ON ALL SIDES81256573345KEY NOTES:1. 1/2' X 3" SOLID FLAT BAR ALUMINUM RAILS.2. 1/2" DIA MOUNTING HOLES.3. SOLID EXTRUDED ALUMINUM RUNGS 1-1/8" DIAM, STRIATED.4. ALUM MOUNTING BRACKET.5. 1/2" DIA X 4" LONG SST EXP ANCHOR BOLT.6. WALL MOUNTING BRACKET: 4" X 8" X 3/8" ALUM ANGLE - 6" LONG.7. FLOOR MOUNTING BRACKET: 4" X 4" X 1/2" ALUM ANGLE - 2-3/4"LONG.12 12C:\PW_PL1\CLAYTONDD\D4323573\D003.DWGNONPUBLIC DATA652 Bielenberg Drive, Suite 203Woodbury, MN 55125Tel: (651) 252-3800CDMSmith.com2025-07-09&RXQFLO1R,([KLELW'3DJHRIPage 143 of 445 0HWURSROLWDQ&RXQFLO (QYLURQPHQWDO6HUYLFHV .HQQHEHF'ULYH (DJDQ01 /DNHYLOOH)DUPLQJWRQ0 0&(6352-(&7180%(5 92/80(2) 7(&+1,&$/63(&,),&$7,216$1'$33(1',&(6 2FWREHU &RXQFLO1R,([KLELW'3DJHRI Page 144 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &HUWLILFDWLRQV3DJH  '2&80(17 &(57,),&$7,2163$*( ,KHUHE\FHUWLI\WKDWWKLVSODQVSHFLILFDWLRQRUUHSRUWZDVSUHSDUHGE\PHRUXQGHUP\GLUHFW VXSHUYLVLRQDQGWKDW,DPDGXO\5HJLVWHUHG3URIHVVLRQDO(QJLQHHURUGXO\5HJLVWHUHG$UFKLWHFWXQGHU WKHODZVRIWKH6WDWHRI0LQQHVRWD BBBBBBBBBBBBBBBBBBBBBBBBBB 'DQ&KRXLQDUG3( 015HJLVWUDWLRQ1XPEHU 'DWH 5HVSRQVLEOHIRU'LYLVLRQ BBBBBBBBBBBBBBBBBBBBBBBBBB 'RXJ-HUPDLQ<RXQJEORRG3( 015HJLVWUDWLRQ1XPEHU 'DWH7 5HVSRQVLEOHIRU'LYLVLRQDQG 'LYLVLRQ 07/10/25 /0/25 BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB &K L G 3 ( &RXQFLO1R,([KLELW'3DJHRI Page 145 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 7DEOHRI&RQWHQWV  '2&80(17 7$%/(2)&217(176 92/80( 3$57,±%,'',1*$1'&2175$&75(48,5(0(176 ',9,6,21±%,'',1*$1'&2175$&75(48,5(0(176  &HUWLILFDWLRQV3DJH  7DEOHRI&RQWHQWV  /LVWRI'UDZLQJV 3$57,,7(&+1,&$/63(&,),&$7,216 ',9,6,21±*(1(5$/5(48,5(0(176  6XPPDU\RI:RUN  0HDVXUHPHQWDQG3D\PHQW  6XEPLWWDOV  &RQVWUXFWLRQ6FKHGXOH ',9,6,21±6,7(:25.  ([FDYDWLRQ  )LOODQG%DFNILOO  *UDYLW\6HZHU0DQKROHV  &&79,QVSHFWLRQRI*UDYLW\6HZHUV ',9,6,21±&21&5(7( 12786('  ',9,6,21±0$6215< 12786('  ',9,6,21±0(7$/6 12786('  ',9,6,21±:22'$1'3/$67,&6 12786('  ',9,6,21±7+(50$/$1'02,6785(3527(&7,216 12786('  ',9,6,21±'2256$1':,1'2:6 12786('  ',9,6,21±),1,6+(6 ',9,6,21±63(&,$/7,(6 12786('  ',9,6,21±(48,30(17 12786('  &RXQFLO1R,([KLELW'3DJHRI Page 146 of 445 0+6LSKRQ5HKDELOLWDWLRQ 0HWURSROLWDQ&RXQFLO (QYLURQPHQWDO6HUYLFHV 7DEOHRI&RQWHQWV  ',9,6,21±)851,6+,1*6 12786('  ',9,6,21±63(&,$/&216758&7,21 12786('  ',9,6,21±&219(<,1*6<67(06 12786('  ',9,6,21±0(&+$1,&$/  3DUVKDOO)OXPH)ORZPHWHUV ',9,6,21±(/(&75,&$/ 12786('  $33(1',; $'',7,21$/,1)250$7,21  $SSHQGL[$±6RLO%RULQJ  $SSHQGL[%±5HFRUG'UDZLQJV 92/80( '5$:,1*6  /DNHYLOOH)DUPLQJWRQ0 (1'2)'2&80(17 &RXQFLO1R,([KLELW'3DJHRI Page 147 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV /LVWRI'UDZLQJV  6(&7,21 /,672)'5$:,1*6 1R7LWOH ϭd/d>W' Ϯ'EZ>EKd^EZs/d/KE^ ϯ'EZ>>'E ϰ'EZ>Zs/d/KE^ ϱ/s/>>'E ϲW>EEWZK&/> ϳd/>^ ϴd/>^ ϵd/>^ ϭϬW>EE^d/KE ϭϭd/>^ ϭϮd/>^ &RXQFLO1R,([KLELW'3DJHRI Page 148 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 6800$5<2):25. 6(&7,216800$5<2):25. 3$57*(1(5$/ 6(&7,21,1&/8'(6 $ /RFDWLRQRI:RUN % %DVLFGHVFULSWLRQRIWKH:RUN & 5HODWHGZRUNDWVLWHE\RWKHUVDQG&281&,/ ' &281&,/IXUQLVKHGJRRGV ( 6HTXHQFLQJDQGVFKHGXOLQJUHTXLUHPHQWV ) &2175$&725XVHRIWKHVLWH /2&$7,212):25. $ 7KH:RUNRIWKLV&RQWUDFWLVORFDWHGDWWKHIROORZLQJORFDWLRQV  /DNHYLOOH)DUPLQJWRQ0ORFDWHGQHDUWKHLQWHUVHFWLRQRIWK6WUHHW:HVWDQG&HGDU $YHQXHLQ/DNHYLOOH01  7KHSURMHFWDUHDLVORFDWHGZLWKLQDUHVLGHQWLDOGHYHORSPHQWE\/HQQDU % 7KLVZRUNLVORFDWHGZLWKLQSXEOLFSURSHUW\SXEOLFULJKWRIZD\WHPSRUDU\DQGXWLOLW\ HDVHPHQWV :25.'(6&5,37,21 $ 7KH:RUNGHVFULEHGLQWKLVVHFWLRQSURYLGHVDJHQHUDOGHVFULSWLRQRIWKHPDMRUZRUNDQGGRHV QRWLQFOXGHDOOZRUNWREHSHUIRUPHGE\WKH&2175$&725  7HPSRUDU\FRQYH\DQFHRIUHVLGHQWLDOVDQLWDU\VHZDJH  'HPROLWLRQRIH[LVWLQJPDQKROHVDQGSLSHV  &RQVWUXFWLRQRIDQHZVDQLWDU\VHZHUPDQKROHXSVWUHDPRIWKHPHWHULQJVWDWLRQ  &RQVWUXFWLRQRIDQHZPHWHULQJPDQKROH07KLVFRQVWUXFWLRQLQFOXGHVDSRO\PHU FRQFUHWHVWUXFWXUHSDUVKDOOIOXPHDQGDSSXUWHQDQFHVZLWKLQJWKLVPHWHULQJVWDWLRQ  &RQVWUXFWLRQRIDQHZ578SDGDQGFRQQHFWLRQWRHOHFWULFDOVHUYLFH  5DLVLQJDQH[LVWLQJPDQKROHWRJUDGH  &RQVWUXFWLRQRIDQHZDFFHVVGULYHZD\DQGEROODUGV  6LWHJUDGLQJDQGUHVWRUDWLRQFRQVLVWHQWZLWKWKH/HQQDUGHYHORSPHQWSODQ % ,IWKHUHLVDFRQWUDGLFWLRQEHWZHHQ0&(6VSHFLILFDWLRQVDQGSODQVWKHSODQVVKDOOWDNH SUHFHGHQFH,I0&(6FRQVWUXFWLRQGRFXPHQWVGRQRWFRYHUDQLWHPRIZRUNWKH&LW\¶V VSHFLILFDWLRQVVKDOOEHIROORZHG &RXQFLO1R,([KLELW'3DJHRI Page 149 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 6800$5<2):25. 5(/$7(':25.$76,7(%<27+(56 $ /HQQDUZLOOEHFRQVWUXFWLQJDUHVLGHQWLDOGHYHORSPHQWLQDQGDURXQGWKHPHWHULQJVWDWLRQVLWH &RRUGLQDWHDOOZRUNZLWKWKHRYHUDOOZRUNSODQE\/HQQDU 5(/$7(':25.$76,7(%<&281&,/ $ &281&,/GRHVQRWDQWLFLSDWHSHUIRUPLQJDQ\FRQVWUXFWLRQZRUNLQWKHSURMHFWDUHDFRQFXUUHQW ZLWKWKH:RUNRIWKLV&RQWUDFW % &281&,/VWDIIRSHUDWHVDQGPDLQWDLQVIDFLOLWLHVWKDWDUHFXUUHQWO\DQGFRQWLQXRXVO\UHFHLYLQJ SXPSLQJDQGWUHDWLQJZDVWHZDWHU & 2WKHU&281&,/ZRUNPD\EHSHUIRUPHGWKDWUHTXLUHVWKHFRRUGLQDWLRQE\DQGFRRSHUDWLRQRI WKH&2175$&725LQRUGHUWRPLQLPL]HXQSODQQHGGHOD\VRULQWHUUXSWLRQVWR&281&,/ZRUN RURSHUDWLRQV ' &281&,/ZLOOGRWKHIROORZLQJRSHUDWLRQVFRQFXUUHQWZLWKWKH:RUNRIWKLV&RQWUDFW  3URYLGHDQ578FDELQHWHOHFWULFPHWHUDQGVDIHW\VZLWFKWRFRQQHFWWRWKHHOHFWULFDO VHUYLFH  &RQWLQXRXVRSHUDWLRQDQGPDLQWHQDQFHRIH[LVWLQJIDFLOLWLHVQRWPDGHDYDLODEOHWRWKH &2175$&725IRUSXUSRVHVRIH[HFXWLQJWKH:RUN  1RWLILFDWLRQ D &2175$&725PXVWSURYLGHDPLQLPXPRIIRXUWHHQ  GD\VDGYDQFHQRWLFHWRWKH &$5DQGKRXUDGYDQFHFRQILUPDWLRQWRWKH&$5UHTXHVWLQJDQ\&281&,/ VHUYLFHV&2175$&725¶6UHTXHVWPXVWVSHFLILFDOO\LGHQWLI\WKHXQLWDQGV\VWHP DIIHFWHGEXWPXVWEHVXEMHFWWRWKHRSHUDWLRQDODYDLODELOLW\RIEDFNXSWDQNVDQG V\VWHPVIRUWKHDIIHFWHGSURFHVV E 2WKHUFRQVWUDLQWVRUVHTXHQFLQJUHTXLUHPHQWVPD\DIIHFWQRWLILFDWLRQUHTXLUHPHQWV  &2175$&725PXVWEHUHVSRQVLEOHIRUDOORWKHUUHPRYDODQGIOXVKLQJDFWLYLWLHVUHTXLUHG WRFRPSOHWHWKHZRUNDVIROORZV D )XUQLVKZDWHUIRUIOXVKGRZQDQGFOHDQLQJ+DXOZDWHUIURPRIIVLWHLIQHFHVVDU\ E ,IUHVLGXHVIURPIOXVKGRZQDUHOLPLWHGWRVHZDJHUHODWHGZDVWHPDWHULDOV ZDWHUJULW VOXGJH WKHQGUDLQDJHPD\EHWKURXJKH[LVWLQJ&281&,/IDFLOLWLHV F ,IUHVLGXHVRWKHUWKDQWKRVHSUHYLRXVO\PHQWLRQHGDUHSUHVHQWLQFOXGLQJWKRVH UHVLGXHVLQFRUSRUDWHGE\FRQVWUXFWLRQUHODWHGDFWLYLWLHVWKHQ&2175$&725PXVW GLVSRVHRIWKHPRIIVLWHLQDODZIXOPDQQHU ( 6ZLWFKLQJDQG'HHQHUJL]DWLRQRI(OHFWULFDO(TXLSPHQW  7KH&2175$&725PXVWSHUIRUPGHHQHUJL]DWLRQRIDOOHOHFWULFDOHTXLSPHQWDVUHTXLUHG IRUWKHSXUSRVHVRIFRPSOHWLQJWKLVZRUNZLWKWKHIROORZLQJH[FHSWLRQV  6ZLWFKLQJDQGGHHQHUJL]DWLRQRIHTXLSPHQWIHHGHUDQGEUDQFKFLUFXLWVEHORZ9DQG QRWSDUWRIWKHPDLQGLVWULEXWLRQV\VWHPRUSURFHVVHTXLSPHQWPXVWEHSHUIRUPHGE\WKH &2175$&725XSRQUHFHLYLQJDXWKRUL]DWLRQE\WKH&$5 &RXQFLO1R,([KLELW'3DJHRI Page 150 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 6800$5<2):25.  6ZLWFKLQJDQGGHHQHUJL]DWLRQRISURFHVVHOHFWULFDOHTXLSPHQWEHORZ9PXVWEH SHUIRUPHGE\&281&,/¶V2SHUDWLRQVVWDII  7KHUHPDLQGHURIDOOVZLWFKLQJDQGGHHQHUJL]DWLRQPXVWEHSHUIRUPHGE\&281&,/¶V HOHFWULFDOPDLQWHQDQFHVWDII &281&,/)851,6+('*22'6 $ 1R&281&,/IXUQLVKHGJRRGVDUHLQFOXGHGLQWKLV&RQWUDFW :25.6(48(1&( $ 7KHH[LVWLQJIDFLOLWLHVDUHFXUUHQWO\DQGFRQWLQXRXVO\UHFHLYLQJSXPSLQJDQGWUHDWLQJ ZDVWHZDWHUDQGWKRVHIXQFWLRQVPXVWQRWEHLQWHUUXSWHGH[FHSWDVVSHFLILHGKHUHLQDQGZLWK 0&(6DSSURYHG2SHUDWLRQ,PSDFW1RWLFH 2,1 SHU6HFWLRQ&2175$&725PXVW FRRUGLQDWHWKHZRUNZLWKWKH&$5WRDYRLGDQ\LQWHUIHUHQFHZLWKQRUPDORSHUDWLRQRIVHZHU HTXLSPHQWDQGSURFHVVHV % 7KH&2175$&725PXVWFRRUGLQDWHWKHZRUNZLWKWKH&$5WRPLQLPL]HLQWHUIHUHQFHZLWK QRUPDORSHUDWLRQVRI&281&,/IDFLOLWLHVDQGSURFHVVHVZKLFKSURYLGHIRUFRQWLQXRXVO\ UHFHLYLQJSXPSLQJDQGWUHDWLQJZDVWHZDWHU & &2175$&725PXVWSODQRUJDQL]HDQGGHWHUPLQHWKHVHTXHQFLQJRIWKHLUZRUNVXEMHFWWR WKHIROORZLQJFRQVWUDLQWV  &RRUGLQDWHWHPSRUDU\FRQYH\DQFHRIWKHXSVWUHDPVHZHUVZLWKWKH&LW\RI/DNHYLOOHDQG /HQQDU  &RRUGLQDWHVLWHZRUNURDGFRQVWUXFWLRQJUDGLQJDQGUHVWRUDWLRQZLWK/HQQDU  &RRUGLQDWHDGMDFHQWXWLOLW\ZRUNZLWK/HQQDU &2175$&72586(2)6,7($1'35(0,6(6 $ &RRSHUDWHIXOO\ZLWK&281&,/ VSHUVRQQHOIRUH[LVWLQJIDFLOLWLHV&281&,/PD\UHVWULFWWKH WLPHDQGGXUDWLRQRIE\SDVVLQJGLYHUVLRQVVKXWGRZQVDQGRWKHUGLVUXSWLRQVWRIDFLOLW\ RSHUDWLRQV  3UHSDUHDFRQVWUXFWLRQSODQDQGVFKHGXOHLGHQWLI\LQJH[LVWLQJIDFLOLW\FRQVWUDLQWVDQG VXEPLWWRWKH&$5LQDFFRUGDQFHZLWK6HFWLRQVXEPLWWDOV  1RWLI\&$5RIZRUNDIIHFWLQJH[LVWLQJIDFLOLWLHVSULRUWRLWVVWDUW&KDQJHVLQSODQDQG VFKHGXOHPXVWEHVXEPLWWHGWR&$5ZLWKLQGD\VRIQHHGLQJIDFLOLWLHV'RQRWEHJLQWKLV ZRUNZLWKRXW&$5 VDXWKRUL]DWLRQ % &RQILQHZRUNWRUHPDLQZLWKLQWKH&RQVWUXFWLRQ/LPLWVVKRZQRQWKH'UDZLQJV,IRWKHU DGGLWLRQDOVSDFHLVQHHGHGIRUFRQWUDFWRUVWDJLQJRURWKHULWHPVREWDLQDQGSD\IRUVXFK VSDFHRIIVLWH & 3URYLGHDOWHUQDWLYHVRXUFHRISRZHUDVUHTXLUHG ' '2127SHUPLWFRQVWUXFWLRQHPSOR\HHVWRUHVLGHDWWKH3URMHFWVLWH ( /HQQDUDQG&281&,/ZLOOLGHQWLI\SDUNLQJDUHDVDYDLODEOHWR&2175$&725SHUVRQQHO 3$57352'8&76 12786(' &RXQFLO1R,([KLELW'3DJHRI Page 151 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 6800$5<2):25. 3$57(;(&87,21 12786(' (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 152 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 0($685(0(17$1'3$<0(17 6(&7,210($685(0(17$1'3$<0(17 3$57*(1(5$/ 6(&7,21,1&/8'(6 $ 'HVFULSWLRQRISURFHGXUDOUHTXLUHPHQWVIRU$OORZDQFHV % 0HDVXUHPHQWFULWHULDDSSOLFDEOHWRSRUWLRQVRIWKH:RUNSHUIRUPHGXQGHUDXQLWSULFHSODQQHG TXDQWLWLHVDQGRUOXPSVXPSD\PHQWPHWKRG & 'HVFULSWLRQVRIELGLWHPVWKHLUPHDVXUHPHQWDQGSD\PHQWLQIRUPDWLRQ &2175$&7255(63216,%,/,7,(6 $ &2175$&725PXVWSURYLGHQHFHVVDU\HTXLSPHQWZRUNHUVDQGVXUYH\SHUVRQQHODV UHTXLUHGE\WKH&$5WRPHDVXUHTXDQWLWLHV $//2:$1&(6 $ 'HILQLWLRQV  5HLPEXUVHPHQW$OORZDQFHV5HLPEXUVHPHQWVRILQYRLFHDPRXQWVSDLGE\WKH &2175$&725WRWKLUGSDUWLHVIRUDXWKRUL]HGDOORZDQFHZRUN1R&2175$&725 PDUNXSVZLOOEHDSSOLHGWRWKHVHFRVWV  7LPHDQG0DWHULDO$OORZDQFHV0HDVXUHPHQWZLOOEHGHWHUPLQHGIURPGDLO\VXEPLWWDOV GRFXPHQWLQJWKHGLUHFWFRVWVRIODERUPDWHULDODQGHTXLSPHQWUHTXLUHGIRUFRPSOHWLRQRI DXWKRUL]HGZRUN3D\PHQWRIWKHGLUHFWFRVWVDSSURYHGIURPGDLO\FRVWVXEPLWWDOVZLOO FRQVWLWXWHIXOOFRPSHQVDWLRQIRUGLUHFWFRVWVRIDXWKRUL]HGWLPHDQGPDWHULDODOORZDQFH ZRUN'LUHFWFRVWVRYHUKHDGDQGSURILWIHHPXVWEHLQDFFRUGDQFHZLWKWKH*HQHUDO &RQGLWLRQV % $OORZDQFH$GPLQLVWUDWLRQ  $OORZDQFHVKDYHEHHQLQFOXGHGRQWKH%LG)RUPWRSURYLGHIXQGVIRUZRUNZKLFKFDQQRW EHLGHQWLILHGLQVXIILFLHQWGHWDLOWREHELG$OORZDQFHVDUHFRVWHVWLPDWHVWREHXVHGIRU ELGGLQJSXUSRVHVRQO\DQGDUHVXEMHFWWRWKHIROORZLQJ D 0HDVXUHPHQWDQGSD\PHQWRIWKHZRUNDQGFRVWVIRUHDFKDOORZDQFHPXVWEH FRQVLVWHQWZLWKWKLV6HFWLRQ E $WFORVHRXWRIFRQWUDFWDOORZDQFHIXQGVQRWDXWKRUL]HGIRUSD\PHQWZLOOEHFUHGLWHGWR WKH&281&,/  1R&2175$&725PDUNXSVZLOOEHDSSOLHGWR5HLPEXUVHPHQWDOORZDQFHV /803680$1'81,735,&(%,',7(06 $ 3D\PHQWIRUDOOOXPSVXPDQGXQLWSULFHLWHPVPXVWEHDWWKHSULFHVOLVWHGLQWKH%LG)RUPDQG PXVWFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOHTXLSPHQWODERULQVWDOODWLRQPDWHULDOVSURMHFW PDQDJHPHQWDQGWKH&2175$&725¶6RYHUKHDGDQGSURILWWRFRPSOHWHWKH:RUN &RPSHQVDWLRQLVIRUDOOULVNORVVGDPDJHDQGDOOH[SHQVHUHVXOWLQJIURPFRPSOHWLQJWKH :RUN$OOZRUNVKRZQRUVSHFLILHGEXWQRWLQFOXGHGLQWKH0HDVXUHPHQWDQG3D\PHQWLWHP &RXQFLO1R,([KLELW'3DJHRI Page 153 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 0($685(0(17$1'3$<0(17 GHVFULSWLRQVPXVWEHFRQVLGHUHGLQFLGHQWDOWRWKH:RUNDQGQRVHSDUDWHSD\PHQWPXVWEH PDGHIRUWKDWZRUN % 7KHWHUP³FRPSOHWHLQSODFH´ZKHQXVHGLQWKHVHSD\PHQWSURYLVLRQVPHDQVFRPSOHWLRQRI WKH&RQWUDFWLWHPRUXQLWVLQDFFRUGDQFHZLWKDOOLQGLFDWHGDQGVSHFLILHGUHTXLUHPHQWVDQG UHDG\IRUXVH & 3URJUHVVSD\PHQWVZLOOEHEDVHGRQWKH&$5¶VREVHUYDWLRQVDQGHYDOXDWLRQVRITXDQWLWLHV LQFRUSRUDWHGLQWKH:RUNPXOWLSOLHGE\WKHXQLWSULFHZLWKDQDGMXVWPHQWIRUSHUFHQWDJHRI ZRUNFRPSOHWHG ' )LQDOSD\PHQWIRU:RUNJRYHUQHGE\XQLWSULFHVZLOOEHPDGHRQWKHEDVLVRIWKHDFWXDO PHDVXUHPHQWVDQGTXDQWLWLHVGHWHUPLQHGE\&$5PXOWLSOLHGE\WKHXQLWSULFHIRU:RUNZKLFK LVLQFRUSRUDWHGLQRUPDGHQHFHVVDU\E\WKH:RUN 0($685(0(172)48$17,7,(6 $ 7KH&$5PXVWGHWHUPLQHTXDQWLWLHVE\WKHV\VWHPRIZHLJKWVDQGPHDVXUHVLQFXVWRPDU\ XVH$GGLWLRQDOPHDVXUHPHQWUHTXLUHPHQWVLIDQ\DUHIXUWKHUGHVFULEHGLQHDFKLWHP GHVFULSWLRQ % 0HDVXUHPHQWE\:HLJKW:HLJKWPHDVXUHPHQWVPXVWEHPDGHRQFDOLEUDWHGVFDOHVXQOHVV RWKHUZLVHGHVFULEHGLQWKHPHDVXUHPHQWVHFWLRQRIWKDWLWHP)XUQLVKLQJPDLQWDLQLQJDQG XVLQJVFDOHVLVLQFLGHQWDOWRWKHZRUN8VHVFDOHVWKDWKDYHDQXQH[SLUHGFHUWLILFDWLRQE\D WHVWLQJILUPRUDJHQF\WKDWYHULILHVWKHDFFXUDF\RIWKHVFDOHV9HKLFOHWDUHZHLJKWVPXVWEH PHDVXUHGGRFXPHQWHGWRWKH&$5DQGVXEWUDFWHGIURPVFDOHUHDGLQJV & 0HDVXUHPHQWE\9ROXPH9ROXPH0HDVXUHPHQWPXVWEHPDGHE\GLUHFWPHDVXUHPHQWRI DUHDWLPHVWKHDYHUDJHGHSWKXQOHVVRWKHUZLVHGHVFULEHGLQWKHPHDVXUHPHQWVHFWLRQRIWKDW LWHP ' 0HDVXUHPHQWE\$UHD$UHDPXVWEHPHDVXUHGE\XVLQJPHDQOHQJWKDQGZLGWKRUUDGLXV ZLWKLQFRQWUDFWGHVLJQDWHGOLPLWVXQOHVVRWKHUZLVHGHVFULEHGLQWKHPHDVXUHPHQWVHFWLRQRI WKDWLWHP1RSD\PHQWZLOOEHPDGHRXWVLGHRIWKHFRQWUDFWGHVLJQDWHGOLPLWVXQOHVVGLUHFWHG LQZULWLQJE\WKH&$5 ( /LQHDU0HDVXUHPHQW/LQHDUPHDVXUHPHQWPXVWEHPHDVXUHGDWWKHLWHPFHQWHUOLQHRU SDUDOOHOWRDQGDORQJWKHIRXQGDWLRQ ) 3ODQ4XDQWLW\3ODQTXDQWLWLHVOLVWHGRQWKH%LG)RUPZLWKD³ 3 ´PXVWQRWEHPHDVXUHG 7KHVXPRISD\PHQWVIRUSODQTXDQWLWLHVPXVWQRWH[FHHGWKH([WHQGHG$PRXQW 68%0,77$/6 $ $OORZDQFHV  6XEPLWGRFXPHQWDWLRQRIGLUHFWFRVWVIRUWLPHDQGDOORZDQFHZRUNWRWKH&$5RQDGDLO\ EDVLV  6XEPLWWKHIROORZLQJLWHPVWR&$5ZLWKDSSOLFDWLRQVIRUSD\PHQWIRUUHLPEXUVHPHQW DOORZDQFHFKDUJHV D 5HFHLSWIRUDFWXDOFKDUJHVSDLG E 'HWDLOHGH[SODQDWLRQRIWKHFKDUJHV &RXQFLO1R,([KLELW'3DJHRI Page 154 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 0($685(0(17$1'3$<0(17 F &RSLHVRI&2175$&725¶VFRUUHVSRQGHQFHUHODWLQJWRUHLPEXUVHPHQWDOORZDQFH FKDUJHV G &RSLHVRIKDXORUORDGWLFNHWVRURWKHUGRFXPHQWDWLRQUHTXLUHGWRVXSSRUWWKH DSSOLFDWLRQ 3$57352'8&76  12786(' 3$57(;(&87,21 '(6&5,37,212)0($685(0(17$1'3$<0(17,7(06 $ %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³0RELOL]DWLRQ´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNDQGFRVWVRISUHSDUDWRU\ZRUN ERQGVLQVXUDQFHWHPSRUDU\IDFLOLWLHVDQGPRYHPHQWRISHUVRQQHOHTXLSPHQWVXSSOLHV WRWKH3URMHFWVLWHLQFLGHQWDOVHVWDEOLVKPHQWRI&2175$&725RIILFHVDQGRWKHU IDFLOLWLHVQHFHVVDU\IRUWKH:25.DQGDOOFRVWVDVVRFLDWHGZLWKFRPSOHWLQJWKH:25. WKDWDUHQRWLQFOXGHGLQRWKHUELGLWHPV D 3D\PHQWXSWRSHUFHQWRIWKH727$/%,'ZLOOEHPDGHLQWKHILUVWSD\PHQW E 3D\PHQWIRU0RELOL]DWLRQFKDUJHVLQH[FHVVRISHUFHQWRIWKH727$/%,'ZLOOEH PDGHZLWKWKH),1$/3$<0(17 % %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³'HZDWHULQJ´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNDQGFRVWVIRUODERUPDWHULDOV HTXLSPHQWDQGDOOHOVHQHFHVVDU\IRUJURXQGZDWHUGHZDWHULQJWRIDFLOLWDWHFRQVWUXFWLRQ 3DUWLDOSD\PHQWIRUGHZDWHULQJZRUNZLOOEHEDVHGRQDQDJUHHGXSRQSHUFHQWDJHRI:RUN FRPSOHWHGSULRUWRVXEPLWWDORI$SSOLFDWLRQIRU3D\PHQW & %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³7HPSRUDU\&RQYH\DQFH´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNDQGFRVWVIRUWHPSRUDU\FRQYH\DQFH LQFOXGLQJSOXJJLQJRIVHZHUVSXPSLQJFRQYH\DQFHSLSLQJGLVFKDUJHLQWRGRZQVWUHDP PDQKROHRGRUFRQWURODQGSXPSPRQLWRULQJZDWFK ' %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³%ROODUGV´  0HDVXUHPHQWZLOOEH(DFK  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNDQGFRVWVIRUODERUPDWHULDOV HTXLSPHQWDQGDOOHOVHQHFHVVDU\WRFRPSOHWHLQSODFHDVVSHFLILHGIRU%ROODUGV ( %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³%LWXPLQRXV3DYHPHQW´  0HDVXUHPHQWZLOOEHE\WKH6TXDUH<DUGUHJDUGOHVVRIWKLFNQHVV &RXQFLO1R,([KLELW'3DJHRI Page 155 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 0($685(0(17$1'3$<0(17  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNQHFHVVDU\WRFRPSOHWHWKH%LG,WHP LQIXOOLQFOXGLQJJUDGLQJVXEJUDGHSUHSDUDWLRQSDYHPHQWFRQVWUXFWLRQDQGFXUEDSURQ FRQVWUXFWLRQ  %LWXPLQRXVSDYHPHQWUHPRYDODQGUHSODFHPHQWIRUWHPSRUDU\FRQYH\DQFHPXVWEH LQFLGHQWDOWR%LG,WHP³7HPSRUDU\&RQYH\DQFH´ ) %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³([FDYDWLRQ´  0HDVXUHPHQWZLOOEHE\&XELF<DUGVRIPDWHULDOH[FDYDWHG  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNDQGFRVWVIRUH[FDYDWLRQLQFOXGLQJ ODERUPDWHULDOVHTXLSPHQWDQGDOOHOVHQHFHVVDU\WRFRPSOHWHDVVSHFLILHGIRU H[FDYDWLRQ * %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³6KHHWLQJDQG6KRULQJ´  0HDVXUHPHQWZLOOEHE\6TXDUH)HHWIRUHDFKW\SHRIVKHHWLQJDQGRUVKRULQJLQVWDOOHG  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNDQGFRVWVQHFHVVDU\WRSURYLGH LQVWDOODQGUHPRYHVKHHWLQJDQGVKRULQJV\VWHPVUHTXLUHGWRFRPSOHWHWKHZRUN + %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³LQ&&)53LSH´  0HDVXUHPHQWZLOOEH/LQHDU)RRWIRUHDFKW\SHVL]HDQGFODVVRISLSHLQVWDOOHG  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUIXUQLVKLQJDQGLQVWDOOLQJFRPSOHWHLQSODFHDV VSHFLILHG3D\PHQWVKDOOLQFOXGHILWWLQJVFRQQHFWLRQVWRVWUXFWXUHVSLSHEHGGLQJDQG IOH[LEOHMRLQWV , %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³LQ&&)53LSH´  0HDVXUHPHQWZLOOEH/LQHDU)RRWIRUHDFKW\SHVL]HDQGFODVVRISLSHLQVWDOOHG  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUIXUQLVKLQJDQGLQVWDOOLQJFRPSOHWHLQSODFHDV VSHFLILHG3D\PHQWVKDOOLQFOXGHILWWLQJVFRQQHFWLRQVWRVWUXFWXUHVSLSHEHGGLQJDQG IOH[LEOHMRLQWV - %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPDV³LQ0DQKROH QHZ ´  0HDVXUHPHQWZLOOEHOXPSVXP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNFRVWVDQGDOOHOVHQHFHVVDU\WR FRPSOHWHWKH%LG,WHPDVVSHFLILHGLQFOXGLQJGHPROLWLRQRIWKHH[LVWLQJPDQKROH IRXQGDWLRQFRQVWUXFWLRQDVVHPEO\IUDPHFDVWLQJVFRQQHFWLRQVGURSVWUXFWXUHPDQKROH IUDPHDQGFRYHURIDOOVL]HVDQGPRGHOVVKRZQRQWKH'UDZLQJVDQGILQLVKLQJRIWKH PDQKROH . %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPDV³LQ0DQKROH([WHQVLRQWR*UDGH´  0HDVXUHPHQWZLOOEH9HUWLFDO)RRWRIH[WHQVLRQRIPDQKROHLQVWDOOHGXSWRJUDGH  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNFRVWVDQGDOOHOVHQHFHVVDU\WR FRPSOHWHWKH%LG,WHPDVVSHFLILHG3D\PHQWVKDOOLQFOXGHH[SRVLWLQJDQGGHPROLVKLQJ H[LVWLQJPDQKROHFRPSRQHQWVSURYLGLQJDQGLQVWDOOLQJPDQKROHEDUUHODQGFRQHVHFWLRQV WRUDLVHWKHPDQKROHWRJUDGHWRSVODEFDVWLQJVIUDPHVHDOLQJDQGLQWHUQDOOLQHUV &RXQFLO1R,([KLELW'3DJHRI Page 156 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 0($685(0(17$1'3$<0(17 / %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³LQ3RO\PHU&RQFUHWH0HWHU9DXOW´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNFRVWVDQGDOOHOVHQHFHVVDU\WR FRPSOHWHLQVWDOODWLRQRIWKHPHWHUYDXOW3D\PHQWVKDOOLQFOXGHIRXQGDWLRQFRQVWUXFWLRQ ZDOOVWUXFWXUHWRSVODEVWUXFWXUHLWHPVFDVWLQWRWKHWRSVODE PDQKROHFRYHUV>1HHQDK DQG&RPSRVLWH)UDPH/LG@EDVHGDYLWFDUQHDUP ODGGHU,QWHUPHGLDWHSODWIRUP IORRUJUDWLQJYHQWSLSHVDQGHOHFWULFDOFRQGXLWV 0 %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³LQ3DUVKDOO)OXPH´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNFRVWVDQGDOOHOVHQHFHVVDU\WR FRPSOHWHWKH%LG,WHPLQFOXGLQJWKHSDUVKDOOIOXPHFKDQQHOJURXWHGEDVHEHORZWKH IOXPHSURYLVLRQVWRVHDOWKHIOXPHFDOLEUDWLRQRUWHVWLQJRIWKHIOXPHDQGSUHIDEULFDWHG SDUVKDOOIOXPHHQGDGDSWHUVWRWUDQVLWLRQWRIURPSLSHWRDFKDQQHO 1 %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³578&DELQHW%DVHDQG$SSXUWHQDQFHV´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNFRVWVDQGDOOHOVHQHFHVVDU\WR FRPSOHWHWKH%LG,WHPLQFOXGLQJHOHFWULFDOFRQQHFWLRQFDELQHWPRXQWLQJDQGFDSSLQJ PRQLWRULQJRIHOHFWULFDOV\VWHPV 2 %LG,WHP5KDVEHHQSURYLGHGRQWKH%LG)RUPIRU³%DFNILOO´  0HDVXUHPHQWZLOOEH&XELF<DUGRIEDFNILOOHGPDWHULDOV  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNODERUDQGFRVWVUHTXLUHGWREDFNILOO WKHVLWHDVVSHFLILHGLQFOXGLQJHTXLSPHQWSODFLQJDQGFRPSDFWLQJVSRLOVSURYLGLQJ DGGLWLRQDOEDFNILOOPDWHULDO 3 %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³*UDGLQJ´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNFRVWVDQGDOOHOVHQHFHVVDU\WR JUDGHWKHVLWHDQGFRRUGLQDWHZLWKGHYHORSPHQWZLGHJUDGLQJSODQV 4 %LG,WHPKDVEHHQSURYLGHGRQWKH%LG)RUPIRU³/DQGVFDSH5HVWRUDWLRQ´  0HDVXUHPHQWZLOOEH/XPS6XP  3D\PHQWZLOOFRQVWLWXWHIXOOFRPSHQVDWLRQIRUDOOZRUNDQGFRVWVIRUWRSVRLOUHDSSOLFDWLRQ SODQWLQJDQGDOOHOVHUHTXLUHGWRFRPSOHWHODQGVFDSLQJLQIXOODVVSHFLILHG 5 $OORWKHUZRUNDQGFRVWVPXVWEHLQFLGHQWDOWRWKH3URMHFWDQGLQFOXGHGLQWKHDSSURSULDWH%LG ,WHPDQGQRDGGLWLRQDOFRPSHQVDWLRQZLOOEHPDGH (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Bid Item 19 has been provided on the Bid Form for CAR Directed Time and Material Allowance. Not Used Bid Item 19 has been provided on the Bid Form for “CAR Directed Time and Material Allowance” 1. An allowance has been established to cover costs associated with labor, materials, and equipment necessary to conduct MCES utility Work not anticipated or shown on the Drawings as directed by the CAR. 2. Payment will be on a time and material basis. Not used Page 157 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 6(&7,21±68%0,77$/6 3$57*(1(5$/ 6(&7,21,1&/8'(6 $ 3URFHGXUDODQGVSHFLILFUHTXLUHPHQWVIRUWKHIROORZLQJVXEPLWWDOV  6KRS'UDZLQJVDQG3URGXFW,QIRUPDWLRQ  &RQVWUXFWLRQ3URJUHVV6FKHGXOHV  6DPSOHV  'HVLJQVDQG'HVLJQ'DWD  7HVW5HSRUWV  &HUWLILFDWHV  0DQXIDFWXUHU¶VLQVWUXFWLRQV  )LHOGUHSRUWV  &RQVWUXFWLRQ6DIHW\6XEPLWWDOV  3URMHFWSKRWRVDQG9LGHR7DSHV  3HUPLW&RPSOLDQFH'RFXPHQWDWLRQ  2WKHUVXEPLWWDOVUHTXLUHGE\WKH&$5RUWKH&RQWUDFW'RFXPHQWV &2175$&725¶65(63216,%,/,7,(6 $ 6XEPLWDVUHTXLUHGE\'LYLVLRQVSHFLILFDWLRQVHFWLRQV3URMHFWZRUNPDWHULDOV IDEULFDWLRQDQGLQVWDOODWLRQVKDOOFRQIRUPZLWKDSSURYHGVKRSGUDZLQJVDSSOLFDEOHVDPSOHV DQGSURGXFWGDWD % 3UHSDUHDQGWUDQVPLWHDFKVXEPLWWDOVXIILFLHQWO\LQDGYDQFHRISHUIRUPLQJWKHUHODWHGZRUNRU RWKHUDSSOLFDEOHDFWLYLWLHVRUZLWKLQWKHWLPHVSHFLILHGLQWKHLQGLYLGXDOVHFWLRQVRIWKH 6SHFLILFDWLRQVVRWKDWWKHLQVWDOODWLRQZLOOQRWEHGHOD\HGE\UHYLHZDQGSURFHVVLQJWLPHV LQFOXGLQJGLVDSSURYDODQGUHVXEPLWWDO LIUHTXLUHG FRRUGLQDWLRQZLWKRWKHUVXEPLWWDOV YHULILFDWLRQRIILHOGPHDVXUHPHQWVDQGFOHDUDQFHVWHVWLQJSXUFKDVLQJIDEULFDWLRQGHOLYHU\ DQGVLPLODUVHTXHQFHGDFWLYLWLHV1RH[WHQVLRQRIWLPHZLOOEHDXWKRUL]HGEHFDXVHRIWKH &2175$&725¶VIDLOXUHWRWUDQVPLWVXEPLWWDOVVXIILFLHQWO\LQDGYDQFHRIWKH:RUN)DEULFDWLRQ SHUIRUPHGPDWHULDOVSXUFKDVHGRURQVLWHFRQVWUXFWLRQDFFRPSOLVKHGZKLFKGRHVQRWFRQIRUP WRVKRSGUDZLQJVDQGGDWDVKDOOEHWKH&2175$&725¶VULVN & 'HWHUPLQHDQGYHULI\WKHIROORZLQJ  )LHOGPHDVXUHPHQWVTXDQWLWLHVGLPHQVLRQVVSHFLILHGSHUIRUPDQFHFULWHULDLQVWDOODWLRQ UHTXLUHPHQWVPDWHULDOVFDWDORJQXPEHUVFRQIRUPDQFHZLWKWKHVSHFLILFDWLRQVDQG GUDZLQJVDQGVLPLODULQIRUPDWLRQZLWKUHVSHFWWKHUHWR &RXQFLO1R,([KLELW'3DJHRI Page 158 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6  0DWHULDOVZLWKUHVSHFWWRLQWHQGHGXVHIDEULFDWLRQVKLSSLQJKDQGOLQJVWRUDJHDVVHPEO\ DQGLQVWDOODWLRQSHUWDLQLQJWRWKHSHUIRUPDQFHRIWKH:RUN  ,QIRUPDWLRQUHODWLYHWR&2175$&725¶VVROHUHVSRQVLELOLWLHVZLWKUHVSHFWWRPHDQV PHWKRGVWHFKQLTXHVVHTXHQFHVDQGSURFHGXUHVRIFRQVWUXFWLRQDQGVDIHW\SUHFDXWLRQV DQGSURJUDPVLQFLGHQWWKHUHWR ' &KHFNDOOVXEFRQWUDFWRUVVKRSGUDZLQJVUHJDUGLQJPHDVXUHPHQWVVL]HRIPHPEHUV PDWHULDOVDQGGHWDLOVXQWLOVDWLVILHGWKDWWKH\FRQIRUPWRWKHLQWHQWRIWKH'UDZLQJVDQG 6SHFLILFDWLRQV5HWXUQDOOVKRSGUDZLQJVIRXQGWREHLQDFFXUDWHRURWKHUZLVHLQHUURUWRWKH VXEFRQWUDFWRUVIRUFRUUHFWLRQEHIRUHVXEPLVVLRQWRWKH&281&,/ ( $IIL[WKHIROORZLQJ&RQWUDFWRU¶V&HUWLILFDWLRQ6WDWHPHQWLQFOXGLQJWKH&2175$&725¶V &RPSDQ\1DPHDQGVLJQHGE\WKH&2175$&725WRHDFKVKRSGUDZLQJVDPSOHSURGXFW GDWDDQGVXEPLWWDO  ³&RQWUDFWRU¶V&HUWLILFDWLRQ6WDWHPHQW%\WKLV6XEPLWWDO,KHUHE\UHSUHVHQWWKDW,KDYH GHWHUPLQHGDQGYHULILHGDOOILHOGPHDVXUHPHQWVILHOGFRQVWUXFWLRQFULWHULDPDWHULDOV GLPHQVLRQVFDWDORJQXPEHUVDQGVLPLODUGDWDDQG,KDYHUHYLHZHGDQGDSSURYHGWKLV VXEPLWWDODQGFKHFNHGDQGFRRUGLQDWHGHDFKLWHPZLWKRWKHUDSSOLFDEOHDSSURYHGVKRS GUDZLQJVVXEPLWWDOVDQGDOO&RQWUDFWUHTXLUHPHQWV´ ) 6XSSOLHU¶V&HUWLILFDWLRQ6WDWHPHQW  ³6XSSOLHU¶V&HUWLILFDWLRQ6WDWHPHQW%\WKLV6XEPLWWDOZHKHUHE\FHUWLI\WKDWZHKDYH UHYLHZHGWKHFRQWUDFWUHTXLUHPHQWVIRUWKHIXUQLVKLQJDQGLQVWDOODWLRQRI>QDPHHTXLSPHQW SURYLGHG@LQFOXGLQJHQYLURQPHQWDOFRQGLWLRQVPDWHULDOVFKDUDFWHULVWLFVK\GUDXOLFV VXSSRUWLQJXWLOLWLHVGLPHQVLRQVDQGVWUXFWXUDOVXSSRUWDQGZHFHUWLI\WKDWWKLVLVDQ DSSURSULDWHDSSOLFDWLRQIRUWKLVHTXLSPHQW´ * 1RWLI\WKH&$5LQZULWLQJDWWKHWLPHRIVXEPLWWDORIDQ\GHYLDWLRQVLQWKHVXEPLWWDOVIURPWKH UHTXLUHPHQWVRIWKH&RQWUDFW'RFXPHQWV6XFKQRWLFHVKDOOEHLQDZULWWHQFRPPXQLFDWLRQ VHSDUDWHIURPWKHVXEPLWWDODQGVKDOOEHLQGLFDWHGRQHDFK6KRS'UDZLQJDQG6DPSOH VXEPLWWHGWR$(IRUUHYLHZDQGDSSURYDORIHDFKYDULDWLRQ + 7KHUHYLHZDQGDSSURYDORIVKRSGUDZLQJVVDPSOHVRUSURGXFWGDWDE\WKH$(VKDOOQRW UHOLHYHWKH&2175$&725IURPLWVUHVSRQVLELOLW\ZLWKUHJDUGWRWKHIXOILOOPHQWRIWKHWHUPVRI WKH&RQWUDFW$OOULVNVRIHUURUDQGRPLVVLRQDUHDVVXPHGE\WKH&2175$&725DQGWKH$( DQG&281&,/ZLOOKDYHQRUHVSRQVLELOLW\WKHUHIRUH 68%0,77$/5(48,5(0(176 $ 7UDQVPLWVXEPLWWDOVLQDWLPHO\PDQQHUDQGZLWKRXWLPSHGLQJRYHUDOOSURJUHVVRIWKH:RUN  6FKHGXOHVXEPLWWDOVFRQVLVWHQWZLWKWKHFRQVWUXFWLRQVFKHGXOHZLWKUHFRJQLWLRQRIWLPH UHTXLUHGIRUVXEPLWWDOUHYLHZ  &RRUGLQDWHVXEPLWWDOVZLWKRWKHUVXEPLWWDOVUHODWHGDFWLYLWLHVVHTXHQWLDODFWLYLWLHVDQG RYHUDOOSHUIRUPDQFHRIWKH:RUN % 7UDQVPLWVXEPLWWDOVXQGHU&281&,/DSSURYHG6XEPLWWDO7UDQVPLWWDO)RUP )RUP WR WKHSDUWLHVLGHQWLILHGDWWKH3UHFRQVWUXFWLRQ&RQIHUHQFHDQGVHQGDSURSHUO\GRFXPHQWHG FRS\RIWKH6XEPLWWDO7UDQVPLWWDO)RUPWRWKH&$5 &RXQFLO1R,([KLELW'3DJHRI Page 159 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 & 0DLQWDLQDZULWWHQORJRIVXEPLWWDOVDQGDFWLRQVWKHUHRQ'LVWULEXWHFRSLHVRIUHYLHZHGDQG DSSURYHGVXEPLWWDOVEHDULQJUHYLHZVWDPSWRFRQFHUQHGSDUWLHV3ODFHRQHFRS\RI DSSURYHGVXEPLWWDOVLQ3URMHFWUHFRUGGRFXPHQWVILOHFRQVLVWHQWZLWK6HFWLRQ ' $OOVXEPLWWDOVVKDOOEHWUDQVPLWWHGLQHOHFWURQLFIRUPDW SGIRU0LFURVRIW2IILFH [OV GRF RU SSW DQGVKDOOEHOHJLEOH LH0LQLPXPVL]HIRQWLVSWDVSULQWHGRQ[LQFKRU[ LQFKVL]HGSDSHURUDFWXDOVL]HRISUHSULQWHGVFDQQHGPDWHULDO  ( &OHDUO\LGHQWLI\RQWKHWUDQVPLWWDOVKHHWLIWKHVXEPLWWDOUHSUHVHQWV³2U(TXDO´LWHPVRU VXEVWLWXWHLWHPVRUFRQVWUXFWLRQPHWKRGV  ,IWKHVXEPLWWDOUHSUHVHQWVVXEVWLWXWHLWHPVRUFRQVWUXFWLRQPHWKRGVLQFOXGHVXSSRUWLQJ GRFXPHQWDWLRQ ) &RPELQHWKHIROORZLQJLWHPVDQGVXEPLWXQGHUDVLQJOHWUDQVPLWWDOVKHHW  &RSLHVRI3URGXFW'DWD4XDOLW\$VVXUDQFH'DWDDQG6KRS'UDZLQJV * 7KH&2175$&725VKDOOVHTXHQWLDOO\QXPEHUHDFKVXEPLWWDORUGHYHORSDVXEPLWWDO LGHQWLILFDWLRQQXPEHULQJV\VWHPDFFHSWDEOHWRWKH&$5  5HVXEPLWWDOVVKDOOEHGHVLJQDWHGE\WKHDGGLWLRQRIDOHWWHU$WR=LQGLFDWLQJWKH UHVXEPLVVLRQ LH& UGVXEPLVVLRQ  68%0,77$/5(9,(:352&('85(6 $ &2175$&725VKDOOPDNHFRUUHFWLRQVUHTXLUHGE\$(DQGVKDOOUHWXUQWKHUHTXLUHGQXPEHU RIFRUUHFWHGFRSLHVRI6KRS'UDZLQJVDQGVXEPLWDVUHTXLUHGQHZ6DPSOHVIRUUHYLHZDQG DSSURYDO&2175$&725VKDOOGLUHFWVSHFLILFDWWHQWLRQLQZULWLQJWRUHYLHZVRWKHUWKDQWKH FRUUHFWLRQVFDOOHGIRUE\$(RQSUHYLRXVVXEPLWWDOV % :KHUHD6KRS'UDZLQJRU6DPSOHLVUHTXLUHGE\WKH&RQWUDFW'RFXPHQWVRUWKHVFKHGXOHRI 6KRS'UDZLQJVDQG6DPSOHVXEPLVVLRQVLVUHTXLUHGUHODWHG:RUNSHUIRUPHGSULRUWR$(¶V UHYLHZDQGDSSURYDORIWKHSHUWLQHQWVXEPLWWDOZLOOEHDWWKHVROHH[SHQVHDQGUHVSRQVLELOLW\RI &2175$&725 & 7KH&2175$&725UHPDLQVUHVSRQVLEOHIRUGHWDLOVDQGDFFXUDF\IRUFRRUGLQDWLQJWKHZRUN ZLWKDOORWKHUDVVRFLDWHGZRUNDQGWUDGHVIRUVHOHFWLQJIDEULFDWLRQSURFHVVHVIRUWHFKQLTXHV RIDVVHPEO\DQGIRUSHUIRUPLQJZRUNLQDVDIHPDQQHU ' 6XEPLWWDOVZLOOEHUHYLHZHGIRUFRQIRUPDQFHZLWK&RQWUDFW'RFXPHQWVDQGZLOOUHFHLYHRQHRI WKHIROORZLQJDFWLRQV  $)XUQLVKDVVXEPLWWHG  %)XUQLVKDV1RWHG E\$(  &5HYLVHDQG5HVXEPLW  '5HMHFWHG  ($(¶V5HYLHZ1RW5HTXLUHG ( 6XEPLWWDOVZLOOEHUHYLHZHGIRU&2175$&725¶VDSSURYDOVWDPS6XEPLWWDOVQRWVWDPSHGE\ WKH&2175$&725 V ZLOOEHUHWXUQHGZLWKRXWDQ\DFWLRQ &RXQFLO1R,([KLELW'3DJHRI Page 160 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 ) )DLOXUHWRLQFOXGHUHTXLUHGVSHFLILFLQIRUPDWLRQZLOOUHVXOWLQWKHWUDQVPLWWDOEHLQJUHWXUQHGWR WKH&2175$&725ZLWKDFWLRQ³&´RU³'´ * 5HVXEPLWWDOVZLOOEHKDQGOHGLQWKHVDPHPDQQHUDVILUVWVXEPLWWDOV2QUHVXEPLWWDOVGLUHFW VSHFLILFDWWHQWLRQLQZULWLQJRQWKHOHWWHURIWUDQVPLWWDODQGRQUHVXEPLWWHGVKRSGUDZLQJVE\ XVHRIUHYLVLRQWULDQJOHVRURWKHUVLPLODUPHWKRGVWRUHYLVLRQVRWKHUWKDQWKHFRUUHFWLRQV UHTXHVWHGE\WKH$(RQSUHYLRXVVXEPLVVLRQV$Q\VXFKUHYLVLRQVZKLFKDUHQRWFOHDUO\ LGHQWLILHGVKDOOEHPDGHDWWKHULVNRIWKH&2175$&7250DNHFRUUHFWLRQVWRDQ\ZRUN GRQHEHFDXVHRIWKLVW\SHUHYLVLRQWKDWLVQRWLQDFFRUGDQFHWRWKH&RQWUDFW'RFXPHQWVDV PD\EHUHTXLUHGE\WKH$( + 3DUWLDOVXEPLWWDOVPD\QRWEHUHYLHZHG7KH$(ZLOOEHWKHRQO\MXGJHDVWRWKH FRPSOHWHQHVVRIDVXEPLWWDO6XEPLWWDOVQRWFRPSOHWHZLOOEHUHWXUQHGWRWKH&2175$&725 DQGZLOOEHFRQVLGHUHG³1RW$SSURYHG´XQWLOUHVXEPLWWHG  7KH$(PD\DWLWVRSWLRQSURYLGHDOLVWRUPDUNWKHVXEPLWWDOGLUHFWLQJWKH&2175$&725 WRWKHDUHDVWKDWDUHLQFRPSOHWH , 5HSHWLWLYH5HYLHZ  6KRSGUDZLQJVDQGRWKHUVXEPLWWDOVZLOOEHUHYLHZHGQRPRUHWKDQ>WZLFH@DWWKH &281&,/¶VH[SHQVH$OOVXEVHTXHQWUHYLHZVZLOOEHSHUIRUPHGDWWLPHVFRQYHQLHQWWRWKH $(DQGDWWKH&2175$&725¶VH[SHQVHEDVHGRQWKH$(¶VWKHQSUHYDLOLQJUDWHVRURQ WKHIROORZLQJ,IUHYLHZLVLQKRXVH &281&,/$( WKHQWKHUDWHVKDOOEHVHWDWDUDWHRI SHUKRXUIRUHDFKKRXUZRUNHGRUSRUWLRQWKHUHRIRQDOOVXEVHTXHQWUHYLHZV 5HLPEXUVHWKH&281&,/IRUDOOVXFKIHHVLQYRLFHGWRWKH&281&,/E\WKH$(RUZRUNHG E\WKH$(LILQKRXVH5HLPEXUVHPHQWVKDOOEHYLDDFKHFNPDGHSD\DEOHWRWKH ³0HWURSROLWDQ&RXQFLO´DQGVXEPLWWHGWRWKH&$56XEPLWWDOVPXVWEHUHYLVHGDQGUH VXEPLWWHGXQWLODSSURYHG  $Q\QHHGIRUPRUHWKDQRQHVXEPLVVLRQRUDQ\RWKHUGHOD\LQREWDLQLQJ$(¶VUHYLHZRI VXEPLWWDOVZLOOQRWHQWLWOH&2175$&725WRH[WHQVLRQRIWKH&RQWUDFW7LPH - ,IWKH&2175$&725FRQVLGHUVDQ\FRUUHFWLRQLQGLFDWHGRQWKHVKRSGUDZLQJVWRFRQVWLWXWHD FKDQJHWRWKH&RQWUDFW'RFXPHQWVJLYHZULWWHQQRWLFHWKHUHRIWRWKH&$5DWOHDVWFDOHQGDU GD\VSULRUWRUHOHDVHIRUPDQXIDFWXUH . :KHQWKHVKRSGUDZLQJVKDYHEHHQFRPSOHWHGWRWKHVDWLVIDFWLRQRIWKH$(FDUU\RXWWKH FRQVWUXFWLRQLQDFFRUGDQFHWKHUHZLWKDQGVKDOOPDNHQRIXUWKHUFKDQJHVWKHUHLQH[FHSWXSRQ ZULWWHQLQVWUXFWLRQVIURPWKH$( / 6XEPLWWDOVZLOOEHUHYLHZHGLQRUGHUUHFHLYHGXQOHVV&2175$&725UHTXHVWVDUHYLVHGRUGHU RIUHYLHZLQZULWLQJ 0 $OOVXEPLWWDOVVKDOOEHVXIILFLHQWO\LQDGYDQFHRIFRQVWUXFWLRQUHTXLUHPHQWVWRSURYLGHQROHVV WKDQFDOHQGDUGD\VIRUUHYLHZIURPWKHWLPHWKH$(UHFHLYHVWKHP1ROHVVWKDQ FDOHQGDUGD\VZLOOEHUHTXLUHGIRUPDMRUHTXLSPHQWWKDWUHTXLUHVUHYLHZE\PRUHWKDQRQH HQJLQHHULQJGLVFLSOLQH 1 5HYLVHDQGUHVXEPLWUHMHFWHGVXEPLWWDOVDQGWKRVHUHTXLULQJFRUUHFWLRQVRUYHULILFDWLRQRI LQIRUPDWLRQLQDWLPHO\PDQQHUVXFKWKDWRYHUDOOSURJUHVVRIWKH:RUNLVQRWLPSHGHG &RXQFLO1R,([KLELW'3DJHRI Page 161 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 $(¶65(9,(:6 $ 7KHUHYLHZRIVKRSGUDZLQJVGDWDVDPSOHVDQGRWKHUVXEPLWWDOVZLOOEHIRUJHQHUDO FRQIRUPDQFHZLWKWKHGHVLJQFRQFHSWDQG&RQWUDFW'RFXPHQWV7KH\VKDOOQRWEHFRQVWUXHG  $VSHUPLWWLQJDQ\GHSDUWXUHIURPWKH&RQWUDFWUHTXLUHPHQWV  $VUHOLHYLQJWKH&2175$&725RIUHVSRQVLELOLW\IRUDQ\HUURUVLQFOXGLQJGHWDLOV GLPHQVLRQVDQGPDWHULDOV  $VDSSURYLQJGHSDUWXUHVIURPGHWDLOVIXUQLVKHGE\WKH$(H[FHSWDVRWKHUZLVHSURYLGHG KHUHLQ  $VDSSURYLQJVXEVWLWXWLRQVWRVSHFLILHGSURGXFWVRUPDQXIDFWXUHUV % $(ZLOODWWHPSWWRFRPSOHWHUHYLHZRIHDFKVXEPLWWDOZLWKLQFDOHQGDUGD\VRILWVUHFHLSW )DLOXUHRI$(WRUHYLHZDVXEPLWWDOZLWKLQFDOHQGDUGD\VVKDOOQRWEHWKHEDVLVIRU &2175$&725WRFODLPDGGLWLRQDO&RQWUDFW3ULFHRU&RQWUDFW7LPH$(ZLOODWWHPSWWRDOHUW &2175$&725LQZULWLQJZLWKQRWLILFDWLRQWR&$5ZLWKLQFDOHQGDUGD\VRIUHFHLSWRIHDFK VXEPLWWDOLIWKHUHYLHZZLOOUHTXLUHPRUHWKDQGD\V/HQJWKRIWLPHIRU$(¶VUHYLHZLV GHSHQGHQWXSRQQXPHURXVIDFWRUVLQFOXGLQJEXWQRWOLPLWHGWR  6L]HRIVXEPLWWDO  &RPSOHWHQHVVRIVXEPLWWDO  &RPSOH[LW\RIVXEPLWWDO  1XPEHURIRWKHUVXEPLWWDOVUHFHLYHGLQWKHVDPHWLPHSHULRG 35(&216758&7,2168%0,77$/6 $ 6XEPLWHOHFWURQLFFRSLHVRIHDFKRIWKHIROORZLQJLWHPVDWOHDVWGD\VSULRUWRWKH 3UHFRQVWUXFWLRQ&RQIHUHQFH  &2175$&725¶V3ULQFLSDO6WDIIDQG&RQVXOWDQWVLQIRUPDWLRQLQFOXGLQJQDPH V DQGZRUN DGGUHVVHVDQGWHOHSKRQHQXPEHU  &2175$&725 VSURMHFWPDQDJHUILHOGVXSHULQWHQGHQWVDIHW\UHSUHVHQWDWLYHDQGRWKHU VLWHUHSUHVHQWDWLYHV,QFOXGHQDPH V KRPHDQGZRUNDGGUHVVHVDQGKRPHZRUNDQG FHOOXODUWHOHSKRQHQXPEHUV  &2175$&725 VLQGLYLGXDO V DXWKRUL]HGWRVLJQGRFXPHQWVLQIRUPDWLRQLQFOXGLQJQDPHV ZRUNDGGUHVVVDPSOHVRIVLJQDWXUHDQGOLPLWVRIDXWKRULW\RIHDFKLQGLYLGXDO  6FKHGXOHRI9DOXHV  &2175$&725¶VOLVWRI6XEFRQWUDFWRUVDQGPDMRUVXSSOLHUV  3UHOLPLQDU\3URJUHVV6FKHGXOHFRQVLVWHQWZLWK6HFWLRQ  3URSRVHGVFKHGXOHRIVXEPLWWDOV  3URSRVHG6XEPLWWDO7UDQVPLWWDO)RUP3URYLGHVSDFHIRUWKHIROORZLQJLQIRUPDWLRQLQD IRUPDWDFFHSWDEOHWRWKH&281&,/ &RXQFLO1R,([KLELW'3DJHRI Page 162 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 D 'DWH&2175$&725¶VQDPH3URMHFWQDPHDQGQXPEHUDQG&RQWUDFW1XPEHU E 1DPHVRI6XEFRQWUDFWRUVDQGVXSSOLHUVLQYROYHGZLWKWKHVXEPLWWDO F 5HIHUHQFHWRSHUWLQHQW'UDZLQJVKHHWVDQG6SHFLILFDWLRQVHFWLRQV G ,GHQWLILFDWLRQRI³RUHTXDO´LWHPVVXEVWLWXWHLWHPVDQGVXEVWLWXWHFRQVWUXFWLRQPHWKRGV UHSUHVHQWHGE\WKHVXEPLWWDO H LQFKE\LQFKEODQNVSDFHIRU$(¶VUHYLHZQRWHVDQGVWDPS 352*5(666&+('8/( $ &KURQRORJLFDOSURJUHVVVFKHGXOHRQLQFKE\LQFKVKHHWVLQFOXGLQJWKHIROORZLQJ  6HTXHQFHRIFRQVWUXFWLRQ  7HPSRUDU\FRQVWUXFWLRQRIIDFLOLWLHVXWLOLWLHVDQGFRQWUROV  7HPSRUDU\SXPSLQJDQGSLSLQJSURYLVLRQV  2WKHU:RUNUHODWHGLWHPVUHTXHVWHGE\WKH&$5 % /LVWHDFKVWDJHDQGZRUNDFWLYLW\LQFKURQRORJLFDOVHTXHQFHVKRZLQJEHJLQQLQJDQG FRPSOHWLRQGDWHV,QFOXGHHDFKZRUNDFWLYLW\ZLWKDQHVWLPDWHGGXUDWLRQRIRUPRUHFDOHQGDU GD\V & )RUPDWLQIRUPDWLRQDVDKRUL]RQWDOEDUFKDUWZLWKVHSDUDWHEDUVIRUHDFKWUDGHRURSHUDWLRQ 3URYLGHVSDFHIRUQRWDWLRQVDQGIXWXUHUHYLVLRQV ' ,GHQWLI\HDFKZRUNLWHPE\DSSOLFDEOHVSHFLILFDWLRQVHFWLRQQXPEHUDQGJUDSKLFDOO\VKRZ UHODWLRQVKLSVEHWZHHQZRUNLWHPV ( (VWLPDWHWLPHVIRUSHUIRUPDQFHRIWKHIROORZLQJ  3UHSDUDWLRQRIVXEPLWWDOVE\&2175$&725DQGUHYLHZRIVXEPLWWDOVE\$(,QFOXGHWKLV LQIRUPDWLRQRQWKH3URJUHVV6FKHGXOHDQGLQDVHSDUDWH6FKHGXOHRI6XEPLWWDOVZKLFK VKRZVRQO\VXEPLWWDOUHODWHGDFWLYLWLHV  )DEULFDWLRQGHOLYHU\DQGLQVWDOODWLRQ  7HVWLQJVWDUWXSLQVWUXFWLRQRI&281&,/SHUVRQQHODQGFOHDQXS  'LYHUVLRQVVKXWGRZQVZRUNLQH[LVWLQJ&281&,/IDFLOLWLHVDQGRWKHUGLVUXSWLRQVRI &281&,/IDFLOLWLHVUHJDUGOHVVRIGXUDWLRQV ) ,QFOXGHQDUUDWLYHGHVFULSWLRQRI&2175$&725¶VFRQVWUXFWLRQSODQH[SODLQLQJ  $VVXPSWLRQVXVHGWRGHYHORSWKHVFKHGXOH  'LVUXSWLRQVFKHGXOHDQG&2175$&725UHTXLUHPHQWVIRU&281&,/IDFLOLWLHV  3URSRVHGFRQVWUXFWLRQVHTXHQFH  7KHQDWXUHRIUHODWLRQVKLSVVKRZQEHWZHHQZRUNLWHPV  &ULWLFDOSDWKDFWLYLWLHVDQGDSSURDFKHVWRDGGUHVVLQJWKHLUFRRUGLQDWLRQDQGFRPSOHWLRQ &RXQFLO1R,([KLELW'3DJHRI Page 163 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6  0HDQVDQGPHWKRGVRIFRQVWUXFWLRQDQGHTXLSPHQWWREHHPSOR\HGLQWKH:RUN  3URSRVHGFRQVWUXFWLRQIDFLOLWLHVDQGWHPSRUDU\FRQWUROV  &RRUGLQDWLRQZLWKRWKHUFRQWUDFWRUVRQWKHVLWH * 5HYLVHXSGDWHDQGUHLVVXHVFKHGXOHZLWKHDFKDSSOLFDWLRQIRUSD\PHQWRUZKHQUHTXHVWHG E\&$56KRZFKDQJHVLQWKH:RUNVLQFHSUHYLRXVVFKHGXOHZDVVXEPLWWHGDQGVKRZ SHUFHQWDJHRIFRPSOHWLRQIRUHDFKDFWLYLW\5HYLVH&RXQFLOIDFLOLW\GLVUXSWLRQSDUWVRISODQDV QHHGHG6XEPLWUHYLVLRQVGD\VEHIRUHQHHGLQJ&281&,/IDFLOLWLHV + :KHUHZRUNLVWREHSHUIRUPHGXQGHUWKLVFRQWUDFWFRQFXUUHQWO\ZLWKDQGRUFRQWLQJHQWXSRQ ZRUNSHUIRUPHGRQWKHVDPHIDFLOLWLHVRUDUHDXQGHURWKHUFRQWUDFWVFRRUGLQDWHWKLVFRQWUDFW¶V VFKHGXOHZLWKWKHVFKHGXOHVRIWKHRWKHUFRQWUDFWV2EWDLQWKHVFKHGXOHVRIWKHRWKHU DSSURSULDWHFRQWUDFWVIURPWKH&$5IRUWKHSUHSDUDWLRQDQGXSGDWLQJRIWKHFRQVWUXFWLRQ VFKHGXOHDQGPDNHWKHUHTXLUHGFKDQJHVLQWKHVFKHGXOHZKHQLQGLFDWHGE\FKDQJHVLQ FRUUHVSRQGLQJVFKHGXOHV , $GMXVWPHQWRIVFKHGXOHDQGDFWLYLW\FRPSOHWLRQWLPHV  &2175$&725UHTXHVWHGFKDQJHVLQPHWKRGVRIRSHUDWLQJZKLFKDIIHFWWKHDSSURYHG FRQVWUXFWLRQVFKHGXOHQRWLI\WKH&$5LQZULWLQJVWDWLQJZKDWVFKHGXOHFKDQJHVDUH SURSRVHGDQGWKHUHDVRQIRUWKHFKDQJH,IWKH&$5DSSURYHVWKHVHFKDQJHVUHYLVHDQG VXEPLWIRUDSSURYDOWKHHQWLUHDIIHFWHGSRUWLRQRIWKHVFKHGXOH  &$5UHTXHVWHGDGMXVWPHQWVPD\FRQVLVWRIFKDQJLQJSRUWLRQVRIWKHDFWLYLW\VHTXHQFH DQGRUDFWLYLW\GXUDWLRQ¶VGLYLVLRQRIDSSURYHGDFWLYLWLHVRURWKHUDGMXVWPHQWVDVPD\EH DXWKRUL]HGE\WKH&$57KHDGGLWLRQRIH[WUDQHRXVQRQZRUNLQJDFWLYLWLHVDQGRU DFWLYLWLHVZKLFKDGGUHVWUDLQWVWRWKHVFKHGXOHVKDOOQRWEHDSSURYHG  0DQGDWRU\DGMXVWPHQWV  ,IWKHFRPSOHWLRQRIDQ\DFWLYLW\ZKHWKHURUQRWFULWLFDOIDOOVPRUHWKDQRQHKXQGUHG SHUFHQW  EHKLQGLWVDSSURYHGGXUDWLRQVXEPLWDVFKHGXOHDGMXVWPHQWVKRZLQJHDFK VXFKDFWLYLW\GLYLGHGLQWRWZRDFWLYLWLHVUHIOHFWLQJFRPSOHWHGYHUVXVXQFRPSOHWHGZRUN  6KRSGUDZLQJVZKLFKQHHGWREHUHVXEPLWWHGRUDUHQRWUHYLHZHGZLWKLQWKHVFKHGXOH WLPHGVKDOOEHLPPHGLDWHO\UHVFKHGXOHG  7KH&2175$&725DFNQRZOHGJHVDQGDJUHHVWKDWDFWXDOGHOD\VLQDFWLYLWLHVZKLFK DFFRUGLQJWRWKHVFKHGXOHGRQRWDIIHFWDQ\FRQWUDFWFRPSOHWLRQGDWHVKRZQE\WKHFULWLFDO SDWKLQWKHVFKHGXOHGRQRWKDYHDQ\HIIHFWRQWKHFRQWUDFWFRPSOHWLRQGDWHRUGDWHVDQG WKHUHIRUHZLOOQRWEHWKHEDVLVIRUDFKDQJHWKHUHLQ  $YDLODEOHIORDWWLPHLQWKHVFKHGXOHPD\EHXVHGE\WKH&281&,/RUE\WKH &2175$&725)ORDWWLPHLVGHILQHGDVWKHDPRXQWRIWLPHEHWZHHQWKHHDUO\VWDUWGDWH DQGWKHODWHVWDUWGDWHRUWKHHDUO\ILQLVKGDWHDQGWKHODWHILQLVKGDWHRIDQ\RIWKH DFWLYLWLHVLQWKHVFKHGXOH 6+23'5$:,1*6 $ 'UDZWRDFFXUDWHVFDOHLQHOHFWURQLFIRUPDWIRUVKHHWVVL]HVQRWOHVVWKDQLQFKHVE\ LQFKHVQRUODUJHUWKDQLQFKHVE\LQFKHVH[FHSWIRUDFWXDOSDWWHUQRUWHPSODWHW\SH &RXQFLO1R,([KLELW'3DJHRI Page 164 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 GUDZLQJV'RQRWUHSURGXFH&RQWUDFW'RFXPHQWVDVEDVLVRI6KRS'UDZLQJV3URYLGH FRPSOHWHLQIRUPDWLRQWRVKRZFRQIRUPDQFHWRWKH&RQWUDFW'RFXPHQWVFRQVLVWLQJRIWHFKQLFDO GUDZLQJVDQGGDWDVSHFLILFDOO\SUHSDUHGIRUWKLV3URMHFWLQFOXGLQJEXWQRWOLPLWHGWR  )DEULFDWLRQDQGLQVWDOODWLRQGUDZLQJVLQFOXGLQJUHIHUHQFHWRDSSOLFDEOHGHWDLOHGGUDZLQJV RIFRPSRQHQWVDQGDVVHPEOLHV  6KRSZRUNPDQXIDFWXULQJLQVWUXFWLRQV  7HPSODWHVDQGSDWWHUQV  &RRUGLQDWLRQGUDZLQJVIRUSURGXFWVDQGPDWHULDOVWKDWPXVWLQWHUIDFHZLWKWKHZRUNRI RWKHUVXEPLWWDOVLQGLFDWLQJKRZZRUNVKRZQE\VHSDUDWHVKRSGUDZLQJVZLOOLQWHUIDFHDQG WKHVHTXHQFHRILQVWDOODWLRQ % 6KRSGUDZLQJVDQGSURGXFWGDWDVKHHWVWREHSULQWHGRQLQ[LQFKHVDQGVPDOOHUVKDOO EHPHUJHGWRJHWKHULQDQRUGHUO\IDVKLRQLQDQHOHFWURQLFILOHDQGEHDUWKHDERYH&HUWLILFDWLRQ 6WDWHPHQWRQWKHFRYHUVKHHW7KHFRYHUVKHHWVKDOOIXOO\GHVFULEHWKHSDFNDJHGGDWDDQG LQFOXGHDOLVWRIDOOLWHPVZLWKLQWKHSDFNDJH 352'8&7'$7$ $ 3URYLGHFRPSOHWHLQIRUPDWLRQWRVKRZFRQIRUPDQFHWRWKHFRQWUDFWGRFXPHQWVDQGRWKHU LQIRUPDWLRQDVPD\EHVSHFLILHGRUUHTXLUHGLQFOXGLQJ  0DQXIDFWXUHU¶VVWDQGDUGSURGXFWLQIRUPDWLRQGHOHWHDOOQRQDSSOLFDEOHLQIRUPDWLRQDQG FOHDUO\LGHQWLI\DOODSSOLFDEOHLQIRUPDWLRQ0DQXIDFWXUHU¶VVDOHVLQIRUPDWLRQVKHHWVDUHQRW DFFHSWDEOH  0DQXIDFWXUHU¶VLQVWUXFWLRQVIRUWUDQVSRUWDWLRQKDQGOLQJVWRUDJHPDLQWHQDQFHDQG LQVWDOODWLRQ 48$/,7<$6685$1&('$7$ $ 'RFXPHQWDWLRQVKRZLQJFRPSOLDQFHZLWKUHTXLUHPHQWVVSHFLILHGLQWKH$UWLFOHWLWOHG³48$/,7< $6685$1&(´LQ3DUWRI'LYLVLRQVSHFLILFDWLRQVHFWLRQV4XDOLW\$VVXUDQFH GRFXPHQWDWLRQVKDOOLQFOXGHWKHIROORZLQJDVDSSOLFDEOH  'HVLJQFRQVLGHUDWLRQVLQFOXGLQJPL[IRUPXODVFDOFXODWLRQVDQGWHVWUHVXOWVYHULI\LQJ GHVLJQPL[SHUIRUPDQFH  0DQXIDFWXUHUVLQVWDOOHU¶VDQGGHVLJQHU¶VTXDOLILFDWLRQV  &HUWLILFDWLRQV 6$03/(6 $ ,QGLYLGXDOVDPSOHVWRVKRZFRQIRUPDQFHWRWKH&RQWUDFW'RFXPHQWV6HWVRIVDPSOHVZKLFK VKRZWKHIXOOUDQJHRIDYDLODEOHFRORUVDQGILQLVKHVIRULWHPV&281&,/LVWRVHOHFWFRORUV SDWWHUQVWH[WXUHVRUILQLVKHV % /DEHORUWDJHDFKVDPSOHRUVHWRIVDPSOHVZLWK3URMHFW1DPH3URMHFW1XPEHUVSHFLILFDWLRQ VHFWLRQQXPEHUDQGLQWHQGHGXVH & ,QFOXGHVDPSOHV &RXQFLO1R,([KLELW'3DJHRI Page 165 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 6285&(48$/,7<&21752/'$7$ $ 'RFXPHQWDWLRQVKRZLQJFRPSOLDQFHZLWKUHTXLUHPHQWVVSHFLILHGLQ$UWLFOHVWLWOHG³6285&( 48$/,7<&21752/´LQ3DUWRI'LYLVLRQVSHFLILFDWLRQVHFWLRQV6RXUFH4XDOLW\ &RQWURO'DWDVKDOOLQFOXGH  6HULDOQXPEHUVRURWKHUGLVWLQFWLYHPDUNLQJVRQSURGXFWVZKLFKZLOODOORZ&281&,/WR LGHQWLI\SURGXFWVUHSUHVHQWHGE\WKH6RXUFH4XDOLW\&RQWURO'DWD  5HVXOWVRIIDFWRU\WHVWLQJVKRZLQJFRQIRUPDQFHZLWKVSHFLILHGUHTXLUHPHQWV  &HUWLILHGSHUIRUPDQFHGDWDIRUSURGXFWVVXFKDVSXPSFXUYHV  ,GHQWLW\RILQGLYLGXDORUILUPSHUIRUPLQJWKH6RXUFH4XDOLW\&RQWUROWHVWLQJ % 6XEPLWHOHFWURQLFFRSLHVRI6RXUFH4XDOLW\&RQWURO'DWDIRUDSSURYDOSULRUWRVKLSSLQJ SURGXFWVIURPWKHPDQXIDFWXULQJDVVHPEO\RUIDEULFDWLRQIDFLOLW\WRWKH3URMHFWVLWH ),(/'48$/,7<&21752/5(32576 $ 3UHSDUHZULWWHQUHSRUWVVKRZLQJFRQIRUPDQFHRIZRUNZLWKUHTXLUHPHQWVVSHFLILHGLQ$UWLFOHV WLWOHG³),(/'48$/,7<&21752/´LQ3DUWRI'LYLVLRQVSHFLILFDWLRQVHFWLRQV % $UUDQJHIRU,QGHSHQGHQW7HVWLQJ/DERUDWRU\WRSUHSDUHZULWWHQUHSRUWVVKRZLQJFRQIRUPDQFH RIZRUNZLWKUHTXLUHPHQWVVSHFLILHGLQ$UWLFOHVWLWOHG³7(67,1*$1',163(&7,21´LQ3DUW RI'LYLVLRQVSHFLILFDWLRQVHFWLRQVZKHQGLUHFWHGE\WKH&$5 & ,QFOXGHWKHIROORZLQJLQIRUPDWLRQLQWKHZULWWHQUHSRUW  ,GHQWLI\E\DSSOLFDEOHVSHFLILFDWLRQVHFWLRQDQGWHVWRULQVSHFWLRQPHWKRG  'DWHRIUHSRUWDQGQDPHDGGUHVVDQGWHOHSKRQHQXPEHURIILUPUHVSRQVLEOHIRUUHSRUW  1DPHVDQGVLJQDWXUHVRILQGLYLGXDOVSHUIRUPLQJWKHWHVWRULQVSHFWLRQDQGRILQGLYLGXDOV LVVXLQJWKHUHSRUW  'DWHVWLPHVWHPSHUDWXUHVZHDWKHUFRQGLWLRQVDQGORFDWLRQVRIWHVWVDQGLQVSHFWLRQV  &RPSOHWHLQVSHFWLRQRUWHVWGDWDUHVXOWVRIWHVWLQWHUSUHWDWLRQRIWHVWUHVXOWVFRPSOLDQFH ZLWKWKH&RQWUDFW'RFXPHQWVDQGUHFRPPHQGDWLRQVUHJDUGLQJUHWHVWLQJ ' 6XEPLWHOHFWURQLFFRSLHVRI)LHOG4XDOLW\&RQWURO'DWDZLWKLQGD\VRIWKHFRPSOHWLRQRI LQVSHFWLRQVDQGWHVWV 3$57352'8&76 12786(' 3$57(;(&87,21 12786(' &RXQFLO1R,([KLELW'3DJHRI Page 166 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 &RXQFLO1R,([KLELW'3DJHRI Page 167 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 68%0,77$/6 (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 168 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &216758&7,216&+('8/( &30  6(&7,21&216758&7,216&+('8/( &30  3$57*(1(5$/ 6(&7,21,1&/8'(6 $ 4XDOLW\DVVXUDQFH % )RUPDW & 6FKHGXOHV ' 6XEPLWWDOV ( 5HYLHZDQGHYDOXDWLRQ ) 8SGDWLQJVFKHGXOHV * 'LVWULEXWLRQ 5(/$7('6(&7,216 $ *HQHUDO&RQGLWLRQV6XSSOHPHQWDU\&RQGLWLRQVDQG'LYLVLRQVHFWLRQVDSSO\WRWKHZRUNRI WKLV6HFWLRQ 48$/,7<$6685$1&( $ 6FKHGXOHU&2175$&725 VSHUVRQQHOVSHFLDOL]LQJLQ&30VFKHGXOLQJZLWKRQH\HDU PLQLPXPH[SHULHQFHLQVFKHGXOLQJFRQVWUXFWLRQZRUNRIDFRPSOH[LW\FRPSDUDEOHWRWKLV 3URMHFWDQGKDYLQJXVHRIFRPSXWHUIDFLOLWLHVFDSDEOHRIGHOLYHULQJDGHWDLOHGJUDSKLFSULQWRXW ZLWKLQKRXUVRIUHTXHVW % &2175$&725 V$GPLQLVWUDWLYH3HUVRQQHO\HDUPLQLPXPH[SHULHQFHLQXVLQJDQG PRQLWRULQJ&30VFKHGXOHVRQFRPSDUDEOHSURMHFWV )250$7 $ /LVWLQJV5HDGLQJIURPOHIWWRULJKWLQDVFHQGLQJRUGHUIRUHDFKDFWLYLW\$FWLYLWLHV UHSUHVHQWLQJILHOGFRQVWUXFWLRQZRUNVKDOOKDYHGXUDWLRQVQRJUHDWHUWKDQZRUNLQJGD\V % 'LDJUDP6KHHW6L]HLQFKHVKLJKE\LQFKHVZLGH & 6FDOHDQG6SDFLQJ7RDOORZIRUQRWDWLRQVDQGUHYLVLRQV 6&+('8/(6 $ 3UHSDUHQHWZRUNDQDO\VLVGLDJUDPVLQSUHFHGHQFHIRUPDWDQGVXSSRUWLQJPDWKHPDWLFDO DQDO\VHVXVLQJWKH&ULWLFDO3DWK0HWKRG % ,OOXVWUDWHWKHRUGHUDQGLQWHUGHSHQGHQFHRIDFWLYLWLHVDQGVHTXHQFHRIZRUNKRZWKHVWDUWRID JLYHQDFWLYLW\GHSHQGVRQFRPSOHWLRQRISUHFHGLQJDFWLYLWLHVDQGKRZWKHFRPSOHWLRQRIWKH DFWLYLW\PD\UHVWUDLQWKHVWDUWRIVXEVHTXHQWDFWLYLWLHV & ,OOXVWUDWHFRPSOHWHVHTXHQFHRIFRQVWUXFWLRQE\DFWLYLW\LGHQWLI\LQJZRUNRIVHSDUDWHZRUN VWDJHVDQGW\SHV$FWLYLWLHVVKDOOEHJURXSHG ZLWKLGHQWLI\LQJEDQGLQJ E\FRGHV &RXQFLO1R,([KLELW'3DJHRI Page 169 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &216758&7,216&+('8/( &30  UHSUHVHQWLQJVWDJHVDQGZRUNW\SHV3URYLGHGDWHVIRUVXEPLWWDOIRUDSSURYDORIVDPSOHVDQG VKRSGUDZLQJV>LQFOXGLQJWKRVHIRU&281&,/IXUQLVKHGLWHPV@WKHSURFXUHPHQWRIFULWLFDO PDWHULDOVDQGHTXLSPHQWDQGWKHLULQVWDOODWLRQDQGFRPPLVVLRQLQJ7KHDFWLYLWLHVUHSUHVHQWLQJ PDWHULDODQGHTXLSPHQWSURFXUHPHQWVKDOOFRQWDLQWKHDSSURSULDWHVSHFLILFDWLRQVHFWLRQ QXPEHULQWKHDFWLYLW\GHVFULSWLRQ ' 0DWKHPDWLFDODQDO\VHV7DEXODWHHDFKDFWLYLW\RIGHWDLOHGQHWZRUNGLDJUDPVXVLQJFDOHQGDU GDWHVDQGLGHQWLI\IRUHDFKDFWLYLW\  3UHFHGLQJDQGVXFFHHGLQJDFWLYLW\QXPEHUV  $FWLYLW\GHVFULSWLRQ  (VWLPDWHGGXUDWLRQRIDFWLYLW\LQXQLWVRIGD\V  (DUOLHVWVWDUWGDWH E\FDOHQGDUGDWH   (DUOLHVWILQLVKGDWH E\FDOHQGDUGDWH   $FWXDOVWDUWGDWH E\FDOHQGDUGDWH   $FWXDOILQLVKGDWH E\FDOHQGDUGDWH   /DWHVWVWDUWGDWH E\FDOHQGDUGDWH   /DWHVWILQLVKGDWH E\FDOHQGDUGDWH   7RWDODQGIUHHIORDWRUVODFN  3HUFHQWDJHRIDFWLYLW\FRPSOHWHG  5HVSRQVLELOLW\IRUDFWLYLW\ &2175$&725VXEFRQWUDFWRUVXSSOLHUV  ( 5HTXLUHG6RUWV/LVWDFWLYLWLHVLQVRUWVRUJURXSV  %\WKHSUHFHGLQJZRUNLWHPRUHYHQWQXPEHUIURPORZHVWWRKLJKHVW  %\DPRXQWRIIORDWRUVODFNWKHQLQRUGHURIHDUO\VWDUW  %\UHVSRQVLELOLW\LQRUGHURIHDUOLHVWSRVVLEOHVWDUWGDWH  ,QRUGHURIODWHVWDOORZDEOHVWDUWGDWH  ,QRUGHURIODWHVWDOORZDEOHILQLVKGDWH  /LVWLQJRIEDVLFLQSXWGDWDWKDWJHQHUDWHVWKHUHSRUW  /LVWLQJRIDFWLYLWLHVRQWKHFULWLFDOSDWK  :HHNO\DFWLYLW\PDQSRZHUORDGLQJ LQPDQGD\V E\DFWLYLW\QXPEHUIURPORZHVWWR KLJKHVW  *UDSKLFDO:HHNO\DQGWRWDOPDQSRZHUSURMHFWLRQV  $FWLYLW\FRVWVKRZLQJDFWLYLW\RULJLQDOFRVWYDOXHFRPSOHWHSUHYLRXVO\SUHYLRXVFRVWWR GDWHSHULRGFRPSOHWHSHULRGHDUQHGFRVWFRPSOHWHWRGDWHWRWDOFRVWWRGDWHVRUWHG E\VWDJHVDQGDFWLYLW\QXPEHUIURPWKHORZHVWWRKLJKHVW &RXQFLO1R,([KLELW'3DJHRI Page 170 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &216758&7,216&+('8/( &30  68%0,77$/6)255(9,(: $ :LWKLQGD\VDIWHUWKHHIIHFWLYHGDWHRIWKH$JUHHPHQWVXEPLWWKHSURSRVHGSUHOLPLQDU\ QHWZRUNGLDJUDPGHILQLQJSODQQHGRSHUDWLRQVIRUWKHILUVWGD\VRI:RUNZLWKDJHQHUDO RXWOLQHIRUWKHUHPDLQGHURIWKH:RUN,QFOXGHWKHFRVWVRIDFWLYLWLHVH[SHFWHGWREHFRPSOHWHG RUSDUWLDOO\FRPSOHWHGEHIRUHVXEPLVVLRQDQGDSSURYDORIWKHFRPSOHWHQHWZRUNGLDJUDP % :LWKLQGD\VDIWHUWKH>HIIHFWLYHGDWHRIWKH$JUHHPHQWVXEPLWWKHGUDIWRIWKHSURSRVHG FRPSOHWHQHWZRUNGLDJUDPIRUUHYLHZ,QFOXGHZULWWHQFHUWLILFDWLRQWKDWPDMRU6XEFRQWUDFWRUV KDYHUHYLHZHGDQGDFFHSWHGWKHSURSRVHGVFKHGXOH & :LWKLQGD\VDIWHUWKHMRLQWUHYLHZRIWKHSURSRVHGFRPSOHWHQHWZRUNGLDJUDPVXEPLWWKH FRPSOHWHQHWZRUNDQDO\VLVFRQVLVWLQJRIQHWZRUNGLDJUDPVDQGPDWKHPDWLFDODQDO\VHV ' 6XEPLWXSGDWHGQHWZRUNVFKHGXOHVHYHU\GD\V ( 6XEPLWWKHQXPEHURIRSDTXHUHSURGXFWLRQVWKH&2175$&725UHTXLUHVSOXVWZRFRSLHV ZKLFKZLOOEHUHWDLQHGE\WKH&281&,/ 5(9,(:$1'(9$/8$7,21 $ 3DUWLFLSDWHLQMRLQWUHYLHZDQGHYDOXDWLRQRIWKHQHWZRUNGLDJUDPVDQGDQDO\VLVZLWKWKH&$5 DWHDFKVXEPLWWDODWDWLPHDQGSODFHGHWHUPLQHGE\WKH&$5 % (YDOXDWHSURMHFWVWDWXVWRGHWHUPLQHZRUNEHKLQGVFKHGXOHDQGZRUNDKHDGRIVFKHGXOH & $IWHUUHYLHZUHYLVHDVQHFHVVDU\DVDUHVXOWRIWKHUHYLHZDQGUHVXEPLWZLWKLQGD\V 83'$7,1*6&+('8/(6 $ 0DLQWDLQVFKHGXOHVWRUHFRUGDFWXDOVWDUWDQGILQLVKGDWHVRIFRPSOHWHGDFWLYLWLHV % ,QGLFDWHSURJUHVVRIHDFKDFWLYLW\WRGDWHRIUHYLVLRQZLWKSURMHFWHGFRPSOHWLRQGDWHRIHDFK DFWLYLW\$QQRWDWHGLDJUDPVWRJUDSKLFDOO\GHSLFWWKHFXUUHQWVWDWXVRI:RUN & ,QGLFDWHDFWLYLWLHVPRGLILHGVLQFHSUHYLRXVVXEPLWWDOPDMRUFKDQJHVLQ:RUNDQGRWKHU LGHQWLILDEOHFKDQJHV ' ,QGLFDWHFKDQJHVUHTXLUHGWRPDLQWDLQ'DWHRI6XEVWDQWLDO&RPSOHWLRQ ( 6XEPLWVRUWVUHTXLUHGWRVXSSRUWUHFRPPHQGHGFKDQJHV ) 3URYLGHDQDUUDWLYHUHSRUWWRGHILQHSUREOHPDUHDVDQWLFLSDWHGGHOD\VDQGLPSDFWRQWKH VFKHGXOH5HSRUWFRUUHFWLYHDFWLRQWDNHQRUSURSRVHGDQGLWVHIIHFW>LQFOXGLQJWKHHIIHFWVRI FKDQJHVDQGVFKHGXOHVRIVHSDUDWHFRQWUDFWRUV@ ',675,%87,21 $ )ROORZLQJMRLQWUHYLHZDQGXSGDWLQJGLVWULEXWHFRSLHVRIXSGDWHGVFKHGXOHVWR  &281&,/WZRFRSLHV  &281&,/6FKHGXOLQJ&RQVXOWDQWRQHHOHFWURQLFEDFNXSFRS\  6XEFRQWUDFWRUV  6XSSOLHUV &RXQFLO1R,([KLELW'3DJHRI Page 171 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &216758&7,216&+('8/( &30   2WKHUFRQFHUQHGSDUWLHV % ,QVWUXFWUHFLSLHQWVWRSURPSWO\UHSRUWLQZULWLQJSUREOHPVDQWLFLSDWHGE\SURMHFWLRQVVKRZQLQ WKHVFKHGXOHV 3$57352'8&76 6&+('8/,1*62)7:$5( 7KHQHWZRUNDQDO\VLVVFKHGXOLQJVRIWZDUHXVHGWRSURGXFHWKHVFKHGXOHDQGPDWKHPDWLFDO DQDO\VHVVKDOOEH3ULPDYHUD3URMHFW3ODQQHU 3 IRU:LQGRZV70RUDSSURYHGHTXDO 3$57(;(&87,21 5(63216,%,/,7<)256&+('8/(&203/,$1&( $ :KHQHYHUWKHFXUUHQWPRQWKO\FRQVWUXFWLRQVFKHGXOHDQGFRQVWUXFWLRQVWDWXVUHSRUWLQGLFDWHV WKDWGHOD\VWRWKHFULWLFDOSDWKKDYHUHVXOWHGRUZKHQVRGLUHFWHGE\WKH&$5WDNHVRPHRUDOO RIWKHIROORZLQJDFWLRQVDWQRDGGLWLRQDOFRVWWRWKH&281&,/ % 6XEPLWWRWKH&$5IRUDSSURYDODZULWWHQVWDWHPHQWRIWKHVWHSVWREHWDNHQWRUHPRYHRU DUUHVWWKHGHOD\WRWKHFULWLFDOSDWKLQWKHDSSURYHGVFKHGXOH & ,QFUHDVHFRQVWUXFWLRQPDQSRZHULQVXFKTXDQWLWLHVDQGFUDIWVDVZLOOVXEVWDQWLDOO\HOLPLQDWHLQ WKHMXGJPHQWRIWKH&$5WKHEDFNORJRIZRUN ' ,QFUHDVHWKHQXPEHURIZRUNLQJKRXUVSHUVKLIWVKLIWVSHUZRUNLQJGD\VZRUNLQJGD\VSHU ZHHNWKHDPRXQWRIFRQVWUXFWLRQHTXLSPHQWRUDQ\FRPELQDWLRQRIWKHIRUHJRLQJVXIILFLHQWO\ WRVXEVWDQWLDOO\HOLPLQDWHLQWKHMXGJPHQWRIWKH&$5WKHEDFNORJRIZRUN ( 5HVFKHGXOHDFWLYLWLHVWRDFKLHYHPD[LPXPSUDFWLFDOFRQFXUUHQFHRIDFFRPSOLVKPHQWRI DFWLYLWLHVDQGFRPSO\ZLWKWKHUHYLVHGVFKHGXOH ) &RVWVLQFXUUHGE\WKH&281&,/DULVLQJIURPVXFKOHQJWKHQLQJRIKRXUVLQFOXGLQJIXUQLVKLQJ RI,QVSHFWRUVVKDOOEHWKH&2175$&725 VUHVSRQVLELOLW\DQGVKDOOEHGHGXFWHGIURPPRQLHV GXHKLPKHU)DLOXUHRIWKH&2175$&725WRFRPSO\ZLWKWKHUHTXLUHPHQWVRIWKH&$5PD\ EHJURXQGVIRUGHWHUPLQDWLRQE\WKH&281&,/WKDWWKH&2175$&725LVQRWSURFHHGLQJDW VXFKUDWHVDVZLOOHQVXUHFRPSOHWLRQZLWKLQWKHVSHFLILHGWLPHDQGPD\UHVXOWLQWKH WHUPLQDWLRQRIWKHULJKWRIWKH&2175$&725WRFRQWLQXHWKHZRUN $'-8670(172)&2175$&76&+('8/($1'&203/(7,217,0( $ ,IWKH&2175$&725GHVLUHVWRPDNHFKDQJHVLQKLVPHWKRGRIRSHUDWLQJZKLFKDIIHFWWKH DSSURYHGFRQVWUXFWLRQVFKHGXOHQRWLI\WKH&$5LQZULWLQJVWDWLQJZKDWVFKHGXOHFKDQJHVDUH SURSRVHGDQGWKHUHDVRQIRUWKHFKDQJH,IWKH&$5DSSURYHVWKHVHFKDQJHVUHYLVHDQG VXEPLWIRUDSSURYDOZLWKRXWDGGLWLRQDOFRVWWRWKH&281&,/DOORIWKHDIIHFWHGSRUWLRQRIWKH &30QHWZRUN$GMXVWWKH&30VFKHGXOHRQO\DIWHUSULRUDSSURYDORIKLVSURSRVHGFKDQJHVE\ WKH&$5 % $GMXVWPHQWVPD\FRQVLVWRIFKDQJLQJSRUWLRQVRIWKHDFWLYLW\VHTXHQFHDQGRUDFWLYLW\ GXUDWLRQ¶VGLYLVLRQRIDSSURYHGDFWLYLWLHVRURWKHUDGMXVWPHQWVDVPD\EHDXWKRUL]HGE\WKH &$57KHDGGLWLRQRIH[WUDQHRXVQRQZRUNLQJDFWLYLWLHVDQGRUDFWLYLWLHVZKLFKDGGUHVWUDLQWV WRWKH&30VFKHGXOHVKDOOQRWEHDSSURYHG &RXQFLO1R,([KLELW'3DJHRI Page 172 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &216758&7,216&+('8/( &30  & ,IWKHFRPSOHWLRQRIDQ\DFWLYLW\ZKHWKHURUQRWFULWLFDOIDOOVPRUHWKDQRQHKXQGUHGSHUFHQW  EHKLQGLWVDSSURYHGGXUDWLRQVXEPLWIRUDSSURYDODVFKHGXOHDGMXVWPHQWVKRZLQJ HDFKVXFKDFWLYLW\GLYLGHGLQWRWZRDFWLYLWLHVUHIOHFWLQJFRPSOHWHGYHUVXVXQFRPSOHWHGZRUN ' 6KRSGUDZLQJVZKLFKDUHQRWDSSURYHGRQWKHILUVWVXEPLWWDORUZLWKLQWKHVFKHGXOHWLPHVKDOO EHLPPHGLDWHO\UHVFKHGXOHG ( 7KHFRQWUDFWFRPSOHWLRQWLPHZLOOEHDGMXVWHGRQO\IRUFDXVHVVSHFLILHGLQWKLVFRQWUDFW7R UHTXHVWDQH[WHQVLRQRIDQ\FRQWUDFWFRPSOHWLRQGDWHIXUQLVKVXFKMXVWLILFDWLRQDQGVXSSRUWLQJ HYLGHQFHDVWKH&$5PD\GHHPQHFHVVDU\IRUDGHWHUPLQDWLRQDVWRZKHWKHUWKH &2175$&725LVHQWLWOHGWRDQH[WHQVLRQRIWLPHXQGHUWKHSURYLVLRQVRIWKLVFRQWUDFW&$5 ZLOODIWHUUHFHLSWRIVXFKMXVWLILFDWLRQDQGVXSSRUWLQJHYLGHQFHPDNHILQGLQJVRIIDFWDQGZLOO DGYLVHWKH&2175$&725LQZULWLQJWKHUHRI,IWKH&$5ILQGVWKDWWKH&2175$&725LV HQWLWOHGWRDQ\H[WHQVLRQRIDQ\FRQWUDFWFRPSOHWLRQGDWHXQGHUWKHSURYLVLRQVRIWKLVFRQWUDFW WKH&$5 VGHWHUPLQDWLRQDVWRWKHWRWDOQXPEHURIGD\VH[WHQVLRQVKDOOEHEDVHGXSRQWKH FXUUHQWO\DSSURYHG&30VFKHGXOHDQGRQDOOGDWDUHOHYDQWWRWKHH[WHQVLRQ6XFKGDWDVKDOO EHLQFOXGHGLQWKHQH[WPRQWKO\XSGDWLQJRIWKHVFKHGXOH7KH&2175$&725DFNQRZOHGJHV DQGDJUHHVWKDWDFWXDOGHOD\VLQDFWLYLWLHVZKLFKDFFRUGLQJWRWKH&30VFKHGXOHGRQRW DIIHFWDQ\FRQWUDFWFRPSOHWLRQGDWHVKRZQE\WKHFULWLFDOSDWKLQWKHQHWZRUNGRQRWKDYHDQ\ HIIHFWRQWKHFRQWUDFWFRPSOHWLRQGDWHRUGDWHVDQGWKHUHIRUHZLOOQRWEHWKHEDVLVIRUD FKDQJHWKHUHLQ ) )URPWLPHWRWLPHLWPD\EHQHFHVVDU\IRUWKHFRQWUDFWVFKHGXOHDQGRUFRPSOHWLRQWLPHWREH DGMXVWHGE\WKH&$5WRUHIOHFWWKHHIIHFWVRIMREFRQGLWLRQVZHDWKHUVWULNHVXQDYRLGDEOH GHOD\VRQWKHSDUWRIWKH&281&,/RULWVUHSUHVHQWDWLYHVDQGRWKHUXQIRUHVHHDEOHFRQGLWLRQV ZKLFKPD\LQGLFDWHVFKHGXOHDGMXVWPHQWVDQGRUFRPSOHWLRQWLPHH[WHQVLRQ8QGHUVXFK FRQGLWLRQVUHVFKHGXOHWKHZRUNDQGRUFRQWUDFWFRPSOHWLRQWLPHWRUHIOHFWWKHFKDQJHG FRQGLWLRQVDQGUHYLVHWKHVFKHGXOHDFFRUGLQJO\,WLVVSHFLILFDOO\SRLQWHGRXWWKDWWKHXVHRI DYDLODEOHIORDWWLPHLQWKH&30VFKHGXOHPD\EHXVHGE\WKH&281&,/DVZHOODVE\WKH &2175$&725)ORDWWLPHLVGHILQHGDVWKHDPRXQWRIWLPHEHWZHHQWKHHDUO\VWDUWGDWH DQGWKHODWHVWDUWGDWHRUWKHHDUO\ILQLVKGDWHDQGWKHODWHILQLVKGDWHRIDQ\RIWKHDFWLYLWLHV LQWKHVFKHGXOH &225',1$7,1*6&+('8/(6:,7+27+(5&2175$&76&+('8/(6 $ :KHUHZRUNLVWREHSHUIRUPHGXQGHUWKLVFRQWUDFWFRQFXUUHQWO\ZLWKDQGRUFRQWLQJHQWXSRQ ZRUNSHUIRUPHGRQWKHVDPHIDFLOLWLHVRUDUHDXQGHURWKHUFRQWUDFWVFRRUGLQDWHWKLVFRQWUDFW V VFKHGXOHZLWKWKHVFKHGXOHVRIWKHRWKHUFRQWUDFWV2EWDLQWKHVFKHGXOHVRIWKHRWKHU DSSURSULDWHFRQWUDFWVIURPWKH&$5IRUWKHSUHSDUDWLRQDQGXSGDWLQJRIWKHFRQVWUXFWLRQ VFKHGXOHDQGPDNHWKHUHTXLUHGFKDQJHVLQWKHVFKHGXOHZKHQLQGLFDWHGE\FKDQJHVLQ FRUUHVSRQGLQJVFKHGXOHV 0($685(0(17$1'3$<0(17 $ $OOZRUNDQGFRVWVRIWKLV6HFWLRQVKDOOEHLQFLGHQWDOWRWKH3URMHFWDQGLQFOXGHGLQWKH727$/ %,' (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 173 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV $6%8,/76 6(&7,21$6%8,/76 3$57*(1(5$/ 6(&7,21,1&/8'(6 $ *HQHUDODVEXLOWUHTXLUHPHQWV '(),1,7,21 $ $V%XLOWV'UDZLQJVWDEOHVDQGRWKHULQIRUPDWLRQGHSLFWLQJWKHZRUNFRPSOHWHG$VEXLOWLV V\QRQ\PRXVZLWKUHGOLQHPDUNXSRUUHGPDUN$VEXLOWVDUHSURGXFHGE\WKH &2175$725RU&2175$&725 V6XEFRQWUDFWRUVYHQGRUVVXSSOLHUVRUPDQXIDFWXUHU V % $VOHIW7KHZRUNFRPSOHWHGRUWKHVLWHVWDWXVDWWKHHQGRIDZRUNGD\VKLIWRUYLVLW & 6XUYH\7HFKQLFLDQ)LHOGSHUVRQQHOLQFKDUJHRIPDNLQJILHOGVXUYH\REVHUYDWLRQVWRJDWKHU KRUL]RQWDODQGYHUWLFDOFRRUGLQDWHORFDWLRQGDWD &2175$&7255(63216,%,/,7,(6 $ 3URYLGHQHFHVVDU\HTXLSPHQWZRUNHUVDQGVXUYH\SHUVRQQHODVUHTXLUHGWRSURGXFHDV EXLOWV % 5HSHDWPHDVXUHPHQWVRUVXUYH\DQGPDNHFRUUHFWLRQVWRDQ\DVEXLOWGDWDRUGUDZLQJVDV UHTXLUHGE\WKH(1*,1((5SULRUWRWKHQH[WPRQWKO\DVEXLOWVXEPLWWDO 68%0,77$/6 $ 3UHFRQVWUXFWLRQVXEPLWWDO6XEPLWQDPHDQGGRFXPHQWDWLRQRIWKHTXDOLILFDWLRQVPHHWLQJWKH UHTXLUHPHQWVRIWKLVVHFWLRQIRUWKH6XUYH\7HFKQLFLDQ % 3URYLGHPRQWKO\VXEPLWWDOVRIDVEXLOWGDWDDQGGUDZLQJVIROORZLQJDOOWKHUHTXLUHPHQWVRIWKLV VHFWLRQDQGFRQVLVWHQWZLWK6(&7,2168%0,77$/6 & 6XEPLWWDOVVKDOOFRQWDLQWKHDVEXLOWGDWDDQGGUDZLQJVDVVSHFLILHGKHUHLQ3$57RIWKLV VHFWLRQ 48$/,7<$6685$1&( $ 6XUYH\GDWDVKDOOEHFROOHFWHGE\DVXUYH\WHFKQLFLDQ % 6XUYH\WHFKQLFLDQVKDOOKDYHDPLQLPXPRIWKUHH  \HDUVRIFRQVWUXFWLRQVXUYH\LQJSUDFWLFH RUOLFHQVHGDVD3URIHVVLRQDO/DQG6XUYH\RULQWKH6WDWHRI0LQQHVRWD7KUHH  \HDUVRI FRQVWUXFWLRQVXUYH\LQJSUDFWLFHFDQEHUHGXFHGWRRQH  \HDULIWKHVXUYH\WHFKQLFLDQKDV REWDLQHGFHUWLILFDWLRQIURPWKH1DWLRQDO6RFLHW\RI3URIHVVLRQDO6XUYH\RUV 1636 DVD/HYHO &HUWLILHG6XUYH\7HFKQLFLDQ &67  3$57352'8&76 12786(' 3$57(;(&87,21 *(1(5$/ &RXQFLO1R,([KLELW'3DJHRI Page 174 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV $6%8,/76 $ 6XEPLWDVEXLOWVWKDWVKRZDGGLWLRQVGHOHWLRQVDQGRWKHUFKDQJHVWKDWZHUHPDGHGXULQJ FRQVWUXFWLRQ/DEHODVEXLOWSODQVGUDZLQJVVFKHGXOHVDQGVXUYH\GDWDDV$6%8,/7ZLWK WKHFXUUHQWUHYLVLRQWLPHDQGGDWH([FHSWIRUVXUYH\GDWDLIZRUNZDVFRPSOHWHGDVVKRZQLQ WKHVH&RQWUDFW'RFXPHQWVDQGQRFKDQJHVZHUHPDGHPDUNWKHVHDVEXLOWVDV$6%8,/7 QRILHOGFKDQJHV % 3UHSDUHDQGGLVWULEXWHDVEXLOWVLQGLJLWDOIRUPDWDFFRUGLQJWRWKHUHTXLUHPHQWVRIWKLVVHFWLRQ 6XEPLWDOOGUDZLQJILOHVLQ3')IRUPDW3')PDUNXSVWKDWDUHUHDGDEOHWKURXJK$GREH $FUREDW5HDGHUŠDUHDFFHSWDEOH$VEXLOWGUDZLQJVVKRXOGQRWH[FHHG[RUOHGJHUSDJH VL]H & 6XEPLWDOOGLJLWDODVEXLOWVDWOHDVWRQFHDPRQWKDQGQRPRUHWKDQFDOHQGDUGD\VSDVWWKH FRQVWUXFWHGILHOGFKDQJH8SGDWHWKHSDSHUFRS\RIDOOHOHFWULFDODVEXLOWGUDZLQJVDVOHIWDQG OHDYHLQWKHDVVRFLDWHGHOHFWULFDORUFRQWUROVSDQHOGRFXPHQWDWLRQSRFNHW 6859(<'$7$ $ 2EWDLQWKHQRUWKLQJHDVWLQJDQGHOHYDWLRQRIXQGHUJURXQGIDFLOLWLHVSULRUWREDFNILOOLQJDQ\ WUHQFKHV&ROOHFWFRRUGLQDWHVDWHYHU\IHHWRISLSHFDEOHRUGXFWLQVWDOODWLRQDQGDWDQ\ XWLOLW\FURVVLQJKRUL]RQWDOEHQGYHUWLFDOEHQGMXQFWLRQWHHRUWUDQVLWLRQ&ROOHFWDOO FRRUGLQDWHVXVLQJWKH&RXQW\&RRUGLQDWH6\VWHPDWDVXEIRRWDFFXUDF\IRUQRUWKLQJVDQG HDVWLQJVDQGRQHWHQWKIRRWDFFXUDF\IRUHOHYDWLRQ % &ROOHFWFRRUGLQDWHVDWWKHFRUQHUVRIVXEVXUIDFHLQVWDOOHGVWUXFWXUHVRUDQ\H[SRVHG VWUXFWXUHVDQGEXULHGHOHFWULFDOFRQGXLWV&ROOHFWFRRUGLQDWHVXVLQJWKH&RXQW\&RRUGLQDWH 6\VWHPDWDRQHWHQWKIRRWDFFXUDF\IRUQRUWKLQJVHDVWLQJVDQGHOHYDWLRQV & &ROOHFWFRRUGLQDWHVRIWKHPHWHUDQGPHWHUYDXOWLQFOXGLQJULPHOHYDWLRQVWRSVODE LQWHUPHGLDWHODQGLQJORZHUZDONLQJVXUIDFHLQYHUWVRIXSVWUHDPDQGGRZQVWUHDPFRQQHFWLQJ SLSHVWKUHHLQYHUWVDFURVVWKHIOXPHHQWUDQFH DIWHUHQWU\HQGDGDSWHU WKUHHLQYHUWVDFURVV WKHIOXPHWKURDWHQWUDQFHWKUHHLQYHUWVDFURVVWKHIOXPHWKURDWH[LWDQGWKUHHLQYHUWVDFURVV WKHHQGRIWKHIOXPH¶VHQHUJ\UHFRYHU\VHFWLRQ&ROOHFWFRRUGLQDWHVXVLQJWKH&RXQW\ &RRUGLQDWH6\VWHPDWDRQHWHQWKIRRWDFFXUDF\IRUQRUWKLQJVHDVWLQJVDQGDWDRQH KXQGUHGWKIRRWDFFXUDF\IRUHOHYDWLRQV ' &ROOHFWFRRUGLQDWHVRIHYHU\JUDYLW\VHZHUPDQKROHLQFOXGLQJWKHLQYHUWVRIWKHPDQKROHDQG DOOFRQQHFWHGSLSLQJ&ROOHFWFRRUGLQDWHVXVLQJWKH&RXQW\&RRUGLQDWH6\VWHPDWDRQHWHQWK IRRWDFFXUDF\IRUQRUWKLQJVHDVWLQJVDQGDWDRQHKXQGUHGWKIRRWDFFXUDF\IRUHOHYDWLRQV ( 2EWDLQFRRUGLQDWHVRIVXUIDFHUHVWRUDWLRQIHDWXUHVLQFOXGLQJURDGZD\VLJQDJHK\GUDQWVVKXW RIIYDOYHVFXUEVGUDLQDJHEDVLQVPDQKROHVDFFHVVER[HVFDWKRGLFWHVWVWDWLRQVDQGWUDFHU ZLUHVWDWLRQV&ROOHFWFRRUGLQDWHVXVLQJWKH&RXQW\&RRUGLQDWH6\VWHPDWDRQHWHQWKIRRW DFFXUDF\IRUQRUWKLQJVHDVWLQJVDQGHOHYDWLRQV ) 3URYLGHDOODVEXLOWVXUYH\GDWDLQ3RLQW1XPEHU1RUWKLQJ(DVWLQJ(OHYDWLRQ3RLQW 'HVFULSWLRQ 31(=' FRPPDGHOLPLWHG FVY ILOH8VHSRLQWGHVFULSWLRQVIURPDGDWDGLFWLRQDU\ SURYLGHGE\WKH(1*,1((5,QFOXGHSURMHFWQXPEHUSURMHFWQDPHDQGUHYLVLRQGDWHDQGWLPH LQWKHILUVWOLQHRIWKHFVYILOH %8,/',1*'5$:,1*6 &RXQFLO1R,([KLELW'3DJHRI Page 175 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV $6%8,/76 $ 5HFRUGDOODGGLWLRQVGHOHWLRQVDQGILHOGFKDQJHVDVGUDZLQJPDUNXSV'UDZDUHYLVLRQFORXG DURXQGWKHFKDQJH$GGDUHYLVLRQGDWHWRWKHUHYLVLRQFORXG&URVVKDWFKDUHDVUHPRYHGDQG VKRZUHYLVHGOLQHZRUNZLWKGLPHQVLRQVWRDGMDFHQWZDOOVRURSHQLQJV8VHUHGWRGHQRWHDOO QHZJUDSKLFV 3$57 (48,30(17'5$:,1*6 $ 0DUNXS&RQWUDFW'UDZLQJVVXFKDVSLSLQJDQGHOHFWULFDOFRQQHFWLRQGLDJUDPVSODQYLHZVDQG HOHYDWLRQYLHZVVKRZLQJDFWXDOORFDWLRQRIHTXLSPHQWZLWKFOHDUDQFHGLPHQVLRQVWRQHDUE\ HTXLSPHQW (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 176 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV $6%8,/76 &RXQFLO1R,([KLELW'3DJHRI Page 177 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV ([FDYDWLRQ 6(&7,21 (;&$9$7,21 3$57 *(1(5$/  6(&7,21,1&/8'(6 $ ([DPLQDWLRQ % 3UHSDUDWLRQ & ([FDYDWLRQ'UDLQDJHDQG6WDELOL]DWLRQ ' 3UHSDUDWLRQ ( ([FDYDWLQJ2SHUDWLRQV ) 6WRUDJHDQG'LVSRVDORI([FDYDWHG0DWHULDOV * ([FDYDWLRQDQG'LVSRVDORI5RFNVDQG%RXOGHUV + 6LWH,QVSHFWLRQ , &OHDQXS  5()(5(1&(6 $ $PHULFDQ6RFLHW\IRU7HVWLQJDQG0DWHULDOV $670   & 6WDQGDUG7HVW0HWKRGIRU6LHYH$QDO\VLVRI)LQHDQG&RDUVH$JJUHJDWHV  ' 6WDQGDUG3UDFWLFHIRU6DPSOLQJ$JJUHJDWHV  ' 6WDQGDUG7HVW0HWKRGVIRU3DUWLFOH6L]H$QDO\VLVRI6RLOV  ' 6WDQGDUG7HVW0HWKRGVIRU/DERUDWRU\&RPSDFWLRQ&KDUDFWHULVWLFVRI6RLO8VLQJ 6WDQGDUG(IIRUW IWOEIIW  N1PP   ' 6WDQGDUG7HVW0HWKRGVIRU/DERUDWRU\&RPSDFWLRQ&KDUDFWHULVWLFVRI6RLO8VLQJ 0RGLILHG(IIRUW IWOEIIW  N1PP   ' 6WDQGDUG3UDFWLFHIRU&ODVVLILFDWLRQRI6RLOVIRU(QJLQHHULQJ3XUSRVHV 8QLILHG6RLO &ODVVLILFDWLRQ6\VWHP   ' 6WDQGDUG3UDFWLFHIRU'HVFULSWLRQDQG,GHQWLILFDWLRQRI6RLOV 9LVXDO0DQXDO 3URFHGXUH   ' 6WDQGDUG7HVW0HWKRGVIRU'HQVLW\RI6RLODQG6RLO$JJUHJDWHLQ3ODFHE\1XFOHDU 0HWKRGV 6KDOORZ'HSWK   ' 6WDQGDUG7HVW0HWKRGVIRU:DWHU&RQWHQWRI6RLODQG5RFNLQ3ODFHE\1XFOHDU 0HWKRGV 6KDOORZ'HSWK   ' 6WDQGDUG7HVW0HWKRGVIRU/LTXLG/LPLW3ODVWLF/LPLWDQG3ODVWLFLW\,QGH[RI6RLOV % &LW\(QJLQHHUV$VVRFLDWLRQRI0LQQHVRWD6WDQGDUG6SHFLILFDWLRQV & 6WDWHRI0LQQHVRWD'HSDUWPHQWRI7UDQVSRUWDWLRQ 0Q'27 6WDQGDUG6SHFLILFDWLRQIRU &RQVWUXFWLRQ  '(),1,7,216 $ %RUURZPDWHULDOPDWHULDOUHTXLUHGIRUFRQVWUXFWLRQWKDWLVQRWDYDLODEOHRUQRWWREHREWDLQHGIURP SURMHFWH[FDYDWLRQV % &ODVVLILHGH[FDYDWLRQ$Q\H[FDYDWLRQPHHWLQJRQHRIWKHIROORZLQJGHILQLWLRQV 0Q'27 PXFNFRPPRQFKDQQHORUURFN & &OHDU5RFN6RUWHGDQGZDVKHGURFNXVHGIRUGUDLQDJHDQGH[FDYDWLRQVWDELOL]DWLRQ ' ([FDYDWHGPDWHULDOVVRLOPDWHULDOVH[FDYDWHGIURPWUHQFKIRXQGDWLRQRUSURMHFWVLWH ( 0XFN([FDYDWLRQ$VGHILQHGLQ0Q'27 &RXQFLO1R,([KLELW'3DJHRI Page 178 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV ([FDYDWLRQ ) 5RFN0Q'27$3DYHPHQWVKDOOQRWEHFRQVLGHUHGURFN * 6DOYDJH0DWHULDO$VGHILQHGLQ0Q'27 + 6XEJUDGH([FDYDWLRQ$VGHILQHGLQ0Q'27 , 6XEVRLO7KHPLQHUDOVRLOKRUL]RQLPPHGLDWHO\EHORZWKHWRSVRLOXVXDOO\FRQWDLQLQJQRRUOLWWOH RUJDQLFPDWHULDO - 6XLWDEOH)LOO%RUURZDQGVLWHPDWHULDOVQRWFRQWDLQLQJXQVXLWDEOHPDWHULDOVDQGPHHWLQJWKH PDWHULDOUHTXLUHPHQWVGHILQHGLQ6(&7,21),//$1'%$&.),//IRUHDFKILOODQG HPEDQNPHQWXVH . 8QFODVVLILHG([FDYDWLRQ$VGHILQHGLQ0Q'27,QFOXGHVDOOH[FDYDWLRQVH[FHSWPXFN FRPPRQFKDQQHORUURFNUHJDUGOHVVRIFKDUDFWHURUFODVVLILFDWLRQRIPDWHULDO / 8QVXLWDEOH0DWHULDOV5RRWVRURWKHURUJDQLFPDWWHUWUDVKUHIXVHGHEULVIUR]HQPDWHULDOVURFN RURWKHUPDWHULDOVQRWGHILQHGIRUXVHDVEDFNILOORUDUHWRRZHWWRREWDLQVSHFLILHGFRPSDFWLRQ UDWHV  68%0,77$/6 $ 3URYLGHIROORZLQJVXEPLWWDOVFRQVLVWHQWZLWK6(&7,2168%0,77$/6  ([FDYDWLRQ3ODQ6KRS'UDZLQJV D 0HWKRGVDQGVHTXHQFLQJRIH[FDYDWLRQ E 3URSRVHGORFDWLRQVRIVWRFNSLOHGH[FDYDWHGPDWHULDO F 3URSRVHGRQVLWHDQGRIIVLWHVSRLOGLVSRVDOVLWHV G 1XPEHUVW\SHVDQGVL]HVRIHTXLSPHQWSURSRVHGWRSHUIRUPH[FDYDWLRQV H $QWLFLSDWHGGLIILFXOWLHVDQGSURSRVHGUHVROXWLRQV I 5HFODPDWLRQRIRQVLWHVSRLOGLVSRVDODUHDV J 1XPEHUW\SHVDQGVL]HVRIHTXLSPHQWSURSRVHGWRSHUIRUPFOHDQLQJDQGVWUHHWVZHHSLQJ K /LVWRIVLWHFRQWDFWVUHVSRQVLELOLWLHVDQGVLWHSKRQHQXPEHUV  ([FDYDWLRQ6XSSRUW3ODQ([FDYDWLRQVXSSRUWFDOFXODWLRQVDQGGHWDLOVVKDOOEHFHUWLILHGE\D 3URIHVVLRQDO(QJLQHHUOLFHQVHGLQWKH6WDWHRI0LQQHVRWDDQGLQFOXGH D 'HVLJQDVVXPSWLRQVDQGFDOFXODWLRQV E 6KHHWLQJW\SHVL]HPDWHULDOSURSHUWLHVSHQHWUDWLRQORFDWLRQ V LQVWDOODWLRQHTXLSPHQW F %UDFLQJW\SHVL]HPDWHULDOSURSHUWLHVORFDWLRQ G /D\RXWSODQDQGSURILOHRIH[FDYDWLRQEUDFLQJV\VWHP H $QWLFLSDWHGGLIILFXOWLHVDQGSURSRVHGUHVROXWLRQV Ĩ͘0LQLPXPODWHUDOGLVWDQFHIURPWKHFUHVWRIVORSHVIRUYHKLFOHVHTXLSPHQWDQGVWRFNSLOHG H[FDYDWHGPDWHULDOV  'HZDWHULQJ3ODQ D 2EVHUYDWLRQZHOOORFDWLRQV E 'HHSZHOOORFDWLRQVSXPSVL]H V KHDGHUVL]H V  F :HOOSRLQWORFDWLRQVKHDGHUVL]H V  G 6XPSSLWGHSWK V VL]H V ORFDWLRQ V SXPSLQJUHTXLUHPHQWV H )ORZPHWHUW\SHVDQGORFDWLRQ I )ORZUHFRUGLQJDQGUHSRUWLQJSODQ J 6\VWHPHOHFWULFDOUHTXLUHPHQWVDQGJHQHUDWLRQHTXLSPHQW K 2XWOHWFKDQQHOORFDWLRQ V  L 2XWOHWHURVLRQDQGVHGLPHQWDWLRQFRQWURO M 6XUIDFHZDWHUUXQRIIFROOHFWLRQV\VWHP  )LHOGTXDOLW\FRQWUROWHVWUHVXOWV  (;,67,1*&21',7,216 $ 3URMHFWVLWHVXEVXUIDFHLQIRUPDWLRQLVSURYLGHGLQ9ROXPHRI&RQWUDFW'RFXPHQWV  6(48(1&,1*$1'6&+('8/,1* &RXQFLO1R,([KLELW'3DJHRI Page 179 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV ([FDYDWLRQ $ &RRUGLQDWHH[FDYDWLRQZLWKGHYHORSPHQWZRUNFRQGXFWHGRQDGMDFHQWSURSHUWLHVE\/HQQDU % &OHDULQJJUXEELQJDQGVWULSSLQJ&RRUGLQDWHZLWKGHYHORSPHQWZRUNFRQGXFWHGE\/HQQDUDQG FRRUGLQDWHVHGLPHQWDWLRQDQGHURVLRQFRQWUROZLWKWKHGHYHORSPHQWZLGHVLWHSODQVSULRUWR H[FDYDWLQJ & 'HZDWHULQJ&RQIRUPZLWKWKH'HZDWHULQJ3ODQSULRUWRLQLWLDWLQJH[FDYDWLRQ ' ([FDYDWLRQVXSSRUW,QVWDOODQGPDLQWDLQDVQHFHVVDU\WRVXSSRUWVLGHVRIH[FDYDWLRQVDQG SUHYHQWGHWULPHQWDOVHWWOHPHQWDQGODWHUDOPRYHPHQWRIH[LVWLQJIDFLOLWLHVDGMDFHQWSURSHUW\DQG FRPSOHWHGZRUN 3$57 352'8&76  0$7(5,$/6 $ &OHDU5RFN&OHDQò±LQFKPLQXVVRUWHGDQGZDVKHGFUXVKHGURFNH[FOXGLQJFUXVKHG FDUERQDWHURFNDQGIUHHRIFOD\EDOOVGHEULVDQGRUJDQLFPDWHULDOVSHUFHQWUHWDLQHGE\WKH VLHYH 3$57 (;(&87,21  (;$0,1$7,21 $ 3ULRUWRFRQVWUXFWLRQLQVSHFWH[LVWLQJXWLOLW\VWUXFWXUHVDQGVXUIDFHIHDWXUHVZLWK&$5DQG GRFXPHQWFRQGLWLRQ % 9HULI\ZLWK&$5WKDWSHUPLWVQHFHVVDU\WRGRZRUNDUHREWDLQHG  35(3$5$7,21 $ &RPSO\ZLWKWKHUHTXLUHPHQWVRI$UWLFOHRI6(&7,21*(1(5$/&21',7,216IRUWKH PDUNLQJRIXWLOLW\ORFDWLRQVDQGSURWHFWLQJXQGHUJURXQGIDFLOLWLHV&281&,/ZLOOORFDWH&281&,/ RZQHGXWLOLWLHVRQHWLPH&2175$&725VKDOOUHLPEXUVH&281&,/IRUUHORFDWLQJ&281&,/¶V XQGHUJURXQGXWLOLWLHV % ,PSOHPHQWWUDIILFFRQWURO3ODFHDQGPDLQWDLQWUDIILFZDUQLQJVLJQVEDUULFDGHVJXDUGVDQG ZDUQLQJOLJKWV & 6WDNHH[FDYDWLRQOLPLWV0DLQWDLQDFWLYLWLHVZLWKLQOLPLWVVKRZQIRUWKHSURSHUW\ERXQGV,IZRUN H[WHQGVEH\RQGERXQGVFRRUGLQDWHZLWKRWKHUFRQVWUXFWLRQFRQGXFWHGE\/HQQDU ' 3URWHFWVXUIDFHIHDWXUHVWKDWDUHQRWGHVLJQDWHGWREHUHPRYHG&RPSOHWHWHPSRUDU\UHPRYDOV RIVXUIDFHIHDWXUHV6DZFXWSDYHPHQWDORQJVWUDLJKWOLQHVEHIRUHH[FDYDWLRQ,QVWDOOPDLOER[HV IRUWHPSRUDU\VHUYLFHLIQHFHVVDU\ ( &OHDUDQGJUXE6WULSRIIWRSVRLOWRDOLQHWZRIHHWRXWVLGHRIDUHDVWREHH[FDYDWHGDQGVWRFNSLOH 'RQRWVWULSZLWKLQWKHGULSOLQH EUDQFKVSUHDG RIWUHHVLGHQWLILHGWRUHPDLQ6HSDUDWHDQG GLVSRVHRIDVDSSURSULDWHDQ\YHJHWDWLRQWUDVKVWRQHVRYHUWZRLQFKHVLQGLDPHWHUDQGRWKHU H[WUDQHRXVPDWHULDOIURPVDOYDJHDEOHWRSVRLO6WRFNSLOHDQGSURWHFWVDOYDJHDEOHWRSVRLOXQWLOLWLV XVHGLQODQGVFDSLQJWRSVRLOLQJVRGGLQJRUVHHGLQJRSHUDWLRQV$YRLGPL[LQJWRSVRLOZLWK VXEVRLO/DQGVFDSHSURSHUW\LQFRRUGLQDWLRQZLWK/HQQDU¶VVLWHGHYHORSPHQWSODQV ) 3URWHFWVXUYH\PRQXPHQWV * ,QVWDOODQGPDLQWDLQH[FDYDWLRQVXSSRUWV\VWHPVDVVKRZQRUDVUHTXLUHGDFFRUGLQJWRWKH VXEPLWWHGLQWKHH[FDYDWLRQVXSSRUWSODQ  (;&$9$7,21'5$,1$*($1'67$%,/,=$7,21 $ &RQIRUPWRWKHDSSOLFDEOHUHTXLUHPHQWVRI/HQQDU¶VGHYHORSPHQWZLGHGUDLQDJHSODQVDOO UHJXODWLRQVDQGSHUPLWV&RQVWUXFWGHZDWHULQJZHOOSRLQWVRUVXPSSLWVFRQVLVWHQWZLWKWKH GHZDWHULQJSODQ % 'HZDWHUDOODUHDVWRUHFHLYHILOOWR±IRRWEHORZJUDGHSULRUWRSUHSDUDWLRQIRUILOORUHPEDQNPHQW 5HPRYHZDWHULQDPDQQHUWKDWPLQLPL]HVVRLOHURVLRQ &RXQFLO1R,([KLELW'3DJHRI Page 180 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV ([FDYDWLRQ & 'LUHFWVXUIDFHDQGJURXQGZDWHUGLVFKDUJHVWRQDWXUDOGUDLQDJHFKDQQHOVGUDLQVRUVWRUP VHZHUV3URYLGHHQHUJ\GLVVLSDWLRQDQGVHGLPHQWDWLRQEDVLQVDWGLVFKDUJHSRLQW ' 3URYLGHFRQWLQXRXVZDWHUFRQWUROXQWLOEDFNILOOLVFRPSOHWH ( ,QDUHDVZKHUHGHZDWHULQJE\VXPSSLWRUZHOOSRLQWFDQQRWDGHTXDWHO\UHPRYHZDWHUDWWKH GLVFUHWLRQRIWKH&2175$&725DQGDSSURYDORIWKH&$5FRQVWUXFWDOWHUQDWHGUDLQDJHXVLQJWKH IROORZLQJPHDQV  2YHUH[FDYDWHDVUHTXLUHGWRVORSHFXWWRZDUGGHZDWHULQJVXPSRUQDWXUDOGUDLQDJH5HPRYH DOOPDWHULDOVORXJKHGIURPH[FDYDWLRQRUWUHQFKZDOOV  %DFNILOOWRZRUNLQJJUDGHOLQHXVLQJ&OHDU5RFNDVVSHFLILHGDERYH%HGGLQJDQGFRPSDFWLRQ UHTXLUHPHQWVIRU&OHDU5RFNVKDOOEHLGHQWLFDOWRWKHEHGGLQJDQGFRPSDFWLRQUHTXLUHPHQWVRI WKHRYHUO\LQJPDWHULDOV  6HSDUDWH&OHDU5RFNPDWHULDOIURPDOOQDWXUDORULPSRUWHGPDWHULDOXVLQJ*HRWH[WLOH)DEULFDV VSHFLILHGLQ01'27  2YHUODSDOO*HRWH[WLOH)DEULFDPLQLPXPRIIHHW,QSLSHWUHQFKHVWKHIDEULFVKDOOEH RYHUODSSHGIHHWORQJLWXGLQDODQGIHHWWUDQVYHUVHWRWKHWUHQFK  &RPSDFWHDFKOLIWVRDVWRSURYLGHDILUPXQ\LHOGLQJVXSSRUWIRUWKHRYHUO\LQJPDWHULDO  &RQVWUXFWLQJDOWHUQDWHGUDLQDJHLQFOXGLQJDOOPDWHULDOVVKDOOEHLQFLGHQWDOWRWKHSURMHFW  7(67,1*$1',163(&7,21 $ 7KH&2175$&725VKDOOFRRUGLQDWHZLWKDQGVFKHGXOH,7/WRSHUIRUPWKHIROORZLQJWHVWVDV GLUHFWHGE\WKH&$5 % %RUURZ0DWHULDO*UDGDWLRQ7HVWV  &OHDU5RFNWHVWSHUFXELF\DUGV ORRVHYROXPH  & &2175$&725VKDOOGHOLYHUWRWKH,7/VDPSOHVFROOHFWHGLQDFFRUGDQFHZLWK$670'DV IROORZV  &OHDU5RFNWHVWSHUFXELF\DUGV ORRVHYROXPH   (;&$9$7,1*23(5$7,216 $ ([FDYDWLRQLVXQFODVVLILHG&RPSOHWHH[FDYDWLRQUHJDUGOHVVRIWKHW\SHQDWXUHRUFRQGLWLRQRI WKHPDWHULDOVHQFRXQWHUHG % ([FDYDWHVKDSHDQGSUHSDUHDOOVRLOVWRWKHHOHYDWLRQVDQGGLPHQVLRQVVKRZQDQGLQ FRRUGLQDWLRQZLWKDGMDFHQWSURSHUWLHVGHYHORSHGE\/HQQDU3HUIRUPDGGLWLRQDOH[FDYDWLRQDV UHTXLUHGIRUFRQVWUXFWLRQRSHUDWLRQVIRUPLQJDQGLQVSHFWLRQ)RRWLQJVDQGIRXQGDWLRQVWRUHVWRQ XQGLVWXUEHGVRLOXQOHVVVKRZQRWKHUZLVH & 3URYLGHWHPSRUDU\VXSSRUWRIH[LVWLQJXWLOLWLHVORFDWHGZLWKLQH[FDYDWLRQ ' 6ORSHV([FDYDWHGWRDWOHDVWWKHDQJOHRIUHSRVHRUEUDFHVKRUHRUVKHHWDVUHTXLUHGE\ 26+$&)53DUW ( 6HJUHJDWH6XLWDEOH)LOOPHHWLQJWKHUHTXLUHPHQWVRI6(&7,21),//$1'%$&.),//IRU UHXVHRQVLWHIURPWKHUHPDLQLQJH[FDYDWHGPDWHULDO6WRUHDOOPDWHULDOVDFFRUGLQJWR$UWLFOH ) 8WLOLWLHV  8QOHVVVKRZQWREHUHPRYHGSURWHFWDFWLYHXWLOLW\OLQHVVKRZQRQWKH'UDZLQJVRURWKHUZLVH PDGHNQRZQWRWKH&2175$&725SULRUWRH[FDYDWLRQ,IGDPDJHGUHSDLURUUHSODFH  ,IDFWLYHXWLOLW\OLQHVDUHHQFRXQWHUHGDQGDUHQRWVKRZQRQWKH'UDZLQJVRURWKHUZLVHPDGH NQRZQWRWKH&2175$&725SURPSWO\WDNHQHFHVVDU\VWHSVWRDVVXUHWKDWVHUYLFHLVQRW LQWHUUXSWHG  ,IH[LVWLQJXWLOLWLHVDUHIRXQGWRLQWHUIHUHZLWKWKHSHUPDQHQWVXEVXUIDFHZRUNEHLQJ FRQVWUXFWHGXQGHUWKLV6HFWLRQLPPHGLDWHO\QRWLI\WKH&$5 &RXQFLO1R,([KLELW'3DJHRI Page 181 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV ([FDYDWLRQ  'RQRWSURFHHGZLWKSHUPDQHQWUHORFDWLRQRIXWLOLWLHVXQWLOZULWWHQLQVWUXFWLRQVDUHUHFHLYHG IURPWKH&$5 * 7UHQFKLQJ  3LSH(QYHORSH([FDYDWHWRWUHQFKZLGWKDQGLQLWLDOEDFNILOOGHSWKDVVKRZQ:LGWKDWWRSRI H[FDYDWLRQZLOOYDU\GHSHQGLQJRQQDWLYHVRLOW\SHDQGGHSWKRIWUHQFK  )LUP6XEJUDGH*UDGHZLWKKDQGWRROVUHPRYHORRVHDQGGLVWXUEHGPDWHULDODQGWULPRIIKLJK DUHDVDQGULGJHVOHIWE\H[FDYDWLQJEXFNHWWHHWK$OORZVSDFHIRU%HGGLQJ0DWHULDOLIVKRZQ RUVSHFLILHG  8QVWDEOH6XEJUDGH,IVXEJUDGHLVHQFRXQWHUHGWKDWPD\UHTXLUHUHPRYDOWRSUHYHQWSLSH VHWWOHPHQWQRWLI\&$5&$5ZLOOGHWHUPLQHWKHGHSWKRIRYHUH[FDYDWLRQLIDQ\UHTXLUHG  5HPRYHDOOVKHHWLQJLQWKHWUHQFKHVH[FHSWZKHQLQWKHRSLQLRQRIWKH&$5ILHOGFRQGLWLRQV RUWKHW\SHRIVKHHWLQJRUPHWKRGVRIFRQVWUXFWLRQVXFKDVXVHRIFRQFUHWHEHGGLQJDUHVXFK DVWRPDNHUHPRYDORIVKHHWLQJLPSUDFWLFDO,QVXFKFDVHV&$5PD\SHUPLWSRUWLRQVRI VKHHWLQJWREHFXWRIIDQGUHPDLQLQWKHWUHQFK + 3URWHFWLRQRISHUVRQVDQGSURSHUW\  %DUULFDGHRUIHQFHRSHQKROHVDQGGHSUHVVLRQVRFFXUULQJDVSDUWRIWKH:RUNDQGSRVW ZDUQLQJOLJKWVRQSURSHUW\DGMDFHQWWRRUZLWKLQSXEOLFDFFHVV  2SHUDWHZDUQLQJOLJKWVGXULQJKRXUVIURPGXVNWRGDZQHDFKGD\DQGDVRWKHUZLVHUHTXLUHG  3URWHFWVWUXFWXUHVXWLOLWLHVVLGHZDONVSDYHPHQWVDQGRWKHUIDFLOLWLHVIURPGDPDJHFDXVHGE\ VHWWOHPHQWODWHUDOPRYHPHQWZDVKRXWDQGRWKHUKD]DUGVFUHDWHGE\SHUIRUPDQFHRIWKH ZRUNXQGHUWKLV6HFWLRQ , 8VHPHDQVQHFHVVDU\WRSUHYHQWGXVWEHFRPLQJDQXLVDQFHWRWKHSXEOLFWRQHLJKERUVDQGWR RWKHUZRUNEHLQJSHUIRUPHGRQRUQHDUWKHVLWH - 0DLQWDLQDFFHVVWRDGMDFHQWDUHDVDWDOOWLPHV . ([FDYDWHIRUURDGZD\VXEJUDGHVLQDFFRUGDQFHZLWK0Q'27  6725$*($1'',6326$/2)(;&$9$7('0$7(5,$/6 $ 6WRFNSLOLQJ([FDYDWHG0DWHULDO  6WRFNSLOHH[FDYDWHGPDWHULDOWKDWLVVXLWDEOHIRUXVHDVILOORUEDFNILOOXQWLOPDWHULDOLVQHHGHG  &RQILQHVWRFNSLOHVWRZLWKLQHDVHPHQWVULJKWVRIZD\DQGDSSURYHGZRUNDUHDV'RQRW REVWUXFWURDGVVWUHHWVGULYHZD\VRUVLGHZDONV  'RQRWVWRFNSLOHH[FDYDWHGPDWHULDODGMDFHQWWRWUHQFKHVDQGRWKHUH[FDYDWLRQVXQOHVV H[FDYDWLRQVLGHVORSHVDQGH[FDYDWLRQVXSSRUWV\VWHPVDUHGHVLJQHGFRQVWUXFWHGDQG PDLQWDLQHGIRUVWRFNSLOHORDGV  'RQRWVWRFNSLOHH[FDYDWHGPDWHULDOVQHDURURYHUH[LVWLQJIDFLOLWLHVDGMDFHQWSURSHUW\RU FRPSOHWHGZRUNXQOHVVDSSURYHGLQZULWLQJE\&$5DVSDUWRIH[FDYDWLRQRUILOOLQJSODQ  6WRUHH[FDYDWHGPDWHULDORXWVLGHRIGHOLQHDWHGZHWODQGDUHDV  6WRFNSLOHPDWHULDOVLQDUHDVDSSURYHGE\/HQQDUDQGLQFRRUGLQDWLRQZLWKZRUNDWDGMDFHQW SURSHUWLHV % 'LVSRVDORI6SRLO  'LVSRVHRIH[FDYDWHGPDWHULDOVZKLFKDUHXQVXLWDEOHRUQRWQHHGHGIRUILOORUEDFNILOOLQ GHVLJQDWHGVSRLOGLVSRVDODUHDVDVLQGLFDWHGE\/HQQDU  (;&$9$7,21$1'',6326$/52&.6$1'%28/'(56 $ 5RFNH[FDYDWLRQPD\EHSHUIRUPHGE\MDFNKDPPHULQJH[SDQVLYHFKHPLFDOVSOLWWLQJRURWKHU VLPLODUSURFHVV1REODVWLQJZLOOEHDOORZHG % 8QXVHGURFNDQGERXOGHUVVKDOOEHUHPRYHGDQGGLVSRVHGRIRIIVLWHDWQRDGGLWLRQDOH[SHQVHWR WKH&281&,/  6,7(,163(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 182 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV ([FDYDWLRQ $ ,QWKHHYHQWWKHLQVSHFWLRQVLQGLFDWHWKHZRUNKDVQRWEHHQSHUIRUPHGLQDFFRUGDQFHZLWKWKH 'UDZLQJVDQG6SHFLILFDWLRQVWKHPDWHULDOVVKDOOEHUHPRYHGDQGWKHZRUNUHGRQHDQGUHWHVWHG  &/($183 $ 5HPRYHDOOVXUSOXVDQGGLVFDUGHGPDWHULDOVHTXLSPHQWUXEELVKDQGWHPSRUDU\VWUXFWXUHVRQDOO SDUWVRIWKH:RUN7KHSURMHFWVLWHVKDOOEHOHIWLQDFOHDQDQGDFFHSWDEOHFRQGLWLRQ (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 183 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO 6(&7,21 ),//$1'%$&.),// 3$57 *(1(5$/  6(&7,21,1&/8'(6 $ ([DPLQDWLRQ % ([FDYDWLRQ'UDLQDJHDQG6WDELOL]DWLRQ & 3UHSDUDWLRQ ' *HQHUDO3URFHGXUHV ( ,QLWLDO%DFNILOO ) %DFNILOODQG&RPSDFWLRQ * 6XEJUDGH3UHSDUDWLRQIRU5RDGZD\V6ODEVDQGRWKHU3DYHPHQWV + 3ODFLQJ(PEDQNPHQWV , 5LSUDS3ODFHPHQW - )LQLVK*UDGLQJ . 7HVWLQJDQG,QVSHFWLRQ / 7ROHUDQFHVDQG:DUUDQW\   5()(5(1&(6 $ $PHULFDQ6RFLHW\IRU7HVWLQJDQG0DWHULDOV $670   & 6WDQGDUG6SHFLILFDWLRQIRU&RQFUHWH$JJUHJDWHV  & 6WDQGDUG7HVW0HWKRGIRU0DWHULDOV)LQHUWKDQ—P 1R 6LHYHLQ0LQHUDO $JJUHJDWHVE\:DVKLQJ  & 6SHFLILFDWLRQIRU5HDG\0L[HG&RQFUHWH  & 6WDQGDUG7HVW0HWKRGIRU6LHYH$QDO\VLVRI)LQHDQG&RDUVH$JJUHJDWHV  & 3RUWODQG&HPHQW  & 6WDQGDUG6SHFLILFDWLRQIRU/LJKWZHLJKW$JJUHJDWHIRU&RQFUHWH0DVRQU\8QLWV  & 6WDQGDUG6SHFLILFDWLRQIRU5LJLG&HOOXODU3RO\VW\UHQH7KHUPDO,QVXODWLRQ  & )O\$VKDQG5DZRU&DOFLQHG1DWXUDO3R]]RODQIRUXVHDVD0LQHUDO$GPL[WXUHLQ 3RUWODQG&HPHQW&RQFUHWH  ' 6WDQGDUG&ODVVLILFDWLRQRI6RLOVIRU(QJLQHHULQJ3XUSRVHV  ' 6WDQGDUG*XLGHIRU,QYHVWLJDWLQJDQG6DPSOLQJ6RLODQG5RFN  ' 6WDQGDUG7HVW0HWKRGIRU3DUWLFOH6L]H$QDO\VLVRI6RLOV  ' 6WDQGDUG3UDFWLFHIRU6DPSOLQJ$JJUHJDWHV  ' 6WDQGDUG7HVW0HWKRGVIRU/DERUDWRU\&RPSDFWLRQ&KDUDFWHULVWLFVRI6RLO8VLQJ 6WDQGDUG(IIRUW IHHWOEIIHHW  N1PP @  ' 6WDQGDUG7HVW0HWKRGIRU'HQVLW\RI6RLOLQ3ODFHE\WKH6DQG&RQH0HWKRG  ' 6WDQGDUG&ODVVLILFDWLRQRI6RLOVIRU(QJLQHHULQJ3XUSRVHV  ' 6WDQGDUG3UDFWLFHIRU'HVFULSWLRQDQG,GHQWLILFDWLRQRI6RLOV 9LVXDO0DQXDO 3URFHGXUH   ' 6WDQGDUG7HVW0HWKRGVIRU'HQVLW\RI6RLODQG6RLO$JJUHJDWHLQ3ODFHE\1XFOHDU 0HWKRGV 6KDOORZ'HSWK   ' 6WDQGDUG7HVW0HWKRGVIRU:DWHU&RQWHQWRI6RLODQG5RFNLQ3ODFHE\1XFOHDU 0HWKRGV 6KDOORZ'HSWK  &RXQFLO1R,([KLELW'3DJHRI Page 184 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO  ' 6WDQGDUG7HVW0HWKRGVIRU0D[LPXP,QGH['HQVLW\RI6RLOV8VLQJD9LEUDWRU\ 7DEOH  ' 6WDQGDUG7HVW0HWKRGVIRU0LQLPXP,QGH['HQVLW\RI6RLOVDQG&DOFXODWLRQRI 5HODWLYH'HQVLW\  ' 6WDQGDUG7HVW0HWKRGVIRU/LTXLG/LPLW3ODVWLF/LPLWDQG3ODVWLFLW\,QGH[RI6RLOV  '3UHSDUDWLRQDQG7HVWLQJRI6RLO&HPHQW6OXUU\7HVW&\OLQGHUV % 6WDWHRI0LQQHVRWD'HSDUWPHQWRI7UDQVSRUWDWLRQ 0Q'27 6WDQGDUG6SHFLILFDWLRQVIRU &RQVWUXFWLRQ & &LW\(QJLQHHUV$VVRFLDWLRQRI0LQQHVRWD6WDQGDUG6SHFLILFDWLRQV ' $PHULFDQ1DWLRQDO6WDQGDUGV,QVWLWXWH $16,   6WDQGDUG3UDFWLFHIRU'LUHFW'HVLJQRI%XULHG3UHFDVW&RQFUHWH3LSH8VLQJ6WDQGDUG ,QVWDOODWLRQV 6,''   = 6DIHW\&RORU&RGH ( $PHULFDQ3XEOLF:RUNV$VVRFLDWLRQ $3:$   8QLIRUP&RORU&RGHIRU7HPSRUDU\0DUNLQJRI8QGHUJURXQG8WLOLW\/RFDWLRQV ) 'HSDUWPHQWRI/DERU2FFXSDWLRQDO6DIHW\DQG+HDOWK$GPLQLVWUDWLRQ2FFXSDWLRQDO6DIHW\DQG +HDOWK6WDQGDUGV([FDYDWLRQV)LQDO5XOH&)53DUW  '(),1,7,216 $ $JJUHJDWH%DVH*UDGHGDJJUHJDWHIRUXVHLQSLSHHPEHGPHQWEHQHDWKVWUXFWXUDOIRXQGDWLRQV EHQHDWKSDYHPHQWRUVODEVXUIDFHVRUDVDQDJJUHJDWHVXUIDFLQJ % %RUURZ0DWHULDO(DUWKHQPDWHULDOUHTXLUHGIRUFRQVWUXFWLRQRURWKHUVSHFLILHGSXUSRVHWKDWLVQRW WREHREWDLQHGIURPWKHSURMHFWVLWH & &OHDU5RFN6RUWHGDQGZDVKHGURFNXVHGIRUGUDLQDJHDQGH[FDYDWLRQVWDELOL]DWLRQ ' &RPSOHWHG/LIW$OLIWWKDWLVUHDG\IRUQH[WOD\HURUQH[WSKDVHRIZRUN ( *HRWH[WLOHDSHUPHDEOHJHRV\QWKHWLFFRPSULVHGVROHO\RIWH[WLOHV $670' ) *UDQXODU%DFNILOO*UDGHGDJJUHJDWHDQGFOHDQFRDUVHVDQGVDQGJUDYHOVIRUXVHLQEDFNILOO * ,PSRUWHG0DWHULDO0DWHULDOREWDLQHGE\WKH&2175$&725IURPDQDSSURYHGRIIVLWHVRXUFH V  + /LIW/RRVH XQFRPSDFWHG OD\HURIPDWHULDO , 2SWLPXP0RLVWXUH&RQWHQW'HWHUPLQHGLQDFFRUGDQFHZLWK$670VWDQGDUGVSHFLILHGWR GHWHUPLQHPD[LPXPGU\GHQVLW\IRU5HODWLYH&RPSDFWLRQ - 3LSH%HGGLQJ*UDQXODUPDWHULDOXSRQZKLFKSLSHVFRQGXLWVFDEOHVRUGXFWEDQNVDUHSODFHG . 3LSH+DXQFK*UDQXODUPDWHULDOSODFHGEHQHDWKWKHVSULQJOLQHRIDSLSH / 3LSH,QLWLDO%DFNILOO%DFNILOOPDWHULDOVSODFHGRYHUWKHSLSHWRDVWRSURWHFWWKHSLSH 0 3LSH6SULQJ/LQH7KHKRUL]RQWDOOLQHELVHFWLQJDSLSHEHWZHHQWKHLQYHUWDQGWKHFURZQ 1 3LSH=RQH%DFNILOO]RQHWKDWLQFOXGHVIXOOWUHQFKZLGWKDQGH[WHQGVIURP3UHSDUHG7UHQFK %RWWRPWRWRSRXWVLGHVXUIDFHRISLSHFRQGXLWFDEOHRUGXFWEDQN 2 3LSH&RYHU7KDWSDUWRILQLWLDOEDFNILOODVPHDVXUHGIURPWRSRISLSHDQGSURWHFWLQJSLSHFRQGXLW FDEOHRUGXFWEDQNIURPGDPDJHE\KHDY\FRPSDFWLRQHTXLSPHQW 3 5HODWLYH&RPSDFWLRQ7KHUDWLRLQSHUFHQWRIWKHDVFRPSDFWHGILHOGGU\GHQVLW\WRWKH ODERUDWRU\PD[LPXPGU\XQLWZHLJKWDVGHWHUPLQHGLQDFFRUGDQFHZLWKFRPSDFWLRQWHVWVE\ $670'&RUUHFWLRQVIRURYHUVL]HPDWHULDOPD\EHDSSOLHGWRHLWKHUWKHDVFRPSDFWHGILHOG GU\GHQVLW\RUWKHPD[LPXPGU\GHQVLW\DVGHWHUPLQHGE\WKH&$5 4 5HODWLYH'HQVLW\$VGHILQHGE\$670'DQG$670'&DOFXODWHGLQDFFRUGDQFHZLWK $670'EDVHGRQPD[LPXPLQGH[GHQVLW\GHWHUPLQHGLQDFFRUGDQFHZLWK$670' DQGPLQLPXPLQGH[GHQVLW\GHWHUPLQHGLQDFFRUGDQFHZLWK$670' &RXQFLO1R,([KLELW'3DJHRI Page 185 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO 5 5LSUDS6WRQH3URWHFWLYHVWRQHFRYHULQJRQHDUWKVORSHVDEXWPHQWVZDOOVDQGRWKHUVWUXFWXUHV ZKHUHWKHVRLOLVVXVFHSWLEOHWRHURVLRQ 6 6HOHFW*UDQXODU%RUURZ*UDGHGDJJUHJDWHDQGFRDUVHVDQGVDQGJUDYHOVIRUXVHLQSLSH HPEHGPHQWDQGEHQHDWKVWUXFWXUDOIRXQGDWLRQV 7 6XLWDEOH)LOO%RUURZDQGVLWHPDWHULDOVQRWFRQWDLQLQJ8QVXLWDEOH0DWHULDOVDQGPHHWLQJWKH PDWHULDOUHTXLUHPHQWVGHILQHGIRUHDFKILOODQGHPEDQNPHQWXVH 8 7RSVRLO7KHHDUWKKRUL]RQLPPHGLDWHO\EHORZWKHVRGOD\HUDQGFRQVLVWLQJRIWRSHUFHQWRI RUJDQLFPDWHULDO,WLVJHQHUDOO\HLWKHUEODFNRUDGDUNHUFRORUWKDQWKHXQGHUO\LQJPLQHUDOVXEVRLO 9 8QVXLWDEOH0DWHULDOV5RRWVRURWKHURUJDQLFPDWWHUWUDVKUHIXVHGHEULVIUR]HQPDWHULDOVURFN RURWKHUPDWHULDOVQRWGHILQHGIRUXVHDVEDFNILOORUDUHWRRZHWWRREWDLQVSHFLILHGFRPSDFWLRQ UDWHV  68%0,77$/6 $ 3URYLGHIROORZLQJVXEPLWWDOVFRQVLVWHQWZLWK6HFWLRQVXEPLWWDOV % 3URGXFWGDWD  'HVLJQ'DWD&RQWUROOHG/RZ6WUHQJWK)LOODQG/RZ3HUPHDELOLW\)LOOPL[GHVLJQVVLJQHGE\ TXDOLILHGPL[GHVLJQHU  )RUHDFKERUURZPDWHULDO D 1DPHDQGORFDWLRQRIVRXUFH E 5HVXOWVRIJUDGDWLRQWHVWV$670'RU$670& & 6KRSGUDZLQJV±)LOODQG(PEDQNPHQW3ODQ'HWDLOLQJ  0HWKRGVDQGVHTXHQFLQJRIILOOLQJRSHUDWLRQV  )LOOPDWHULDO  &RPSDFWLRQUHTXLUHPHQWV  &RPSDFWLYHHIIRUW QXPEHURISDVVHVZLWKVSHFLILFHTXLSPHQW   (TXLSPHQWDQGORDGRQXQGHUJURXQGIDFLOLWLHV  6FKHGXOH  )LHOGFRPSDFWLRQWHVWLQJSODQLQFOXGLQJ D /DERUDWRU\QDPH E 7HVWVDQG)UHTXHQF\ F 0HWKRG V  ' 6DPSOHRIHDFKW\SHRIERUURZWRWHVWLQJODERUDWRU\LQDFFRUGDQFHZLWK$670' ( 6DPSOHV  )RUHDFKERUURZPDWHULDO D %DJVDPSOHDWVRXUFH H[FHSWULSUDS $670' OEPLQLPXP RQHVDPSOHSHU VRXUFH E 'HOLYHUVDPSOHWR,QGHSHQGHQW7HVWLQJ/DE ,7/   0DUNLQJ7DSHIRRWORQJ  *HRWH[WLOH)DEULF ) 7HVWUHSRUWV  )RUHDFKERUURZDQGH[FDYDWLRQPDWHULDO D /DERUDWRU\FODVVLILFDWLRQ$670' E *UDGDWLRQWHVW V UHVXOWV$670'RU$670& F 0RLVWXUHGU\XQLWZHLJKWUHODWLRQVKLS$670'  )LHOGTXDOLW\FRQWUROWHVWUHVXOWV  0DQXIDFWXUHUVFHUWLILFDWHWKDWULSUDSPDWHULDOVPHHWWKHUHTXLUHPHQWVRI01'27IRU JUDGDWLRQDQGPDWHULDOSURSHUWLHV  (;,67,1*&21',7,216 $ 3URMHFWVLWHVXEVXUIDFHLQIRUPDWLRQLVSURYLGHGLQ9ROXPHRIWKH&RQWUDFW'RFXPHQWV &RXQFLO1R,([KLELW'3DJHRI Page 186 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO  48$/,7<$6685$1&( $ 1RWLI\&$5ZKHQ  6WUXFWXUHWDQNRUWUHQFKLVUHDG\IRUEDFNILOOLQJDQGZKHQHYHUEDFNILOOLQJRSHUDWLRQVDUH UHVXPHGDIWHUDSHULRGRILQDFWLYLW\  6XEJUDGHPDWHULDOVFRQVLVWRIXQVXLWDEOHPDWHULDOVRUFDQQRWEHFRPSDFWHGWRVSHFLILHGOLPLWV  )LOOPDWHULDODSSHDUVWREHGHYLDWLQJIURPVSHFLILFDWLRQVRUPDWHULDOFODVVLILFDWLRQLVGHYLDWLQJ IURPWKHFODVVLILFDWLRQRIWKHPDWHULDOSUHYLRXVO\DFFHSWHGIRUXVHDVILOORUEDFNILOO  :($7+(5/,0,7$7,216 $ *UDGLQJDQGILOOLQJZRUNLVSURKLELWHGEHWZHHQ1RYHPEHUWKDQG$SULOWKXQOHVVZDLYHGLQ ZULWLQJE\WKH&$5 % 'RQRWSODFHIUR]HQPDWHULDODVILOORUEDFNILOORQIUR]HQIRXQGDWLRQRURWKHUILOOPDWHULDO & 'RQRWSODFHPDWHULDOZKLFKZLOOIUHH]HGXULQJEDFNILOOLQJRUFRPSDFWLRQRSHUDWLRQV ' 'RQRWSODFHPDWHULDOH[FDYDWHGGXULQJLQFOHPHQWZHDWKHUXQWLODIWHUPDWHULDOGULHVVXIILFLHQWO\WR PHHWFRPSDFWLRQUHTXLUHPHQWV 3$57 352'8&76  0$7(5,$/6 $ 6XLWDEOH)LOO%RUURZDQGVLWHPDWHULDOVQRWFRQWDLQLQJRUJDQLFPDWWHUGHEULVERXOGHUVRUURFN IUDJPHQWVODUJHUWKDQFXELFIRRWRUDQ\RWKHU8QVXLWDEOH0DWHULDOVDQGWKDWWKH&$5 GHWHUPLQHVWREHVXLWDEOHIRUVSHFLILFXVHV % *UDQXODU%DFNILOO*UDGHGDJJUHJDWHDQGFOHDQFRDUVHJUDLQHGVDQGVDQGJUDYHOV0DWHULDOV FODVVLILHGE\$670'DV636:*:*3*0*&60DQG6&PHHWLQJWKHIROORZLQJ JUDGDWLRQUHTXLUHPHQWV  SHUFHQWSDVVLQJWKHLQFKVLHYH  7KHSRUWLRQSDVVLQJWKHVLHYHGLYLGHGE\WKHSRUWLRQSDVVLQJWKHLQFKVLHYHPD\QRW H[FHHGSHUFHQWE\PDVV  $FFHSWDEOHPDWHULDOVLQFOXGHWKRVHPHHWLQJ01'27' & 6HOHFW*UDQXODU%RUURZ*UDGHGDJJUHJDWHDQGFOHDQFRDUVHJUDLQHGVDQGVDQGJUDYHOV 0DWHULDOVFODVVLILHGE\$670'DV636:*:DQG*3PHHWLQJWKHIROORZLQJJUDGDWLRQ UHTXLUHPHQWV  SHUFHQWSDVVLQJWKHòLQFKVLHYH  7KHSRUWLRQSDVVLQJWKHVLHYHGLYLGHGE\WKHSRUWLRQSDVVLQJWKHLQFKVLHYHPD\QRW H[FHHGSHUFHQWE\PDVV  $FFHSWDEOHPDWHULDOVLQFOXGHWKRVHPHHWLQJ01'27% ' &OHDU5RFN&OHDQò±LQFKPLQXVVRUWHGDQGZDVKHGFUXVKHGURFNH[FOXGLQJFUXVKHG FDUERQDWHURFNDQGIUHHRIFOD\EDOOVGHEULVDQGRUJDQLFPDWHULDOVSHUFHQWUHWDLQHGE\WKH VLHYH ( $JJUHJDWH%DVH*UDGHGDJJUHJDWHIUHHRIFOD\EDOOVDQGRUJDQLFPDWHULDOV0HHWLQJWKH UHTXLUHPHQWVRI01'27(&ODVV ) *HRWH[WLOH)DEULF01'27 * &RQWUROOHG/RZ6WUHQJWK)LOO)ORZDEOH)LOODVLGHQWLILHGRQWKHGUDZLQJV + &OD\)LOO&OD\)LOOPDWHULDOXVHGIRUWUHQFKGDPVVKDOOPHHWLQJWKHIROORZLQJUHTXLUHPHQWV  /RZSHUPHDELOLW\VRLOIUHHRIRUJDQLFPDWHULDOV  2QVLWHH[FDYDWHGFOD\PDWHULDORULPSRUWHGILOOPDWHULDO  WRSHUFHQWE\ZHLJKWSDVVLQJ1R6WDQGDUG6LHYH  0D[LPXPSHUPHDELOLW\DWFRPSDFWHGGHQVLW\RISHUFHQW[FPVHFZKHQWHVWHGE\ IDOOLQJKHDGPHWKRG &RXQFLO1R,([KLELW'3DJHRI Page 187 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO , 5LSUDS6WRQH0HHWLQJWKHUHTXLUHPHQWVRI01'27&ODVV,, - 5LSUDS)LOWHU0DWHULDO0HHWLQJWKHUHTXLUHPHQWVRI01'27% . 7RSVRLO$VVSHFLILHGE\/HQQDUIRUXVHWKURXJKRXWWKHGHYHORSPHQW / 3RO\VW\UHQH,QVXODWLRQ([WUXGHGW\SHFRQIRUPLQJWRWKHIROORZLQJ  6SHFLILFDWLRQV$670&  7KLFNQHVVLQFKHV  (GJHV6TXDUH 0 0DUNLQJ7DSH  ,QHUWSRO\HWK\OHQHLPSHUYLRXVWRNQRZQDONDOLVDFLGVFKHPLFDOUHDJHQWVDQGVROYHQWVOLNHO\ WREHHQFRXQWHUHGLQVRLO  7KLFNQHVV0LQLPXPPLOV  :LGWKLQFKHV  ,GHQWLI\LQJ/HWWHULQJ0LQLPXPLQFKKLJKSHUPDQHQWEODFNOHWWHULQJLPSULQWHGFRQWLQXRXVO\ RYHUHQWLUHOHQJWK  0DWHULDOIURPWKHIROORZLQJPDQXIDFWXUHUVDQGZKLFKPHHWWKHVHVSHFLILFDWLRQVZLOOEH DFFHSWHG D 5HHI,QGXVWULHV7HUUD7DSH E $OOHQ0DUNOLQH  &RORU,QDFFRUGDQFHZLWK$3:$8QLIRUP&RORU&RGHIRU7HPSRUDU\0DUNLQJRI8QGHUJURXQG 8WLOLW\ORFDWLRQV &RORUD)DFLOLW\ 5HG (OHFWULFSRZHUOLQHVFDEOHVFRQGXLWDQGOLJKWQLQJFDEOHV 2UDQJH &RPPXQLFDWLQJDODUPRUVLJQDOOLQHVFDEOHVRUFRQGXLW <HOORZ *DVRLOVWHDPSHWUROHXPRUJDVHRXVPDWHULDOV *UHHQ 6HZHUVDQGGUDLQOLQHV %OXH :DWHULUULJDWLRQDQGVOXUU\OLQHV D$VVSHFLILHGLQ$16,=6DIHW\&RORU&RGH 3$57 (;(&87,21  (;$0,1$7,21 $ ,QVSHFWVXUIDFHVWRUHFHLYHILOOIRXQGDWLRQVRLOVWUHQFKIRXQGDWLRQVRLOVZLWK&$5 % 5HLQVSHFWVXUIDFHVWRUHFHLYHILOOZLWK&$5LIPRUHWKDQLQFKHVRIUDLQIDOOKDVRFFXUUHGDIWHU LQLWLDOLQVSHFWLRQEXWSULRUWRSODFLQJQH[WFRXUVHRIPDWHULDO & 5HLQVSHFWIRXQGDWLRQVRLOVZLWK&$5LIUDLQIDOORUVQRZKDVRFFXUUHGDIWHULQLWLDOLQVSHFWLRQEXW SULRUWRFRQVWUXFWLRQIRXQGDWLRQPXGPDWRUSODFLQJSLSHDQGEHGGLQJ ' $GYLVH&$5RIVRLOW\SHVRUFRQGLWLRQVWKDWDUHQRWLQDFFRUGDQFHZLWKVRLOERULQJVSURYLGHGLQ 9ROXPHRIWKH&RQWUDFW'RFXPHQWV ( 1RWLI\&$5LIVXEJUDGHPDWHULDOLVQRWVXLWDEOHIRUFRQVWUXFWLRQ  35(3$5$7,21 &RXQFLO1R,([KLELW'3DJHRI Page 188 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO $ 5HPRYHLFHIUR]HQPDWHULDODQGVQRZSULRUWRJUDGLQJRUILOOLQJRSHUDWLRQV % 7HVW5ROOLQJ  7HVWUROOVXUIDFHVIRXQGDWLRQVRLOVWRUHFHLYHILOOZLWK>DSQHXPDWLFWLUHGUROOHULQDFFRUGDQFH ZLWK0Q'27  3URWHFWFXOYHUWVXWLOLWLHVDQGRWKHUVWUXFWXUHVIURPGDPDJHGXULQJWHVWUROOLQJ  3URYLGHDGGLWLRQDOFRYHURYHULQSODFHVWUXFWXUHVDQGXWLOLWLHVDVVKRZQ5HPRYHFRYHUDIWHU WHVWUROOLQJ  5HSODFHXWLOLWLHVDQGVWUXFWXUHVGDPDJHGGXULQJWHVWUROOLQJ  7HVWUROOHQWLUHVXUIDFHWRUHFHLYHILOO  2SHUDWHYHKLFOHDWWRPLOHVSHUKRXU  0DNHWZRSDVVHVRYHUVXUIDFHDUHD  8QUROOHGDUHDVEHWZHHQWLUHWUDFNVPD\QRWH[FHHGLQFKHV  7KHVXUIDFHZLOOEHFRQVLGHUHGXQVWDEOHZKHQVXUIDFHVKRZV\LHOGLQJRUUXWWLQJRIPRUHWKDQ WZRLQFKHVGXULQJWHVWUROOLQJ  *(1(5$/352&('85(6 $ 5HSODFHXQVXLWDEOHVRLOVZLWKWKHVDPHPDWHULDOXVHGIRUWKHRYHUO\LQJILOORUEDFNILOO3ODFHPHQW DQGFRPSDFWLRQRIWKHPDWHULDOVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVIRUWKHRYHUO\LQJILOORUEDFNILOO % 5HSODFHH[FDYDWLRQFDUULHGEHORZJUDGHOLQHVRQSHUPDQHQWFXW6ORSHV ZKHUHRYHUO\LQJDUHDLV QRWWRUHFHLYHILOORUEDFNILOO ZLWK6XLWDEOH)LOO & 3ODFHILOOEDFNILOORUHPEDQNPHQWDQGFRPSDFWWRWKHUHTXLUHGGHQVLW\RYHUWKHIXOOZLGWKDQG OHQJWKRIWKHH[FDYDWLRQEHIRUHSODFLQJWKHQH[WOLIW ' 'RQRWDOORZRUFDXVHDQ\RIWKH:RUNSHUIRUPHGWREHFRYHUHGRUHQFORVHGE\ZRUNRIWKLV 6HFWLRQSULRUWRUHTXLUHGLQVSHFWLRQVWHVWVRUDSSURYDOV6KRXOGDQ\RIWKH:RUNEHVRHQFORVHG RUFRYHUHGXSEHIRUHLWKDVEHHQDSSURYHGXQFRYHUDOOVXFK:RUNDQGDIWHUDSSURYDOVKDYH EHHQPDGHEDFNILOODQGFRPSDFWDVVSHFLILHG ( 'UHVVFRPSOHWHHPEDQNPHQWEDFNILOORUILOOZLWKDOORZDQFHIRUWRSVRLOVXUIDFLQJRUVORSH SURWHFWLRQZKHUHDSSOLFDEOH ) 'RQRWSODFHEDFNILOORUILOORQIUR]HQJURXQG * 1REDFNILOOPDWHULDOVVKDOOH[FHHGWKHPD[LPXPVSHFLILHGPRLVWXUHFRQWHQWVSHFLILHGLQWKHWDEOH EHORZ&2175$&725VKDOOPL[GU\RUUHSODFHEDFNILOOPDWHULDOVH[FHHGLQJWKHVSHFLILHG PD[LPXPPRLVWXUHFRQWHQWDWQRFRVWWR&281&,/ 0D[LPXP0RLVWXUH&RQWHQW5HTXLUHPHQWV 5HTXLUHG6WDQGDUG3URFWRU'HQVLW\ $670 '  0D[LPXP3HUFHQWDJH([FHHGLQJ6WDQGDUG 3URFWRU2SWLPXP0RLVWXUH&RQWHQW $670 '    ” &RXQFLO1R,([KLELW'3DJHRI Page 189 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO  ,1,7,$/%$&.),// $ 6WUXFWXUHIRXQGDWLRQSUHSDUDWLRQ  3ODFHIRXQGDWLRQRQXQGLVWXUEHGQDWLYHVRLO  3URRIUROOVXEJUDGHRIVKDIWVZLWKSDVVHVRIYLEUDWRU\SODWHFRPSDFWRU  &RPSDFWXSSHULQFKHV@RIIRXQGDWLRQVRLOVWRSHUFHQW0RGLILHG3URFWRU'HQVLW\DV GHWHUPLQHGE\$670  &RUUHFWDQ\RYHUH[FDYDWLRQEHQHDWKIRRWLQJVDQGEDVHVODEVZLWK6HOHFW*UDQXODU%RUURZRU $JJUHJDWH%DVHSODFHGLQLQFKOLIWV  &RUUHFWDQ\RYHUH[FDYDWLRQEHQHDWKVODEVRQJUDGHZLWK6HOHFW*UDQXODU%RUURZRU $JJUHJDWH%DVHSODFHGLQLQFKOLIWV % %DFNILOO$URXQG6WUXFWXUHV  2EWDLQ&$5 VDFFHSWDQFHRIFRQFUHWHZRUNDQGDWWDLQHGVWUHQJWKSULRUWRSODFLQJEDFNILOO  %DFNILOOWRWRSRIVWUXFWXUHXQOHVVRWKHUZLVHVKRZQZLWK*UDQXODU%DFNILOOSODFHGLQLQFK OLIWV&RPSDFWHDFKOLIWWRPLQLPXPSHUFHQW6WDQGDUG3URFWRU'HQVLW\DVGHWHUPLQHGE\ $670' & 3LSH(PEHGPHQW  5HSODFHXQVXLWDEOHIRXQGDWLRQVRLOVZLWK6HOHFW*UDQXODU%RUURZRU$JJUHJDWH%DVH  5HPRYHOHGJHURFNERXOGHUVDQGODUJHVWRQHVWRSURYLGHDWOHDVWLQFKFOHDUDQFHIURP SLSH  %DFNILOO3LSH=RQHDQG3LSH&RYHUZLWK6HOHFW*UDQXODU%RUURZRU$JJUHJDWH%DVHDVVKRZQ RQWKH&RQWUDFW'UDZLQJV  'RQRWEORFNSLSH'LJEHOOKROHVLQ3LSH%HGGLQJDWHDFKMRLQWVXFKWKDWSLSHEDUUHOUHVWV FRQWLQXRXVO\RQEHGGLQJ  )RU5LJLG3LSH &RQFUHWH ORRVHO\FRPSDFWWKHPLGGOH3LSH%HGGLQJDWDZLGWKQRJUHDWHU WKDQWKHRXWVLGHSLSHGLDPHWHUDVSHU6,''PHWKRG7\SHLQVWDOODWLRQ  5HVWUDLQSLSHFRQGXLWFDEOHVDQGGXFWEDQNVDVQHFHVVDU\WRSUHYHQWWKHLUPRYHPHQW GXULQJEDFNILOORSHUDWLRQV  %DFNILOOPDWHULDOVKRXOGEHZRUNHGXQGHUWKHVLGHVRIWKHSLSHDQGKDQGJUDGHGWRSURYLGH VDWLVIDFWRU\KDXQFKLQJDQGDILUPXQ\LHOGLQJVXUIDFH  3ODFHPDWHULDOZLWKLQ3LSH=RQHDQG3LSH&RYHULQLQFKOLIWV3URYLGHIRRW3LSH&RYHUIRU SLSHGLDPHWHUVXSWRDQGLQFOXGLQJLQFKHVDQGIHHW3LSH&RYHUIRUSLSHGLDPHWHUV JUHDWHUWKDQLQFKHV3URWHFWSLSHIURPWKHGURSSLQJRIODUJHURFNVRURWKHULPSDFWORDGV &RPSDFWHDFKOLIWWRDPLQLPXP>@SHUFHQW6WDQGDUG3URFWRU'HQVLW\DVGHWHUPLQHGE\ $670'  &RPSDFWLRQRIPDWHULDOVZLWKLQWKH3LSH=RQHDQG3LSH&RYHUVKDOOEHDFFRPSOLVKHGZLWK SRUWDEOHRUKDQGYLEUDWRU\HTXLSPHQWPHWKRGVWRDFKLHYHFRPSOHWHFRQVROLGDWLRQXQGHU DURXQGDQGLPPHGLDWHO\DERYHWKHSLSH'RQRWXVHUROOHUW\SHSRZHUGULYHQHTXLSPHQWWR FRPSDFW3LSH=RQHDQG3LSH&RYHUPDWHULDOV  %DFNILOO3LSH,QLWLDO%DFNILOOZLWK*UDQXODU%DFNILOORUILOODVVKRZQLQWKH&RQWUDFW'UDZLQJV SODFHGLQLQFKOLIWV&RPSDFWHDFKOLIWWRPLQLPXPSHUFHQW6WDQGDUG3URFWRU'HQVLW\DV GHWHUPLQHGE\$670'  3ODFH3RO\VW\UHQH,QVXODWLRQRYHUSLSHEDFNILOOZKHUHWKHFURZQRISLSHLVOHVVWKDQIHHW EHORZILQLVKJUDGHVXUIDFH  &OHDU5RFNPD\EHXVHGLQOLHXRIWKHDERYHIRXQGDWLRQEHGGLQJKDXQFKDQGLQLWLDOEDFNILOO PDWHULDOV&RQVWUXFWDFFRUGLQJWR6(&7,21(;&$9$7,213ODFHPHQWDQG FRPSDFWLRQRI3LSH%HGGLQJ3LSH+DXQFKLQJDQG3LSH,QLWLDO%DFNILOOVKDOOUHPDLQDV VSHFLILHGDERYH  ,QVWDOOWUHQFKGDPVXVLQJ&OD\)LOODWORFDWLRQVVKRZQ D 8SRQFRPSOHWLRQRIWUHQFKH[FDYDWLRQVFDULI\ERWWRPDQGVLGHVRIWUHQFKWRGHSWKRI LQFKHVWRLQFKHV &RXQFLO1R,([KLELW'3DJHRI Page 190 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO E 5HPRYHDOOVDQGVHDPVSRFNHWVRUQRQFRKHVLYHPDWHULDOHQFRXQWHUHG F 5HSODFHZLWK&OD\)LOOSODFHGLQLQFKOLIWVDQGFRPSDFWHGWRSHUFHQWPRGLILHGSURFWRU GHQVLW\  &RQWUROOHG/RZ6WUHQJWK)LOO D 'LVFKDUJHIURPWUXFNPRXQWHGGUXPW\SHPL[HULQWRWUHQFK E 3ODFHLQOLIWVDVQHFHVVDU\WRSUHYHQWXSOLIW IORWDWLRQ RIQHZDQGH[LVWLQJIDFLOLWLHV  %$&.),//$1'&203$&7,21 $ *HQHUDO  6FDULI\VORSHVUHFHLYLQJILOO % ,QDUHDVRXWVLGHWKHORDGLQIOXHQFHRIVWUXFWXUHVWDQNVSDYHPHQWVFXUEVVODEVSLSLQJRWKHU IDFLOLWLHVSODFH6XLWDEOH)LOOPDWHULDOVDVIROORZV  0D[LPXPLQFKWKLFNORRVHOLIWV  &RPSDFWHDFKOLIWWRPLQLPXPSHUFHQW6WDQGDUG3URFWRU'HQVLW\DVGHWHUPLQHGE\$670 ' & ,QDUHDVZLWKLQWKHORDGLQIOXHQFHRIVWUXFWXUHVWDQNVSDYHPHQWVFXUEVVODEVSLSLQJRWKHU IDFLOLWLHVSODFH*UDQXODU%DFNILOO>RU6XLWDEOH)LOO@PDWHULDOVDVIROORZV  0D[LPXPLQFKWKLFNORRVHOLIWV  &RPSDFWHDFKOD\HUE\PHFKDQLFDOPHDQVWRDPLQLPXPRISHUFHQWSHUFHQW6WDQGDUG 3URFWRU'HQVLW\DVGHWHUPLQHGE\$670'H[FHSWWRSHUFHQWLQXSSHUWKUHHIHHWRI ERXOHYDUGDUHDVVKRXOGHUVDQGSDYHGVXUIDFHV ' 3LSH7UHQFKHV  ,QVWDOOPDUNLQJWDSHFRQWLQXRXVO\DORQJWKHFHQWHUOLQHRIDOOEXULHGSLSLQJ7ZRIHHWEHORZWKH JURXQGVXUIDFH  %DFNILOODURXQGDFFHVVVWUXFWXUHVZLWKVDPHFODVVEDFNILOODVVSHFLILHGIRUDGMDFHQWWUHQFK XQOHVVRWKHUZLVHVKRZQRUVSHFLILHG ( )RUDUHDVEHQHDWKUDLOURDGHPEDQNPHQWVRUUDLOURDGSURSHUW\  3ODFH*UDQXODU%DFNILOOLQPD[LPXPLQFKWKLFNORRVHOLIWV  $OOHPEDQNPHQWVVKDOOEHFRPSDFWHGWRDGHQVLW\RIQRWOHVVWKDQSHUFHQW6WDQGDUG 3URFWRU'HQVLW\DVGHWHUPLQHGE\$670'  68%*5$'(35(3$5$7,21)2552$':$<66/$%6$1'27+(53$9(0(176 $ )RUDUHDVEHQHDWKSDYHGVXUIDFHVDQGXQSDYHGURDGZD\VSODFHPDWHULDOVLQDFFRUGDQFHZLWK 0Q'27(H[FHSWDVIROORZV  8SSHUWKUHHIHHWRIURDGEHG3ODFH*UDQXODU%DFNILOOLQPD[LPXPLQFKWKLFNORRVHOLIWV &RPSDFWWRPLQLPXPRISHUFHQW6WDQGDUG3URFWRU'HQVLW\DVGHWHUPLQHGE\$670'  5HPDLQGHURIURDGEHG3ODFH*UDQXODU%DFNILOORU6XLWDEOH)LOOLQPD[LPXPLQFKWKLFNOLIWV &RPSDFWWRPLQLPXPRISHUFHQW6WDQGDUG3URFWRU'HQVLW\DVGHWHUPLQHGE\$670' % $JJUHJDWH%DVHDQG6XUIDFLQJ&RQVWUXFWLQDFFRUGDQFHZLWK01'27DQG  )RU6SHFLILHG'HQVLW\0HWKRG'HWHUPLQH2SWLPXP0RLVWXUHDQG0D[LPXPGU\XQLWZHLJKW XVLQJ$670'DQG'UHVSHFWLYHO\  3/$&,1*(0%$1.0(176 $ ([FDYDWHWROLQHVJUDGHVDQGVORSHVVKRZQ % 3URYLGHVHHSDJHWUHQFKHVIRU*UDQXODU%DFNILOOUHSODFHPHQWRIXQVWDEOHDUHDV & 8VH6XLWDEOH)LOOIURPH[FDYDWHGPDWHULDOVIRUHPEDQNPHQWFRQVWUXFWLRQ ' &RQVWUXFWHPEDQNPHQWOD\HUVIURPXQLIRUPPDWHULDOV ( 3ODFHJUDQXODUPDWHULDOVLQXSSHUPRVWSRUWLRQRIWKHHPEDQNPHQW ) 0HFKDQLFDOO\PL[QRQXQLIRUPVRLOVWRSURGXFHXQLIRUPPRLVWXUHFRQWHQWDQGGHQVLW\ &RXQFLO1R,([KLELW'3DJHRI Page 191 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO * 'RQRWSODFHVWRQHFRQFUHWHRUELWXPLQRXVIUDJPHQWVH[FHHGLQJ>WKUHH@LQFKHVLQWKHXSSHU>VL[@ LQFKHVRIURDGEHGHPEDQNPHQWRUZLWKLQ>@LQFKHVRIWKHVWUXFWXUH + %DFNILOOH[FDYDWLRQVEHORZVXEJUDGHDQGVHHSDJHWUHQFKHVLQDFFRUGDQFHZLWKWKLVVHFWLRQ , 3ODFHXSSHU>WKUHH@IHHWRIURDGEHGLQPD[LPXP>HLJKWLQFK@ORRVHOD\HUV - 3ODFHUHPDLQGHURIURDGEHGLQPD[LPXP>WZHOYHLQFK@ORRVHOD\HUV . &RPSDFWXSSHUWKUHHIHHWRIHPEDQNPHQWWRQRWOHVVWKDQ>SHUFHQW@6WDQGDUG3URFWRU'HQVLW\ DVGHWHUPLQHGE\$670' / &RPSDFWUHPDLQGHURIHPEDQNPHQWWRQRWOHVVWKDQ>SHUFHQW@6WDQGDUG3URFWRU'HQVLW\DV GHWHUPLQHGE\$670'  ),1,6+*5$',1* $ )LQLVKVLWHJUDGLQJWUXHWRJUDGHZLWKLQIHHWRIWKHJUDGHVKRZQRQGUDZLQJV % 3ORZGLVNDQGGUDJDQ\DUHDVFRPSDFWHGE\WUXFNVRWKHUYHKLFOHVRUVWRUDJHRIPDWHULDOVWR PDWFKWH[WXUHRIDGMDFHQWDUHDV & $OORZIRULQFKWKLFNQHVVRIWRSVRLOZKHUHVKRZQ ' 3ODFHWRSVRLOLQDFFRUGDQFHZLWK/HQQDU¶VUHTXLUHPHQWVIRUWKHGHYHORSPHQW6SUHDGVDOYDJHG WRSVRLOXQLIRUPO\RYHUGLVWULEXWHGDUHD&RQGXFWILQLVKLQJDQGWRSVRLOLQJFRQFXUUHQWZLWKJUDGLQJ RSHUDWLRQV ( 'LVSRVHRIH[FDYDWHGPDWHULDOQRWVXLWDEOHRUUHTXLUHGIRUEDFNILOO 7(67,1*$1',163(&7,21 $ 7KH&2175$&725VKDOOFRRUGLQDWHZLWKDQGVFKHGXOH,7/LQDFFRUGDQFHZLWK6HFWLRQ 48$/,7<&21752/WRSHUIRUPWKHIROORZLQJWHVWVDVGLUHFWHGE\WKH&$5 % 6285&(7(67,1*  *UDGDWLRQ7HVWV D 6XLWDEOH2Q6LWH0DWHULDO  3URFHGXUH$670&  )UHTXHQF\WHVWSHU\DUGVRIHDFKW\SHRIPDWHULDO  %RUURZ0DWHULDO D 6XLWDEOH)LOOWHVWVSHUFXELF\DUGV ORRVHYROXPH  E *UDQXODU%DFNILOOWHVWSHUFXELF\DUGV ORRVHYROXPH  F 6HOHFW*UDQXODU%RUURZWHVWSHUFXELF\DUGV ORRVHYROXPH  G &OHDU5RFNWHVWSHUFXELF\DUGV ORRVHYROXPH  H $JJUHJDWH%DFNILOOWHVWSHUFXELF\DUGV ORRVHYROXPH  I $JJUHJDWH%DVHWHVWSHUFXELF\DUGV ORRVHYROXPH   6DPSOH&2175$&725VKDOOFROOHFWVDPSOHVLQDFFRUGDQFHZLWK$670'DQGGHOLYHUWR ,7/LQDFFRUGDQFHZLWK6HFWLRQ D 'XULQJSURGXFWLRQRILPSRUWHGPDWHULDOSURYLGHVDPSOHDVIROORZV & 6XLWDEOH)LOOWHVWVSHUFXELF\DUGV ORRVHYROXPH  ' *UDQXODU%DFNILOOWHVWSHUFXELF\DUGV ORRVHYROXPH  ( 6HOHFW*UDQXODU%RUURZWHVWSHUFXELF\DUGV ORRVHYROXPH  ) &OHDU5RFNWHVWSHUFXELF\DUGV ORRVHYROXPH  * $JJUHJDWH%DFNILOOWHVWSHUFXELF\DUGV ORRVHYROXPH  + $JJUHJDWH%DVHWHVWSHUFXELF\DUGV ORRVHYROXPH   7HVWUHSRUWVSURYLGHGE\,7/VKDOOEHXVHGE\WKH&2175$&725LQSUHSDUDWLRQRI6XEPLWWDOV RQERUURZPDWHULDO & ),(/'7(67,1*  ,QSODFHGHQVLW\WHVWV,QDFFRUGDQFHZLWK$670''XULQJSODFHPHQWRIPDWHULDOVWHVW DVIROORZV &RXQFLO1R,([KLELW'3DJHRI Page 192 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV )LOODQG%DFNILOO D 6XLWDEOH)LOO> @ E *UDQXODU%DFNILOO> @ F 6HOHFW*UDQXODU%RUURZ > @ G $JJUHJDWH%DVH> @  ,QSODFHPRLVWXUHWHVWVLQDFFRUGDQFHZLWK$670''XULQJSODFHPHQWRIPDWHULDOV WHVWDVIROORZV D 6XLWDEOH)LOO> @ E *UDQXODU%DFNILOO> @ F 6HOHFW*UDQXODU%RUURZ > @ G $JJUHJDWH%DVH> @  6RLO7HVWV D 6RLOEHDULQJWHVWRQWKHIRXQGDWLRQVRLOVZLOOEHWDNHQDWWKH&$5¶VGLVFUHWLRQ E 6RLOGHQVLW\WHVWVRQWKHEDFNILOOPDWHULDOZLOOEHWDNHQDWWKH&$5¶VGLVFUHWLRQ  5HPRYHPDWHULDOSODFHGLQZRUNWKDWGRHVQRWPHHWPDWHULDORUFRPSDFWLRQUHTXLUHPHQWV 72/(5$1&(6$1':$55$17< $ 5HSDLUVHWWOHPHQWVJUHDWHUWKDQòLQFKDVPHDVXUHGE\DIRRWVWUDLJKWHGJHWKDWRFFXULQ SDYHGVXUIDFHVRU\DUGDUHDVGXULQJWKHJXDUDQWHHSHULRG5HSDLUWUHQFKVHWWOHPHQWVJUHDWHU WKHQLQFKDVPHDVXUHGE\DIRRWVWUDLJKWHGJHLQUHPDLQLQJDUHDV % 5HSODFHVXUIDFHPDWHULDOWRPDWFKH[LVWLQJ (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 193 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV 6(&7,21 *5$9,7<6(:(50$,17(1$1&(+2/(6 3$57 *(1(5$/  6(&7,21,1&/8'(6 $ 3RO\PHU&RQFUHWH0DLQWHQDQFH+ROHV 0+   5()(5(1&(6 $ $PHULFDQ6RFLHW\IRU7HVWLQJDQG0DWHULDOV $670   $ *UD\,URQ&DVWLQJ  $ &KURPLXPDQG&KURPLXP1LFNHO6WDLQOHVV6WHHO3ODWH6KHHWDQG6WULSIRU 3UHVVXUH9HVVHOVDQGIRU*HQHUDO$SSOLFDWLRQV  $ 6WDLQOHVV6WHHO%DUVDQG6KDSHV  & &RQFUHWH$JJUHJDWHV  & -RLQWVIRU&RQFUHWH3LSHDQG0DQKROHV8VLQJ5XEEHU*DVNHWV  & 6WDQGDUG6SHFLILFDWLRQIRU3UHFDVW5HLQIRUFHG&RQFUHWH0DQKROH6HFWLRQV  & 7HVW0HWKRGVIRU&RQFUHWH3LSH0DQKROH6HFWLRQVRU7LOH  & 6WDQGDUG7HVW0HWKRGVIRU&RPSUHVVLYH6WUHQJWKRI&KHPLFDO5HVLVWDQW 0RUWDUV*URXWV0RQROLWKLF6XUIDFLQJDQG3RO\PHU&RQFUHWHV  & 6WDQGDUG7HVW0HWKRGIRU)OH[XUDO6WUHQJWKDQG0RGXOXVRI(ODVWLFLW\RI &KHPLFDO5HVLVWDQW0RUWDUV*URXWV0RQROLWKLF6XUIDFLQJDQG3RO\PHU&RQFUHWHV  & 7HVW0HWKRGIRU'HIOHFWLRQ7HPSHUDWXUHRI3ODVWLFV8QGHU)OH[XUDO/RDGLQ (GJHZLVH3RVLWLRQ  & 0LQLPXP6WUXFWXUDO'HVLJQ/RDGLQJIRU8QGHUJURXQG8WLOLW\6HUYLFHV  & 5HVLOLHQW&RQQHFWRUVEHWZHHQ5HLQIRUFHG&RQFUHWH0DQKROH6WUXFWXUHV 3LSHVDQG/DWHUDOV  & 6WDQGDUG6SHFLILFDWLRQIRU-RLQWVIRU&RQFUHWH3LSH0DQKROHVDQG3UHFDVW %R[6HFWLRQV8VLQJ3UHIRUPHG)OH[LEOH-RLQW6HDODQWV  ' 'HIOHFWLRQ7HPSHUDWXUHRI3ODVWLFV8QGHU)OH[XUDO/RDGLQ(GJHZLVH 3RVLWLRQ &RXQFLO1R,([KLELW'3DJHRI Page 194 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV  ' 7HVW0HWKRGVIRU&RPSUHVVLYH3URSHUWLHVRI5LJLG3ODVWLFV  ' 7HVW0HWKRGIRU)OH[XUDO3URSHUWLHVRI8QUHLQIRUFHGDQG5HLQIRUFHG 3ODVWLFVDQG(OHFWULFDO,QVXODWLQJ0DWHULDOV  '7HVW0HWKRGIRU'HWHUPLQDWLRQRI([WHUQDO/RDGLQJ&KDUDFWHULVWLFVRI 3ODVWLF3LSHE\3DUDOOHO3ODWH/RDGLQJ  ',JQLWLRQ/RVVRI&XUHG5HLQIRUFHG5HVLQV  '6WDQGDUG6SHFLILFDWLRQIRU3RO\PHU&RQFUHWH3LSH % $PHULFDQ&RQFUHWH,QVWLWXWH $&,   $&, %XLOGLQJ&RGH5HTXLUHPHQWVIRU6WUXFWXUDO&RQFUHWH  $&, &RGH5HTXLUHPHQWVIRU(QYLURQPHQWDO(QJLQHHULQJ&RQFUHWH 6WUXFWXUHVDQG&RPPHQWDU\  $&,5*XLGHIRUWKH'HVLJQDQG&RQVWUXFWLRQRI6WUXFWXUDO&RQFUHWH 5HLQIRUFHGZLWK)LEHU5HLQIRUFHG3RO\PHU%DUV  $&,53RO\PHU&RQFUHWH6WUXFWXUDO$SSOLFDWLRQV6WDWHRIWKH$UW5HSRUW & $PHULFDQ$VVRFLDWLRQRI6WDWH+LJKZD\DQG7UDQVSRUWDWLRQ2IILFLDOV $$6+72   $$6+72+ $[LDO/RDGLQJ5HTXLUHPHQWV  68%0,77$/6 $ 6XEPLWWKHIROORZLQJLWHPVIRUUHYLHZE\0&(6  0DQXIDFWXUHU¶V3URGXFW'DWDIRUWKHIROORZLQJLWHPV D 0+YDXOWVDQGULVHUVLQFOXGLQJSURFHGXUHVIRUMRLQWLQJDQGDOORZDEOHMRLQW GHIOHFWLRQV E &DVWLQJVDQG&RYHUV F 'DYLW$UP%DVH G 9HQW3LSLQJDQG3LSH6XSSRUWV H *DVNHWV I -RLQW0DWHULDOVDQG6HDODQWV J 6WHSV &RXQFLO1R,([KLELW'3DJHRI Page 195 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV K *UDWLQJRYHUWKH3DUVKDOO)OXPH&KDQQHO3URYLGHGLPHQVLRQVVXSSRUW DQGDQFKRUGHWDLOVGHIOHFWLRQDQWLFLSDWHGZLWKDOEORDGPD[LPXP UHFRPPHQGHGORDGDQGXOWLPDWHFDSDFLW\ L ,QWHUPHGLDWH3ODWIRUP*UDWLQJDQG$QFKRUV3URYLGHGLPHQVLRQVVXSSRUW DQGDQFKRUGHWDLOVGHIOHFWLRQDQWLFLSDWHGZLWKDOEORDGPD[LPXP UHFRPPHQGHGORDGDQGXOWLPDWHFDSDFLW\ M 3LSH&RQQHFWLRQV  6XPPDU\RIFULWHULDXVHGLQPDLQWHQDQFHKROHGHVLJQLQFOXGLQJDVPLQLPXP PDWHULDOSURSHUWLHVORDGLQJFULWHULDDQGGLPHQVLRQVDVVXPHG,QFOXGHFHUWLILFDWLRQ IURPPDQXIDFWXUHUWKDWSRO\PHUFRQFUHWHPDLQWHQDQFHKROHGHVLJQPHHWVRU H[FHHGVWKHORDGDQGVWUHQJWKUHTXLUHPHQWVRI$670&DQG$670& UHLQIRUFHGLQDFFRUGDQFHZLWK$&,5,QFOXGHFXUUHQW,62 FHUWLILFDWLRQ  6KRS'UDZLQJVVKRZLQJPDLQWHQDQFHKROHPDWHULDOPDQKROHGLPHQVLRQV ZHLJKWVMRLQWVSLSHFRQQHFWLRQVGHSWKHOHYDWLRQVRISLSHSHQHWUDWLRQVJUDWLQJ GHVLJQLQWHUPHGLDWHSODWIRUPGHVLJQDQGRULHQWDWLRQRIFRQQHFWLQJSLSHSUHSDUHG E\DSURIHVVLRQDOHQJLQHHUUHJLVWHUHGLQWKH6WDWHRI0LQQHVRWD  &DOFXODWLRQVSUHSDUHGE\DSURIHVVLRQDOHQJLQHHUUHJLVWHUHGLQWKH6WDWHRI 0LQQHVRWDWRVXSSRUWWKHEDVLVRIGHVLJQ D 6WUXFWXUDOFDOFXODWLRQVIRUPDLQWHQDQFHKROHZDOODQGVODEWKLFNQHVV GHVLJQ E &DOFXODWLRQFRQILUPLQJWKDWWKHVWUXFWXUHLVQRWEXR\DQWZLWKJURXQGZDWHUDW JUDGH F ,QWHUPHGLDWHSODWIRUPDQGDQFKRUGHVLJQ  0DQXIDFWXUHU¶V&HUWLILFDWHRI&RPSOLDQFHVWDWLQJWKDWHDFKVWUXFWXUHZLOOEH VWUXFWXUDOO\VRXQGIRUHDFKVSHFLILFLQVWDOODWLRQVKRZQRQWKH'UDZLQJV  4XDOLW\&RQWURO'RFXPHQWDWLRQ3URYLGHGRFXPHQWDWLRQWKDWSRO\PHUFRQFUHWH PDWHULDOXVHGIRUWKHVWUXFWXUHPHHWVVWUXFWXUDOUHTXLUHPHQWV 3$57 352'8&76  32/<0(5&21&5(7(0$,17(1$1&(+2/(6 $0DQXIDFWXUHV0DWHULDOVIURPWKHIROORZLQJPDQXIDFWXUHVZLOOEHDFFHSWHG $UPRURFN $SSURYHG(TXDO %$FLGUHVLVWDQWSRO\PHUPDLQWHQDQFHKROHVHFWLRQVEDVHVHFWLRQVDQGUHODWHGFRPSRQHQWV &RXQFLO1R,([KLELW'3DJHRI Page 196 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV &3URYLGHUHLQIRUFHGSUHFDVWFRQFUHWHEDVHVODEDQGKDUGZDUHWRDWWDFKSRO\PHUEDVH VHFWLRQWRVODE3RO\PHUEHQFKDQGFKDQQHODUHWREHFRQVWUXFWHGZLWKSRO\PHUFRQFUHWH PDWHULDO '5LVHUVHFWLRQV  0DQKROHMRLQWVVKDOOEHDVVHPEOHGZLWKDEHOOVSLJRWRUVKLSODSEXW\OPDVWLFMRLQW VXFKWKDWRQDVVHPEO\WKHPDQKROHEDVHULVHUDQGWRSVHFWLRQPDNHD FRQWLQXRXVDQGXQLIRUPPDLQWHQDQFHKROHVWUXFWXUH  &RQVWUXFWULVHUVHFWLRQVIRUSRO\PHUFRQFUHWHPDLQWHQDQFHKROHVIURPVWDQGDUG SRO\PHUFRQFUHWHPDLQWHQDQFHKROHVHFWLRQVRIWKHGLDPHWHULQGLFDWHGRQ GUDZLQJV8VHYDULRXVOHQJWKVRISRO\PHUFRQFUHWHPDLQWHQDQFHKROHVHFWLRQVLQ FRPELQDWLRQWRSURYLGHFRUUHFWKHLJKWZLWKWKHIHZHVWMRLQWV  'HVLJQZDOOVHFWLRQVIRUGHSWKDQGORDGLQJFRQGLWLRQVZLWKZDOOWKLFNQHVVDV GHVLJQHGE\WKHSRO\PHUFRQFUHWHPDQXIDFWXUHU  7KHWRSVODEDQGZDOOVHFWLRQVVKDOOLQFOXGHSURYLVLRQVIRUDPDLQWHQDQFHKROH FRYHUVYHQWRSHQLQJVDQGGDYLWDUPEDVHDVVKRZQRQWKH'UDZLQJV (*DVNHWV  $670&  :UDSJDVNHWHGPDLQWHQDQFHKROHMRLQWVZLWKLQ*DWRU:UDS,QIL6KLHOG )3LSH&RQQHFWLRQV  3LSHFRQQHFWLRQVVKDOOEHIDFWRU\LQVWDOOHGDQGFRRUGLQDWHG  3URYLGHWUDQVLWLRQIURPFLUFXODUSLSHWRUHFWDQJXODUFKDQQHOXVLQJWUDQVLWLRQSLHFHV VSHFLILHGLQ6HFWLRQ  ,QIOXHQWDQGHIIOXHQWSLSHVVKDOOLQFOXGHIOH[LEOHMRLQWVDVUHFRPPHQGHGE\WKHYDXOW PDQXIDFWXUHUWRSURWHFWWKHSLSHIURPVHWWOHPHQWRIWKHYDXOW *0DWHULDOV  3RO\PHU0L[WXUH±PL[WXUHVKDOOFRQVLVWRIVROHO\RIWKHUPRVHWWLQJUHVLQVDQGDQG DJJUHJDWH1RFHPHQWLWLRXVPDWHULDOVVKDOOEHDOORZHG$OOVDQGDQGDJJUHJDWH VKDOOEHLQHUWLQDQDFLGLFHQYLURQPHQW  5HLQIRUFHPHQW±6KDOOXVHDFLGUHVLVWDQWUHLQIRUFHPHQW )53%DU LQDFFRUGDQFH ZLWK$&,5DVDSSOLFDEOHIRUSRO\PHUFRQFUHWHGHVLJQ  5HVLQ7KHPDQXIDFWXUHUVKDOOXVHRQO\SRO\HVWHUUHVLQV\VWHPVGHVLJQHGIRUXVH ZLWKWKLVSDUWLFXODUDSSOLFDWLRQ5HVLQVKDOOKDYHDPLQLPXPGHIOHFWLRQWHPSHUDWXUH RIGHJUHHV)ZKHQWHVWHGDWSVLIROORZLQJ7HVW0HWKRG'7KHUHVLQ FRQWHQWVKDOOQRWEHOHVVWKDQRIWKHZHLJKWRIWKHVDPSOHDVGHWHUPLQHGE\ WHVW0HWKRG' &RXQFLO1R,([KLELW'3DJHRI Page 197 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV  )LOOHU$OODJJUHJDWHVDQGDQGTXDUW]SRZGHUVKDOOPHHWWKHUHTXLUHPHQWVRI $670&  $GGLWLYHV5HVLQDGGLWLYHVVXFKDVFXULQJDJHQWVSLJPHQWVG\HVILOOHUVDQG WKL[RWURSLFDJHQWVVKDOOQRWEHGHWULPHQWDOWRWKH0+ +'HVLJQZDOOVHFWLRQVIRUGHSWKDQGORDGLQJFRQGLWLRQVZLWKZDOOWKLFNQHVVDVUHTXLUHGE\ SRO\PHUFRQFUHWHPDQXIDFWXUHUV:DOOWKLFNQHVVVKDOOFRQIRUPZLWKGHSWKRIVWUXFWXUH JHRWHFKQLFDOFRQGLWLRQVDQGDQDVVXPHGJURXQGZDWHUOHYHODWJUDGH ,3URYLGHWRSVWRVXSSRUW+YHKLFOHORDGLQJDQGUHFHLYLQJPDLQWHQDQFHKROHFRYHU YHQWVDQGGDYLWDUPEDVHDVLQGLFDWHGRQGUDZLQJV -(DFKPDLQWHQDQFHKROHFRPSRQHQWVKDOOEHIUHHRIDOOGHIHFWVLQFOXGLQJLQGHQWDWLRQV FUDFNVIRUHLJQLQFOXVLRQVDQGUHVLQVWDUYHGDUHDVWKDWGXHWRWKHLUQDWXUHDQGGHJUHHRU H[WHQWGHWULPHQWDOO\DIIHFWWKHVWUHQJWKDQGVHUYLFHDELOLW\RIWKHFRPSRQHQWSDUW7KH LQWHUQDOGLDPHWHURIPDLQWHQDQFHKROHFRPSRQHQWVVKDOOQRWYDU\PRUHWKDQ 9DULDWLRQVLQKHLJKWRIWZRRSSRVLWHVLGHVRIULVHUVDQGFRQLFDOWRSVVKDOOQRWEHPRUHWKH LQFK7KHXQGHUUXQLQKHLJKWRIDULVHURUFRQLFDOWRSVKDOOQRWEHPRUHWKDQOLQFK SHUIRRWRIKHLJKWZLWKDPD[LPXPRILQFKLQDQ\RQHVHFWLRQ .0DUNLQJDQG,GHQWLILFDWLRQ ,QVLGHDQG2XWVLGHRI0+  0DQXIDFWXUHU VQDPHRUWUDGHPDUN  0DQXIDFWXUHU VORFDWLRQ  3URGXFWLRQ'DWH /0LQLPXPFOHDUGLVWDQFHEHWZHHQWZRZDOOSHQHWUDWLRQVVKDOOEHDPLQLPXPRILQFKHVRQ LQFKWRLQFKGLDPHWHU$FOHDUDQFHRILQFKHVLVUHTXLUHGEHWZHHQZDOOSHQHWUDWLRQ DQGMRLQW 0([WHQGHGEDVHIRRWHUUHTXLUHPHQWVIRUEXR\DQF\FRQFHUQVFDQEHDGGUHVVHGZLWK FHPHQWLWLRXVFRQFUHWHPDWHULDO 1([FHSWLRQVWR$670&FRPSRQHQWVVKDOOEHGHVLJQHGIRUWKHLQWHQGHGFRPELQDWLRQV RIPDQXIDFWXULQJPDWHULDOV 20DWHULDOXVHGWRILOOWKHPDLQWHQDQFHKROHDQGJURXWWKHILEHUJODVVIOXPHLQWRSODFHVKDOOEH DVUHFRPPHQGHGE\WKHPDQXIDFWXUHUDQGFRPSDWLEOHZLWKWKHSRO\PHUFRQFUHWH VWUXFWXUH 3$OOPDWHULDOVQHHGHGIRUJURXWLQJDQGSDWFKLQJZLOOEHDSRO\HVWHUPRUWDUFRPSRXQG SURYLGHGE\WKHPDQXIDFWXUHURUDQDSSURYHGHTXDOE\WKHPDQXIDFWXUHU  &$67,1*6 $ 0DFKLQHEHDULQJVXUIDFHVRIIUDPHDQGFRYHUWRSURYLGHWUXHVXUIDFHV &RXQFLO1R,([KLELW'3DJHRI Page 198 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV % 3URYLGHDVROLGOLGZLWKWZRFRQFHDOHGSLFNKROHVDVGHWDLOHGRQWKH'UDZLQJV & 3URYLGHVHOIVHDOLQJV\VWHPZLWKJDVNHWJOXHGLQVHUWHGLQWRGRYHWDLOJURRYHLQERWWRPRI OLG ' )XUQLVKOLGVZKLFKUHDG,17(5&(37256$1,7$5<6(:(5LQLQFKKLJKFDVW OHWWHUV ( (PEHGFDVWLQJVLQWKHWRSVODEDQGIOXVKZLWKJUDGH ) &DVWLQJV  &20'XURVWUHHW&RPSRVLWH0DQKROH$VVHPEO\  1((1$+'IUDPHDQGVROLGFRYHU  1((1$+5IUDPHDQGVROLGFRYHU  $&&(6625,(6 $ -RLQW:UDS  *DWRU:UDSE\6HDOLQJ6\VWHP,QF % 6WHSV  3URYLGHDOXPLQXPODGGHUZLWKGLPHQVLRQVDQGPDWHULDOVDVVKRZQLQWKHGUDZLQJV & +DUGZDUH  $OOKDUGZDUHXVHGLQWKHPDLQWHQDQFHKROHDQGZLWKLQWHULRUDSSXUWHQDQFHVVKDOO EH7\SHVWDLQOHVVVWHHO ' *UDWLQJRYHU&KDQQHO  *UDWLQJVKDOOEHYLQ\OHVWHUDQG7\SH*6DVVKRZQLQWKH'UDZLQJV  *UDWLQJSLHFHVVKDOOEHIW HDVWWRZHVW E\IW QRUWKWRVRXWK ZLWKKLQJHVRQ WKHVRXWKVLGHRIWKHFKDQQHO ( ,QWHUPHGLDWH3ODWIRUP  ,QWHUPHGLDWHSODWIRUPVKDOOEHGHVLJQHGE\DQ(QJLQHHUOLFHQVHGLQWKH6WDWHRI 0LQQHVRWD'HVLJQVKDOOHQVXUHVXIILFLHQWVXSSRUWDQGDQFKRUVWRSUHYHQW GHIOHFWLRQRIWKHSODWIRUP  3URYLGHVWDLQOHVVVWHHODQFKRUVZLWKGHWDLOVDVSURYLGHGE\WKHSODWIRUP PDQXIDFWXUHU &RXQFLO1R,([KLELW'3DJHRI Page 199 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV  3ODWIRUPJUDWLQJVKDOOEHYLQ\OHVWHUZLWKUHPRYDEOHSLHFHVQRODUJHUWKDQIWE\IW DQGOHVVWKDQOEVHDFK6XSSRUWVWUXFWXUHVKDOOEHVWDLQOHVVVWHHODQG YLQ\OHVWHUVXSSRUWPHPEHUVDQGVWDLQOHVVVWHHOZDOOEUDFNHWV  3ODWIRUPVKDOOLQFOXGHDUHPRYDEOHLQE\LQVHFWLRQSRVLWLRQHGDWWKHFHQWHU RIWKHVWUXFWXUH  3ODWIRUPVKDOOLQFOXGHDQRSHQLQJIRUDIL[HGODGGHU3URYLGHDPLQLPXPLQ FOHDUDQFHEHWZHHQWKHODGGHU¶VIDFHDQGSODWIRUPWRDOORZIRUSHUVRQWUDYHO 3URYLGHDPLQLPXPLQFOHDUDQFHEHWZHHQWKHVLGHRIWKHODGGHUDQGWKH SODWIRUP  /DQGLQJSODWIRUPVKDOOPHHWDOO26+$UHTXLUHPHQWVIRUDODQGLQJSODWIRUPSURYLGHG IRUDIL[HGODGGHU%DVHORDGVKDOODVVXPHVXSSRUWIRURQHSHUVRQDQGRQH UHPRYDEOHSLHFHRISODWIRUPJUDWLQJZLWKVDIHW\IDFWRUVDVSHU26+$ 3$57 (;(&87,21  ,167$//$7,21 $ ,QVWDOOPDLQWHQDQFHVWUXFWXUHVLQDFFRUGDQFHZLWKWKH'UDZLQJVDQGWKLV6HFWLRQ &RPSOHWHGLQVWDOODWLRQVKDOOEHSOXPEZLWKLQLQFKRYHUHQWLUHVWUXFWXUHEXLOG % 3URWHFWDOOZRUNDJDLQVWIORRGLQJDQGIORDWDWLRQ & 3ODFHEDVHVODERQFRPSDFWHGJUDQXODUVXEJUDGHSUHSDUHGDVVKRZQRQWKH'UDZLQJV ' ,QWHUQDO3LSH-RLQW6HDO  7KRURXJKO\FOHDQWKHDUHDVLQZKLFKWKHMRLQWVHDOVDUHWREHLQVWDOOHG  ,QVWDOOWKHVHDOLQDFFRUGDQFHZLWKDOOPDQXIDFWXUHULQVWUXFWLRQV ( %HQFKDQG,QYHUW  7KLVPDLQWHQDQFHKROHZLOOLQFOXGHDVDQLWDU\VHZHUFKDQQHODQGILEHUJODVV 3DUVKDOOIOXPH7KH3DUVKDOOIOXPHVKDOOEHJURXWHGLQWRSODFHLQVWULFWDGKHUHQFH WRWKHGLPHQVLRQVVKRZQRQWKHGUDZLQJV  0DQXIDFWXUHGHQGDGDSWHUWUDQVLWLRQSLHFHVIURPFLUFXODUVHZHUWRUHFWDQJXODU FKDQQHODQGUHFWDQJXODUFKDQQHOWRFLUFXODUVHZHUVKDOOEHSURYLGHGE\ 2SHQ&KDQQHO)ORZRUDSSURYHGHTXDO  )LOODQGJURXWPDWHULDOVVKDOOEHSRO\PHUFRQFUHWHWKDWLVFRPSDWLEOHZLWKWKH SRO\PHUFRQFUHWHPDLQWHQDQFHKROHVWUXFWXUH ) 5LVHU-RLQWV ϭ͘)LOOMRLQWVZLWKFRPSDWLEOHHSR[\ERQGLQJDJHQWWRHOLPLQDWHLQILOWUDWLRQ)LQLVKIOXVK ZLWKWKHDGMRLQLQJVXUIDFHV)LOOWKHLQVLGHRIDQ\OHDNLQJMRLQWZLWKHSR[\ERQGLQJ DJHQW &RXQFLO1R,([KLELW'3DJHRI Page 200 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV  $OORZMRLQWVWRFXUHEHIRUHEDFNILOOLQJ%DFNILOOFDUHIXOO\DQGHYHQO\DURXQG PDLQWHQDQFHKROHVHFWLRQ * 3UHYHQWHQWUDQFHRIVRLODQGGHEULVLQWRDOOQHZDQGH[LVWLQJPDLQWHQDQFHKROHV + 3LSH&RQQHFWLRQVDQG3HQHWUDWLRQVSHU3URMHFW'UDZLQJV , 5LVHU-RLQWV  6HDOMRLQWVEHWZHHQSUHFDVWVHFWLRQVZLWKDUXEEHU2ULQJVHWLQDUHFHVV  )LOOMRLQWVZLWKDFRPSDWLEOHHSR[\ERQGLQJDJHQWWRHOLPLQDWHLQILOWUDWLRQ)LQLVK IOXVKZLWKWKHDGMRLQLQJVXUIDFHV)LOOWKHLQVLGHRIDQ\OHDNLQJMRLQWZLWKDQHSR[\ ERQGLQJDJHQW  $OORZMRLQWVWRVHWIRUKRXUVEHIRUHEDFNILOOLQJ%DFNILOOFDUHIXOO\DQGHYHQO\ DURXQGWKHPDLQWHQDQFHKROHVHFWLRQ  ,QVWDOOJDWRUZUDSDURXQGDOOULVHUMRLQWV  7(67,1*$1',163(&7,21 $ &RRUGLQDWHZLWKDQGVFKHGXOHWHVWLQJVHUYLFHV % &RQGXFWDYLVXDOLQVSHFWLRQRIWKHVWUXFWXUHWRLGHQWLI\LQILOWUDWLRQ$OOLQILOWUDWLRQVRXUFHV VKDOOEHVHDOHGZLWKFKHPLFDOJURXW  ),(/'48$/,7<&21752/ $ *HQHUDO  0RQLWRUUHFRUGDQGUHSRUWWR&$5GHIHFWVRUGDPDJHWRPDWHULDOVGXULQJ LQVWDOODWLRQ  &RPSOHWHDYLGHRLQVSHFWLRQRIWKHILQLVKHGPDLQWHQDQFHKROHVWUXFWXUH9LGHR VKDOOEHXVLQJDSDQRUDPLFGHJUHHKLJKGHILQLWLRQFDPHUDGHSOR\HGDWJUDGH DQGORZHUHGWKURXJKWKHVWUXFWXUH6XEPLWYLGHRGRFXPHQWDWLRQWR&$5ZLWKLQ GD\VIROORZLQJLQVSHFWLRQ % &OHDQLQJDQG3URWHFWLRQ  &OHDQDQGSURWHFWZRUNLQSURJUHVVGXULQJKDQGOLQJDQGGXULQJLQVWDOODWLRQ$SSO\ SURWHFWLYHFRYHULQJVRQPDWHULDOVRULQVWDOOHGZRUNWRHQVXUHWKHPDWHULDOVDUHIUHH IURPGDPDJHRUGHWHULRUDWLRQ  &OHDQDQGSHUIRUPPDLQWHQDQFHRQWKHVWUXFWXUHDQGDSSXUWHQDQFHVSULRUWR UHYLHZIRUILQDODFFHSWDQFHE\WKH&$5 &RXQFLO1R,([KLELW'3DJHRI Page 201 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV *UDYLW\6HZHU0DLQWHQDQFH+ROHV  ),1$/$&&(37$1&( $ 'HIHFWV:KHQ&$5GHHPVDGHIHFWLVUHSDLUDEOHUHSDLUGHIHFWV,IDGHIHFWLVQRW UHSDLUDEOHUHSODFHGDPDJHGPDWHULDOVRULQVWDOODQHZVWUXFWXUHFRPSRQHQWDWQR DGGLWLRQDOFRVWWRWKH&281&,/ % 5HKDELOLWDWLRQRI'HIHFWV3ULRUWR$FFHSWDQFH$IWHUYDULRXVW\SHVRIUHKDELOLWDWLRQZRUNDUH FRPSOHWHWKHZRUNVKDOOEHYLVXDOO\LQVSHFWHGIRUFRPSOLDQFHLQWKHSUHVHQFHRIWKH&$5 & 5HKDELOLWDWLRQRI'HIHFWV$IWHU$FFHSWDQFH7KH&$5UHVHUYHVWKHULJKWWRLQVSHFWWKH VWUXFWXUHGXULQJWKH\HDUZDUUDQW\SHULRG$Q\OHDNDJHRUGHIHFWVLQWKHZRUNIRXQGE\ WKLVLQVSHFWLRQVKDOOEHFRUUHFWHGE\WKH&RQWUDFWRUZLWKLQGD\VIURPQRWLFHDQGDWQR DGGLWLRQDOFRVWWRWKH&281&,/ (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 202 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &&79,QVSHFWLRQRI*UDYLW\6HZHU 6(&7,21 &&79,163(&7,212)*5$9,7<6(:(5 3$57 *(1(5$/  6(&7,21,1&/8'(6 $ &ORVHG&LUFXLW7HOHYLVLRQ &&79 ,QVSHFWLRQRIVHZHUVXVLQJLQWHUQDOYLGHRHTXLSPHQWIRUWKH SXUSRVHVRIDVVHVVLQJWKRURXJKQHVVRIFOHDQLQJREVHUYLQJDQGUHFRUGLQJVWUXFWXUDODQGVHUYLFH GHIHFWVDQGFRQVWUXFWLRQIHDWXUHVDQGWRYHULI\QHZVHZHUFRQVWUXFWLRQSULRUWRDFFHSWDQFH % $OOGHVLJQDWHGVHZHUVHFWLRQVVKDOOEHYLVXDOO\LQVSHFWHGE\PHDQVRIFRORUFORVHGFLUFXLW WHOHYLVLRQ &&79 VSHFLILFDOO\GHVLJQHGIRUVHZHULQVSHFWLRQ7KHWHOHYLVLQJVKDOORQO\EH SHUIRUPHGE\H[SHULHQFHGSHUVRQQHOLQSRVVHVVLRQRIDYDOLG3$&32SHUDWRUV&HUWLILFDWH & ,QVSHFWLRQREVHUYDWLRQVVKDOOEHUHFRUGHGLQDFFRUGDQFHZLWK3$&3VWDQGDUGV  '(),1,7,216 $ 6SLOO$VSLOOLVDQ\E\SDVVRIZDVWHZDWHUIURPWKH0HWURSROLWDQ'LVSRVDO6\VWHPLQFOXGLQJ ZLWKRXWOLPLWDWLRQEDFNXSVDQGGLVFKDUJHLQWREDVHPHQWVVWUHHWVVWRUPVHZHUVZHWODQGVZDWHU ERGLHVDQGRUJURXQG  352-(&7'2&80(176 $ 5HIHUWRWKH'UDZLQJVIRUQHZSLSHVWKDWZLOOEHFRQVWUXFWHGDQGVKDOOEHLQVSHFWHG  68%0,77$/6 $ 6XEPLWDYDOLGFRS\RIWKH1$66&23$&32SHUDWRUV&HUWLILFDWHIRUHDFKRSHUDWRUWRWKH&$5D PLQLPXPRIZRUNLQJGD\VEHIRUHVWDUWLQJWKHLQVSHFWLRQZRUN % 6XEPLW3LSH7HFKŠ&&79VHZHULQVSHFWLRQGDWDDQGUHSRUWVIRUHDFKSLSHOLQHVHJPHQWRQD SRUWDEOHKDUGGULYHPRQWKO\DVGDWDLVFROOHFWHGIRU&RXQFLOUHYLHZXQWLOZRUNLVFRPSOHWH 3$57 352'8&76 12786(' 3$57 (;(&87,21  23(5$72548$/,),&$7,216)25,163(&7,21$1'&21',7,21&2',1* $ 3URYLGHDPLQLPXPRIRQHRSHUDWRURQVLWHDWDOOWLPHVZLWKHDFKLQVSHFWLRQXQLWZKRKROGVD YDOLG3$&3FHUWLILFDWHIURP1$66&2(QVXUHHDFKRSHUDWRULVIXOO\WUDLQHGLQDOODVSHFWVRI VHZHULQVSHFWLRQDQGFDSDEOHRIPDNLQJDFFXUDWHREVHUYDWLRQVDQGUHFRUGLQJDOOFRQGLWLRQVWKDW PD\EHHQFRXQWHUHGLQWKHVHZHUV % 3HUIRUPLQVSHFWLRQZRUNDQGFRQGLWLRQFRGLQJRQO\XVLQJRSHUDWRUVZKRKROGDYDOLG3$&3 FHUWLILFDWH  (48,30(17 $ 7KHWHOHYLVLRQFDPHUDDQGDOORWKHUGHYLFHVXVHGIRULQVSHFWLRQVKDOOEHRQHVSHFLILFDOO\ GHVLJQHGDQGFRQVWUXFWHGIRUVXFKLQVSHFWLRQ7KHFDPHUDVKDOOEHFDSDEOHRIUDGLDOYLHZIRU LQVSHFWLRQRIWKHWRSERWWRPDQGVLGHVRIWKHSLSHDQGIRUORRNLQJXSODWHUDOFRQQHFWLRQ7KH FDPHUDVKDOOEHPRXQWHGRQDVHOISURSHOOHGWUDQVSRUWHURURQDGMXVWDEOHVNLGVIORDWVWRNHHSLW LQWKHFHQWHURIWKHSLSH/LJKWLQJVKDOOEHVXSSOLHGE\DODPSRQWKHFDPHUDFDSDEOHRIEHLQJ GLPPHGRUEULJKWHQHGUHPRWHO\IURPWKHFRQWUROSDQHO7KHOLJKWLQJV\VWHPVKDOOEHFDSDEOHRI OLJKWLQJWKHHQWLUHSHULSKHU\RIWKHSLSHDQGJLYHDQHXWUDOFRORUWRWKHLPDJH7KHFDPHUDVKDOO EHRSHUDWLYHLQKXPLGLW\FRQGLWLRQVDQGVKDOOKDYHDPLQLPXPRIOLQHVRIUHVROXWLRQ DQGWHVWHGDWSVL7KHYLHZVHHQE\WKHWHOHYLVLQJFDPHUDVKDOOEHWUDQVPLWWHGWRWKH &RXQFLO1R,([KLELW'3DJHRI Page 203 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &&79,QVSHFWLRQRI*UDYLW\6HZHU PRQLWRUDQGRWKHUFRPSRQHQWVRIWKHYLGHRV\VWHPVKDOOEHFDSDEOHRISURGXFLQJDSLFWXUH TXDOLW\VDWLVIDFWRU\WRWKH&$5DQGLIXQVDWLVIDFWRU\WKHHTXLSPHQWVKDOOEHUHPRYHGDQGQR SD\PHQWEHPDGHIRUXQVDWLVIDFWRU\LQVSHFWLRQ % 'XHWRVWUXFWXUHGHSWKDQGORFDWLRQVFDPHUDYLGHRHTXLSPHQWPXVWEHFDSDEOHRILQVSHFWLQJD PLQLPXPRIIHHWRIVHZHUIURPDVLQJOHDFFHVVSRLQW  $&&(66 $ &2175$&725PXVWORFDWHDQGGHVLJQDWHDOO0+DFFHVVSRLQWVIRUWKHZRUN,IDGHVLJQDWHG 0+LVEHORZH[LVWLQJJUDGH&2175$&725PXVWQRWLI\&$57KH&$5ZLOOGHWHUPLQHLIWKH0+ LVUHTXLUHGWREULQJWRJUDGHRULIRWKHUPHDQVDUHDYDLODEOHWRFRPSOHWH&&79LQVSHFWLRQ  7(/(9,6,1* $ 7KHWHOHYLVLRQFDPHUDVKDOOEHPRYHGWKURXJKWKHLQWHUFHSWRUDWDXQLIRUPUDWHVWRSSLQJZKHQ QHFHVVDU\WRHQVXUHSURSHUGRFXPHQWDWLRQRIWKHVHZHUFRQGLWLRQDQGURWDWHGWRYLHZHDFK VHUYLFHFRQQHFWLRQRUVHZHUVHUYLFHVWXE$WQRWLPHVKDOOWKHWHOHYLVLRQFDPHUDEHSXOOHGDWD VSHHGJUHDWHUWKDQIHHWSHUPLQXWH % ,IGXULQJWKHLQVSHFWLRQRSHUDWLRQWKHWHOHYLVLRQFDPHUDZLOOQRWSDVVWKURXJKWKHHQWLUHVHZHU VHFWLRQWKH&RQWUDFWRUVKDOOUHVHWXSKLVHTXLSPHQWLQDPDQQHUVRWKDWWKHLQVSHFWLRQFDQEH SHUIRUPHGIURPWKHRSSRVLWHPDLQWHQDQFHVWUXFWXUH,IDJDLQWKHFDPHUDIDLOVWRSDVVWKURXJK WKHHQWLUHVHZHUVHFWLRQWKHLQVSHFWLRQVKDOOEHFRQVLGHUHGFRPSOHWHDQGQRDGGLWLRQDO LQVSHFWLRQZRUNZLOOEHUHTXLUHG$OOFRVWVRIUHVHWXSGXHWRDQREVWUXFWLRQLQWKHVHZHUWKDWZLOO QRWDOORZWKHFDPHUDWRSDVVVKDOOEHFRQVLGHUHGLQFLGHQWDODQGSD\PHQWVKDOOEHIRUWKHOLQHDO IHHWRIWHOHYLVHGVHZHUPDLQ & ,QDGGLWLRQWRWHOHYLVLQJWKHLQWHUFHSWRUDOOPDLQWHQDQFHVWUXFWXUHVDWWKHEHJLQQLQJDQGHQGRI HDFKVXUYH\PXVWEHSDQQHGZLWKWKHYLGHRFDPHUDDQGYLVXDOO\LQVSHFWHG  ',67$1&(0($685,1* $ 7KHIRRWDJHPHWHUIRUDFFXUDWHO\UHFRUGLQJWKHORFDWLRQRIWKHWHOHYLVLRQFDPHUDZLWKUHVSHFWWR WKHUHIHUHQFHPDLQWHQDQFHVWUXFWXUHVKDOOEHDGLUHFWUHDGLQJDERYHJURXQGIULFWLRQFODPS GHYLFHRURWKHUVXLWDEOHHTXLSPHQW0DUNLQJRQWKHFDEOHRUWKHOLNHZKLFKZRXOGUHTXLUH LQWHUSRODWLRQIRUGHSWKRIPDLQWHQDQFHVWUXFWXUHZLOOQRWEHDOORZHG7KHPHWHUVKDOOEHFDSDEOH RIEHLQJPDQXDOO\UH]HURHGIRUHDFKQHZVHWXS)RRWDJHVKDOOEHVKRZQRQWKHYLGHRGDWDYLHZ DQGUHFRUGHGDWDOOWLPHVDQGPXVWEH]HURHGDWWKHEHJLQQLQJRIHDFKVXUYH\$OOIRRWDJHVPXVW EHZLWKLQIWDORQJWKHLQWHUFHSWRUFHQWHUOLQHIURPFHQWHURI0+WRFHQWHURI0+)RRWDJH PXVWEHVKRZQRQWKHYLGHRGDWDYLHZDQGUHFRUGHGDWDOOWLPHV  &2',1*9,'(2,163(&7,21 $ $OOGDWDPXVWEHFROOHFWHGLQDFFRUGDQFHZLWK3$&3VWDQGDUGL]HGFRGLQJDQGUHSRUWLQJ % 0&(6FXUUHQWO\XVHV3LSH7HFKŠLQVSHFWLRQVRIWZDUHIURP3HQLQVXODU7HFKQRORJLHV8VHRIWKH ODWHVWYHUVLRQRI3LSH7HFKŠDSSOLFDWLRQLVUHTXLUHGIRUWKLVSURMHFW2WKHU3$&3FHUWLILHG LQVSHFWLRQVRIWZDUHSDFNDJHVZLOOQRWEHDFFHSWHG & )LOHQDPHVVKDOOEHODEHOHGXVLQJ0&(6*,6DWWULEXWHLQIRUPDWLRQZKHQDYDLODEOH ' :KHQDYDLODEOHHDFK0+WR0+VHFWLRQVKDOOEHODEHOHGXVLQJDFRQFDWHQDWLRQRIWKH³,'B12´ DQXQGHUVFRUH ³B´ DQGWKH³,17B6(&7´DWWULEXWHLQIRUPDWLRQ$QH[DPSOHZRXOGEH*9 B,QFDVHVZKHUHWKHUHDUHWZRRUPRUH,17B6(&7QXPEHUVEHWZHHQVWUXFWXUHVWKH ORQJHVWVHFWLRQVKRXOGEHVHOHFWHG ( :KHQDVSDUWRIWKH:25.LI*,6DWWULEXWHLQIRUPDWLRQLVXQDYDLODEOHGXHWR0+DGGLWLRQ UHSODFHPHQWRUUHPRYDORUSLSHDGGLWLRQUHSODFHPHQWRUUHPRYDOHDFK0+WR0+VHFWLRQVKDOO EHODEHOHGXVLQJWKHFRQWUDFWSODQDQGSURILOHVKHHWVDQGDFRQFDWHQDWLRQRIWKH³,QWHUFHSWRU,'´ &RXQFLO1R,([KLELW'3DJHRI Page 204 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &&79,QVSHFWLRQRI*UDYLW\6HZHU DQXQGHUVFRUH ³B´ DQG0+WR0+LQIRUPDWLRQ$QH[DPSOHZRXOGEH*9B0+0+  7KHVWUXFWXUHZKHUHWKHVXUYH\EHJLQVPXVWEHWKHILUVWOLVWHGLQWKHILOHQDPH ) $IROGHUIRUHDFK0+WR0+VHFWLRQVKDOOEHFUHDWHGDQGODEHOHGDVQRWHGDERYHLQDUWLFOH& :LWKLQHDFKIROGHUWKHIROORZLQJILOHVVKDOOEHVWRUHG3LSH7HFKILOH SWG LQVSHFWLRQYLGHR PSJ  3$&3WRSYLHZUHSRUW SGI DQG3$&3VQDSVKRWUHSRUW SGI   48$/,7<&21752/ $ 7KHVXFFHVVIXO&RQWUDFWRUVKDOOGHOLYHUWR&RXQFLOVWDIIDSURSRVHGTXDOLW\DVVXUDQFHFRQWURO 4$4& SODQ1RZRUNVKDOOFRPPHQFHSULRUWRWKHDSSURYDORIWKH4$4&SODQE\&RXQFLOVWDII % 1RSD\PHQWVKDOOEHPDGHIRUVHFWLRQVIDLOLQJWKHTXDOLW\FRQWUROSDUDPHWHUV & )LQLVKHGLQVSHFWLRQYLGHRVKRXOGEHFOHDUQHXWUDOFRORUDQGFRQWLQXRXVRYHUWKHHQWLUHOHQJWK 6KRXOGWKHTXDOLW\RIWKHYLGHRRUDQ\UHTXLUHGLQIRUPDWLRQEHPLVVLQJIURPWKHVXEPLWWDOVWKH ZRUNZLOOEHGHHPHGLQFRPSOHWH7KHFRQWUDFWRUZLOOEHUHTXLUHGWRUHLQVSHFWWKHVHFWLRQ V WRWKH VDWLVIDFWLRQRI&RXQFLOVWDIIDWQRDGGLWLRQFRVWWRWKH&RXQFLO  )/2:&21752/ ' 1HZSLSHVVKDOOEHXQGHUIORZFRQWUROGXULQJSRVWFRQVWUXFWLRQDFFHSWDQFHWHVWLQJ  6(:(5,163(&7,216 $ &&79LQVSHFWLRQVRIHDFKSLSHOLQHVHJPHQWDUHUHTXLUHGEHIRUH&,33OLQLQJ 3UHOLQLQJ DQGDIWHU FRPSOHWLRQRI&,33OLQLQJ 3RVWOLQLQJ  % 1RWLI\WKH&$5RIWKHORFDWLRQVZKHUHVHZHULQVSHFWLRQVZLOOEHSHUIRUPHGRQHIXOOGD\EHIRUH VWDUWLQJLQVSHFWLRQZRUNDWWKDWORFDWLRQ & ,PSOHPHQWIORZFRQWUROPHDVXUHVLQDFFRUGDQFHZLWK$UWLFOHRIWKLV6HFWLRQZKHUHUHTXLUHGWR HQVXUHWKHIROORZLQJIORZOHYHOVDUHPDLQWDLQHGGXULQJVHZHULQVSHFWLRQV  $PLQLPXPRIRIWKHKHLJKWRIWKHVHZHULVWREHYLVLEOHGXULQJWKHVHZHUSUHOLQLQJ LQVSHFWLRQDQGWKHVHZHUSRVWOLQLQJLQVSHFWLRQ  (YDFXDWHIRJIURPWKHVHZHUDQGPDQKROHEHIRUHEHJLQQLQJLQVSHFWLRQVDQGNHHSWKHVHZHU DQGPDQKROHFOHDURIIRJGXULQJWKHHQWLUHLQVSHFWLRQ  .HHSWKHFDPHUDOHQVFOHDQGXULQJWKHHQWLUHVHZHUDQGPDLQWHQDQFHVWUXFWXUHLQVSHFWLRQ  (QVXUHWKHSLFWXUHLVLQIRFXVIURPWKHSRLQWRIREVHUYDWLRQWRDPLQLPXPRISLSHGLDPHWHUV DKHDGRIWKHFDPHUD  3HUIRUPVHZHULQVSHFWLRQVLQDFFRUGDQFHZLWKWKHIROORZLQJ D ,QWKHGRZQVWUHDPGLUHFWLRQXQOHVVDUHYHUVHVHWXSLVUHTXLUHG͘ E )URPWKHFHQWHURIWKHVWDUWPDLQWHQDQFHVWUXFWXUHWRWKHFHQWHURIWKHILQLVKPDLQWHQDQFH VWUXFWXUH F %HJLQLQVSHFWLRQVJHQHUDOO\ZLWKWKHXSVWUHDPVHZHULQWKHV\VWHPDQGSURFHHG GRZQVWUHDPLQDFRQVHFXWLYHPDQQHU G (QVXUHWKHIDFHRIWKHVWDUWPDLQWHQDQFHVWUXFWXUHLVFOHDUO\YLVLEOHDWWKHVWDUWRIWKHVHZHU LQVSHFWLRQ H 5HFRUGWKHOHQJWKRIVHZHUIURPWKHFHQWHURIWKHPDLQWHQDQFHVWUXFWXUHWRWKHFDEOH FDOLEUDWLRQSRLQWDWWKHVWDUWRIWKHLQVSHFWLRQDQGDGMXVWWKHGLVWDQFHUHDGLQJDWWKHFDEOH FDOLEUDWLRQSRLQWVRWKDW]HURLVDWWKHFHQWHURIWKHVWDUWPDLQWHQDQFHVWUXFWXUH I ,QGLFDWHRQWKHPRQLWRUVFUHHQDFFXUDWHDXWRPDWLFGLVWDQFHPHDVXUHPHQWWKDWEHJLQVWR PRYHLPPHGLDWHO\DVWKHFDPHUDPRYHV(QVXUHPHDVXUHPHQWLVDFFXUDWHIURPWKHFDEOH FDOLEUDWLRQSRLQWWRWKHFHQWHURIWKHILQLVKPDLQWHQDQFHVWUXFWXUH  5HSHUIRUPVHZHULQVSHFWLRQVZKHUHWKH&$5KDVGHWHUPLQHGWKHWROHUDQFHUHTXLUHPHQWVIRU FDPHUDSRVLWLRQDQGVSHHGDQGLQWHUQDOGLVWDQFHPHDVXUHPHQWUHTXLUHPHQWVKDYHQRWEHHQ VDWLVILHG 5(9(56(6(783,163(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 205 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV &&79,QVSHFWLRQRI*UDYLW\6HZHU $ 3HUIRUPDUHYHUVHVHWXSLQVSHFWLRQZKHQDEORFNDJHLQWKHVHZHUSUHYHQWVFRPSOHWLRQRIWKH LQVSHFWLRQIURPWKHXSVWUHDPPDLQWHQDQFHVWUXFWXUH0RYHWKHHTXLSPHQWWRWKHGRZQVWUHDP PDLQWHQDQFHVWUXFWXUHDQGDWWHPSWWRFRPSOHWHWKHLQVSHFWLRQRIWKHHQWLUHVHZHUWRWKH XSVWUHDPPDLQWHQDQFHVWUXFWXUH ,1&203/(7(,163(&7,216 $ $GYLVHWKH&$5LPPHGLDWHO\ZKHQDVHZHULQVSHFWLRQFDQQRWEHFRPSOHWHGGXHWRFROODSVH H[FHVVLYHGHIRUPDWLRQLQWUXGLQJFRQQHFWLRQVREVWUXFWLRQVRUODUJHGLVSODFHGMRLQWV-RLQWO\ GHFLGHZLWKWKH&$5RQHRIWKHIROORZLQJDOWHUQDWLYHV  $EDQGRQWKHLQVSHFWLRQRU  5HSHUIRUPWKHLQVSHFWLRQVXEVHTXHQWWRRQHRIWKHIROORZLQJDFWLRQV D 3HUIRUPLQJVROLGGHEULVFXWWLQJ E 5HPRYLQJLQWUXGLQJFRQQHFWLRQV F 0RGLI\LQJWKHFDPHUDVHWXSSRVLWLRQRUPHWKRGRIWUDQVSRUW G &RPSOHWLRQRIH[WHUQDORUHPHUJHQF\UHSDLUV 2%6(59(')$,/85(6'85,1*6(:(5,163(&7,216 $ ,PPHGLDWHO\QRWLI\WKH&$5LIDGHIHFWDSSHDUVWRSRVHDWKUHDWWRSXEOLFKHDOWKDQGVDIHW\RU LQGLFDWHVLPSHQGLQJIDLOXUH1RWLI\WKH0&(6'LVSDWFKHUDWDIWHUQRUPDOZRUNLQJ KRXUVLIWKH&$5FDQQRWEHUHDFKHG&DSWXUHSKRWRJUDSKYLGHRWDSHRUGLJLWDOLPDJHV3URYLGH WKHFDSWXUHGLPDJHVWRWKH&$5DVVRRQDVSRVVLEOH 6(:(5,163(&7,215(32576 $ &RQWUDFWRUVKDOOGHOLYHUWRWKH&$5WKHIROORZLQJ6HZHU,QVSHFWLRQ5HSRUWVIRUHDFKSLSHOLQH VHJPHQW  7ZR  FRSLHVRI&&79LQVSHFWLRQGDWDRQSRUWDEOHKDUGGULYH3RUWDEOHKDUGGULYHZLOOEH PDGHDYDLODEOHIRUSLFNXSXSRQVXFFHVVIXOGRZQORDG $&&(37$1&(2),163(&7,216 $ 7KH&$5ZLOOUHYLHZLQVSHFWLRQUHSRUWVYLGHRUHFRUGLQJVDQGHOHFWURQLFGDWDILOHVWRHQVXUH FRPSOLDQFHZLWKWKHVSHFLILFDWLRQVZLWKLQZRUNLQJGD\VRIVXEPLVVLRQ7KH&$5PD\DGMXVW WKHIUHTXHQF\RIUHYLHZVEDVHGRQWKHUHVXOWVRISUHYLRXVUHYLHZV  3RVWFRQVWUXFWLRQ,QVSHFWLRQ&$5ZLOOGHWHUPLQHDFFHSWDELOLW\RISLSHFRQVWUXFWLRQZLWKLQ ZRUNLQJGD\VRIVXEPLVVLRQRIYLGHRUHFRUGLQJ % 5HSHUIRUPVHZHUDQGPDLQWHQDQFHVWUXFWXUHLQVSHFWLRQVZKHUHWKH&$5KDVGHWHUPLQHGWKH UHTXLUHPHQWVRIWKHVSHFLILFDWLRQKDYHQRWEHHQVDWLVILHG & &RUUHFWQRQFRPSOLDQWLQVSHFWLRQVXEPLVVLRQVDQGUHVXEPLWWKHFRUUHFWHGLQVSHFWLRQVWRWKH &$5ZLWKLQZRUNLQJGD\V ' 5HSHDWWKHSURFHVVXQWLOWKHLQVSHFWLRQVXEPLVVLRQVDUHDFFHSWHGE\WKH&$5 (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 206 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV 6(&7,21 3$56+$//)/80()/2:0(7(56 3$57*(1(5$/  6(&7,21,1&/8'(6 $ 3DUVKDOOIOXPHWUDQVLWLRQFKDQQHOVHFWLRQVZLULQJDQGDFFHVVRULHV  '(),1,7,216 $ 3ULPDU\0HDVXUHPHQW'HYLFH&RQVLVWVRIWKH3DUVKDOOIOXPHDQGDFFHVVRULHV % 6HFRQGDU\0HDVXUHPHQW'HYLFH/HYHOPHDVXULQJVHQVRUDVFDOLEUDWHGE\WKH SULPDU\PHDVXUHPHQWGHYLFH  5()(5(1&(6 $ $PHULFDQ6RFLHW\IRU7HVWLQJDQG0DWHULDOV $670   $670'6WDQGDUG7HVW0HWKRGIRU7HQVLOH3URSHUWLHVRI3ODVWLFV  $670'6WDQGDUG7HVW0HWKRGVIRU)OH[XUDO3URSHUWLHVRI 8QUHLQIRUFHGDQG5HLQIRUFHG3ODVWLFVDQG(OHFWULFDO,QVXODWLQJ 0DWHULDOV  $670'6WDQGDUG7HVW0HWKRGIRU,QGHQWDWLRQ+DUGQHVV RI5LJLG3ODVWLFVE\0HDQVRID%DUFRO,PSUHVVRU  $670'6WDQGDUG7HVW0HWKRGIRU2SHQ&KDQQHO)ORZ 0HDVXUHPHQWRI:DWHUZLWKWKH3DUVKDOO)OXPH  6<67(0'(6&5,37,21 $ 6LQJOHLQFK3DUVKDOO)OXPH % &LUFXODUWRUHFWDQJXODUHQGDGDSWHUWRFRQQHFWWKHUHFWDQJXODUFKDQQHOWRWKH XSVWUHDPDQGGRZQVWUHDPFLUFXODUVHZHUV & 7KHPDQXIDFWXUHURIWKHPHWHULQJHTXLSPHQWVKDOODVVXPHRYHUDOOXQGLYLGHG UHVSRQVLELOLW\IRUWKHSHUIRUPDQFHRIWKHHTXLSPHQWVSHFLILHGKHUHLQ7KH &2175$&725VKDOOLQVSHFWDQGIXUQLVKDOOHTXLSPHQWDQGODERUQHFHVVDU\WR LQVWDOO3DUVKDOOIOXPHPHWHULQJHTXLSPHQW5HPRWH7HOHPHWU\8QLW 578 HQFORVXUHFRQGXLWVDQGDFFHVVRULHV ' 7KH&281&,/ZLOOSURYLGHUDGDUOHYHOVHQVRUXQLWDQGPRXQWLQJKDUGZDUHIRU 3DUVKDOOIOXPHPHWHULQJ7KH&281&,/LQVWDOOVDUDGDUXQLWDQGPRXQWLQJ KDUGZDUHLQDPHWHUYDXOW7KHFRQWUDFWRUVKDOOIXUQLVKDQGLQVWDOODOOFRQGXLWM ER[HVFRQGXFWRUVDQGDVVKRZQRQWKH'UDZLQJV&RRUGLQDWHZRUNZLWK&$5 &RXQFLO1R,([KLELW'3DJHRI Page 207 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV  &2175$&725VKDOOEHUHVSRQVLEOHIRUFRQGXLWVDVVKRZQLQWKH &RQWUDFW'RFXPHQWV  &281&,/ZLOOEHUHVSRQVLEOHIRUZLULQJWHUPLQDWLRQVRQ&281&,/ SURYLGHGHTXLSPHQWFDEOHVDQGFRQGXFWRUV  68%0,77$/6 $ 6XEPLWVKRSGUDZLQJVRIDOOHTXLSPHQWFRPSRQHQWVUHTXLUHGXQGHUWKLV 6HFWLRQLQDFFRUGDQFHZLWK6HFWLRQ68%0,77$/6 % 3URGXFW'DWD  7HVWUHVXOWVRIUHSUHVHQWDWLYHILEHUJODVVUHLQIRUFHGSODVWLFODPLQDWH  7\SH3URGXFW1DPHDQG5HVLQ0DQXIDFWXUHU  3URGXFW:DUUDQW\ & 6KRS'UDZLQJVVKRZLQJ  &ULWLFDOGLPHQVLRQVMRLQWLQJDQGFRQQHFWLRQVIDVWHQHUVDQGDQFKRUV  0DWHULDOVRIFRQVWUXFWLRQ  6L]HVVSDFLQJDQGORFDWLRQRIVWUXFWXUDOPHPEHUV FRQQHFWLRQVDWWDFKPHQWVRSHQLQJVDQGIDVWHQHUV  6WDII/HYHOJDXJHGHWDLOVDQGORFDWLRQ  (QGDGDSWHUGLPHQVLRQVLQVWDOODWLRQORFDWLRQVVHDOV DQGJURXWLQJRURWKHUPHDQVWRDIIL[WRWKHFKDQQHO ' 7HVW'DWD  ,QGHSHQGHQWFHUWLILHGWHVWUHVXOWVFRQILUPLQJPDWHULDOSURSHUWLHV  7HVWUHVXOWVDUHWREHSHUIRUPHGRQVSHFLPHQVUHSUHVHQWDWLYHRIWKH UHVLQVDQGUHLQIRUFHPHQWVVXEPLWWHGXSRQZLWKVXFKUHVLQVDQG UHLQIRUFHPHQWVOLVWHGE\WKHFHUWLI\LQJSDUW\  'DWDVKDOOEHQRPRUHWKDQWKUHH  \HDUVROG ( 'LVFKDUJH7DEOHV  /HYHOWRIORZGLVFKDUJHWDEOHVVKRZLQJ D )ORZHTXDWLRQV E 6XEPHUJHQFHWUDQVLWLRQZKHUHSXEOLVKHG &RXQFLO1R,([KLELW'3DJHRI Page 208 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV F $FFXUDF\ZKHUHSXEOLVKHG G 3ODQYLHZOD\RXWVKRZLQJFULWLFDOGLPHQVLRQVDQGSULPDU\SRLQWRI PHDVXUHPHQW +D  H 'LVFKDUJHWDEOHVRXUFH ) 0DQXIDFWXUHU¶VLQIRUPDWLRQ  ,QVWDOODWLRQLQVWUXFWLRQVLQFOXGLQJKDQGOLQJDQGVWRUDJHLQVWUXFWLRQV  0DQXIDFWXUHU¶V3URMHFWVSHFLILFVSHFLILFDWLRQV  $OOVXEPLWWDOVVSHFLILFDWLRQVGUDZLQJVEURFKXUHVLQVWDOODWLRQLQVWUXFWLRQV GHVFULSWLYHOLWHUDWXUHHWFVKDOOKDYHDOOXQLWVRIPHDVXUHPHQWLQ,PSHULDO XQLWV * 6XEPLWRSHUDWLQJDQGPDLQWHQDQFHGDWD  '(/,9(5<6725$*($1'+$1'/,1* $ 6WRUHSURGXFWVLQGRRUVRULQDZHDWKHUSURWHFWHGDUHDXQWLO LQVWDOODWLRQ3URWHFWIURPVXQOLJKWFRQVWUXFWLRQWUDIILFDQGGDPDJH % 5HVSRQVLELOLW\IRUWKHFDUHDQGSURWHFWLRQRIHTXLSPHQWVKDOOUHPDLQZLWK WKH&2175$&725XQWLOLWKDVEHHQWHVWHGDQGDFFHSWHG  :$55$17< $ )OXPHVVKDOOEHZDUUDQWHGWREHIUHHRIGHIHFWVLQZRUNPDQVKLSDQG PDWHULDOVIRUWZR\HDUV % 7KHZDUUDQW\SHULRGVKDOOEHIURPWKHGDWHRIFRPPLVVLRQLQJ 3$57352'8&76  3$56+$//)/80( $ 0DQXIDFWXUHUV0DWHULDOVIURPWKHIROORZLQJPDQXIDFWXUHUVDQGZKLFKPHHWWKHVH VSHFLILFDWLRQVZLOOEHDFFHSWHG  2SHQFKDQQHO)ORZ  :DUPLQVWHU)LEHUJODVV  7UDFRP  3ODVWL)DE  )53&RPSRVLWHV  ()& &RXQFLO1R,([KLELW'3DJHRI Page 209 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV  )LVKHU 3RUWHU  RUDSSURYHGHTXDO % )OXPHLQIOXHQWWUDQVLWLRQDGDSWHUVHFWLRQDQGH[LW WUDQVLWLRQDGDSWHUVHFWLRQPDWHULDOVVKDOOPHHWWKH IROORZLQJ  ,62FHUWLILHGSRO\HVWHUODPLQDWLQJUHVLQ D /RZ92& E 3URSHUWLHVVKDOOPHHWRUH[FHHG  7HQVLOH6WUHQJWK $670' SVL  )OH[XUDO6WUHQJWK $670' SVL  )OH[XUDO0RGXOXV $670' SVL  $16,$::$) 7\SH,,  %DUFRO+DUGQHVV $670'   :DWHU$EVRUSWLRQ $670'   7HPSHUDWXUHOLPLW ƒ) F 2UWKRSKWKDOLFUHVLQVVKDOOQRWEHDOORZHG  (JODVV D 0LQLPXPRIODPLQDWHFRQWHQWE\ZHLJKW E 6LODQHFRXSOLQJDJHQW F &JODVVVKDOOQRWEHDOORZHG  *HOFRDW D $OOVXUIDFHVPXVWEHJHOFRDWHGEDFNHGE\DUHVLQULFKOD\HURI UHVLQDQGFKRSSHGJODVVIRUPLQJDZDWHUDQGFKHPLFDOUHVLVWDQW VXUIDFH7KHUHPDLQGHURIWKHODPLQDWHVKDOOEHILEHUJODVV UHLQIRUFHGSRO\HVWHUFRQWDLQLQJQRWOHVVWKDQJODVVFRQWHQW E\ZHLJKW E PLOFXUHGWKLFNQHVV F 89LQKLELWRUVVKDOOEHLQDOOJHOFRDWIRUPXODWLRQV G ,QWHULRUVXUIDFHVVKDOOEHZKLWHJORVVIUHHRILUUHJXODULWLHVH[WHULRU &RXQFLO1R,([KLELW'3DJHRI Page 210 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV VXUIDFHVVKDOOEHJUH\  'LPHQVLRQDOEUDFLQJ D 5HPRYDEOHJUD\HTXDOOHJSXOWUXGHGILEHUJODVVEUDFLQJZLWK7 VWDLQOHVVVWHHOKDUGZDUHFDSDEOHRISURYLGLQJVXIILFLHQW VWUHQJWKDQGVWUXFWXUDOVXSSRUWWRUHVLVWWKHVWUHVVHVRIVKLSSLQJ DQGLQVWDOODWLRQ  LQFK[LQFK  )ODQJHV D ,QWHJUDOWRSDQGHQGIODQJHV  LQFKHVZLGH PLQLPXP  6WLIIHQLQJULEV D .QHHMRLQHGHQFDSVXODWHGVWLIIHQLQJULEVWRSURYLGHVXIILFLHQW VWUHQJWKDQGULJLGLW\WRDOORZWKHIOXPHWREHVHOIVXSSRUWLQJDQG FDSDEOHRIKROGLQJWKHUDWHGPD[LPXPKHDGRIZDWHUZLWKRXW YLVLEOHGLVWRUWLRQ  $QFKRULQJFOLSV D $QFKRUFOLSVFKHPLFDOO\ERQGHGWRWKHH[WHULRURIWKHIOXPHWRDLG LQVHFXULQJWKHIOXPHGXULQJLQVWDOODWLRQ E 3UHGULOOHGZLWK‘LQFKKROH  'LPHQVLRQDO7ROHUDQFHV D )OXPHGLPHQVLRQVVKDOOEHSOXVRUPLQXVLQFK & )OXPHVKDOOEHVL]HDVOLVWHGRQWKH'UDZLQJVDQGVKDOOEHIXOOOHQJWKPROGHG ILEHUJODVVUHLQIRUFHGSRO\HVWHUODPLQDWHGLQRQHSLHFH)OXPHVWKDWDUHSURYLGHGLQ PXOWLSOHSLHFHVZLOOQRWEHDFFHSWHG8SVWUHDPDQGGRZQVWUHDPPROGHGILEHUJODVV WUDQVLWLRQVHFWLRQVPD\EHSURYLGHGVHSDUDWHO\IURP3DUVKDOO)OXPH ' )OXPHZDOODQGIORRUWKLFNQHVVVKDOOEHDVVKRZQLQ7DEOH 7$%/( :$//7+,&.1(66(6)253$56+$//)/80(6 LQFKWKURXJKLQFK7KURDW  )/80(6,=( ,1  :$//)/225 7+,&.1(66 ,1      &RXQFLO1R,([KLELW'3DJHRI Page 211 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV  ( )OXPHVKDOOEHUHLQIRUFHGZLWKER[VHFWLRQVWLIIHQHUVGRZQWKHVLGHVDQGDFURVV WKHERWWRPLIIOXPHLV´ZLGHRUJUHDWHUDWDQ\VHFWLRQ6WLIIHQHUVVKDOOEHMRLQHG DWWKHNQHHWRIRUPDULJLGGLPHQVLRQDOO\VWDEOHIOXPH ) )OXPHVKDOOEHIUHHVWDQGLQJDQGVWURQJHQRXJKWRKROGD´PLQLPXPGHSWKRI ZDWHUZLWKRXWYLVLEOHGLVWRUWLRQ * )OXPHVKDOOKDYHORFNLQJFOLSVIDVWHQHGDORQJWKHVLGHRIWKHIOXPHWREHXVHGIRU DQFKRUDJHLQWRWKHFRQFUHWH + 6WLIIHQHUVDFURVVWKHWRSVKDOOEHSHUPDQHQW)53SXOWUXGHGDQJOHFKDQQHORU WHPSRUDU\ZRRGVSUHDGHUVDQGVKDOOSURYLGHVXIILFLHQWVWUHQJWKDQGVWUXFWXUDO VXSSRUWWRUHVLVWWKHVWUHVVHVWKDWRFFXUGXULQJVKLSSLQJDQGSURSHULQVWDOODWLRQRI WKHIOXPH , $FFHVVRULHV  0DQXIDFWXUHULQVWDOOHG6WDII/HYHOJDXJH+LJKYLVLELOLW\GLUHFWUHDG OHYHOJDXJHZLWKLQFKEODFNOHWWHUVQXPHUDOVDWPDMRUGLYLVLRQVRQD KLJKYLVLELOLW\\HOORZEDFNJURXQG6FDOHVKDOOEHJUDGXDWHGLQLQFK PDMRUGLYLVLRQVDQGLQFKPLQRUGLYLVLRQV - 3HUIRUPDQFHDQG'HVLJQ&ULWHULD  :DOOV9HUWLFDO  7KURDW6L]HLQ  'LPHQVLRQV&RQIRUPLQJZLWK$670''6WDQGDUG7HVW 0HWKRGIRU2SHQ&KDQQHO)ORZ0HDVXUHPHQWRI:DWHUZLWKWKH 3DUVKDOO)OXPH  )/80(75$16,7,216(&7,216(1'$'$37(5 $ 6KDOOEHSURYLGHGE\WKHVDPHPDQXIDFWXUHUDVWKHIOXPHPDQXIDFWXUHU % )OXPHWUDQVLWLRQVHFWLRQV(QG$GDSWHU)LEHUJODVVSLHFHVPDQXIDFWXUHGLQ VXEVWDQWLDODFFRUGZLWKDQGRIPDWHULDOVVSHFLILHGLQ$UWLFOHDERYH3URYLGH SLHFHVWKDWFDQEHDWWDFKHGWRWKHFLUFXODULQIOXHQWDQGHIIOXHQWVHZHUVDQGWKH UHFWDQJXODUFKDQQHO3URYLGHIOH[LEOHVHDOVDQGRUJURXWDVUHFRPPHQGHGE\WKH PDQXIDFWXUHUWRFRQQHFWWKHHQGDGDSWHUWRWKHIOXPH & (QGDGDSWHUVVKDOOEHE\2SHQ&KDQQHO)ORZRUHTXDO ' &RQQHFWHQGDGDSWHUVWRWKHLQIOXHQWHIIOXHQWVHZHUDQGIOXPHFKDQQHODV UHFRPPHQGHGE\WKHPDQXIDFWXUHU ( (QGDGDSWHUVVKDOOPDWFKLQIOXHQWDQGHIIOXHQWSLSHGLDPHWHUVDQGVPRRWKO\ WUDQVLWLRQIURPURXQGHGSLSHVHFWLRQWRUHFWDQJXODUIOXPHVHFWLRQWRPDWFKIOXPH FRQYHUJLQJDQGGLYHUJLQJVHFWLRQKHLJKWDQGZLGWK7UDQVLWLRQVKDOOEHLQ &RXQFLO1R,([KLELW'3DJHRI Page 212 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV DFFRUGDQFHZLWKEHVWGHVLJQSUDFWLFHVIRU3DUVKDOOIOXPHV 3$57(;(&87,21  35(3$5$7,21 $ 'HWHUPLQHDQGYHULI\DOOILHOGDQGHTXLSPHQWGLPHQVLRQV % &RRUGLQDWHHDFKLQVWDOODWLRQZLWKWHOHPHWU\V\VWHPDQGDVVRFLDWHGGHVLJQ UHTXLUHPHQWV & 5HPRYHEXUUVIURPLQVLGHRIWKHSLSHWRSURYLGHDXQLIRUPVPRRWKZDOO  ,167$//$7,21 $ ,QVWDOOHTXLSPHQWLQDFFRUGDQFHZLWKWKHPDQXIDFWXUHUUHFRPPHQGDWLRQVDQGWKHVH VSHFLILFDWLRQV % ,QVWDOO3DUVKDOOIOXPHLQRQHSLHFH&XWWLQJRUDQ\RWKHUDFWLYLW\WKDWZLOODOWHUWKH GLPHQVLRQVRIWKHIOXPHZLOOQRWEHSHUPLWWHG8SVWUHDPDQGGRZQVWUHDPPROGHG ILEHUJODVVWUDQVLWLRQVHFWLRQVPD\EHSURYLGHGDQGLQVWDOOHGVHSDUDWHO\IURP 3DUVKDOOIOXPH & ,QVWDOOIOXPHV\PPHWULFDOWRFHQWHUOLQHRIWKHDSSURDFKFKDQQHO ' &RQWUDFWRUWRFRRUGLQDWHZLWK&$5WRLQVSHFWIOXPHLQVWDOODWLRQEHIRUHSRXULQJ FRQFUHWH$IWHUSRXULQJFRQFUHWH&$5WRUHLQVSHFWIOXPHDQGYHULI\HOHYDWLRQV ( 3ODFH&/60DORQJERWWRPDQGVLGHVRIIOXPH(QVXUHWKDWDOOYRLGVDUHJLOOHGDQG DOODLUGLVSODFHG,QVWDOO&/60LQOLIWVRIDGHSWKWRHQVXUHQRIORDWLQJRUZDOO GHIOHFWLRQVZLWKOLIWVQRWH[FHHGLQJWKHWRWDOGHSWKWREHILOOHG ) ,QVWDOODWLRQ7ROHUDQFHV  )OXPHFUHVWVKDOOEHLQVWDOOHGDWWKHHOHYDWLRQVKRZQRQWKHGUDZLQJVZLWKD WROHUDQFHQRWWRH[FHHG´  &HQWHUOLQHRIWKHIOXPHVKDOOPDWFKWKHFHQWHUOLQHRIWKHXSVWUHDPSLSHDQG WUDQVLWLRQVHFWLRQ  7KHIORRURIWKHFRQYHUJLQJVHFWLRQVKDOOEHOHYHOHGODWHUDOO\DQG ORQJLWXGLQDOO\WRDWROHUDQFHQRWWRH[FHHG´RYHUWKHHQWLUHOHQJWK DQGZLGWKRIWKHFRQYHUJLQJVHFWLRQ  7KHFRQYHUJLQJWKURDWGLYHUJLQJVHFWLRQVLGHZDOOVVKDOOEHLQVWDOOHGSOXPE WRDWROHUDQFHQRWWRH[FHHG´DVPHDVXUHGIURPERWWRPWRWRSRI VHFWLRQVLGHZDOOV  3URYLGHDUHFWDQJXODUWKURDWVHFWLRQWHPSODWH´VPDOOHULQGLPHQVLRQ WKDQ$670'VWDQGDUGGLPHQVLRQVIRUIOXPHVL]HLQVWDOOHG7KH WHPSODWHVKDOOSDVVWKURXJKDQ\DUHDRIWKHWKURDWDIWHULQVWDOODWLRQZLWKRXW ELQGLQJWRGHPRQVWUDWHWKURDWVLGHZDOOVDUHSOXPEDQGSDUDOOHO &RXQFLO1R,([KLELW'3DJHRI Page 213 of 445 0HWURSROLWDQ&RXQFLO/DNHYLOOH)DUPLQJWRQ0 (QYLURQPHQWDO6HUYLFHV 3DUVKDOO)OXPH)ORZPHWHUV  ,IWKHLQVWDOOHGIOXPHIDLOVWRPHHWWKHUHTXLUHPHQWVRILWHPVDERYHWKH IOXPHVKDOOEHUHPRYHGDQGUHVHWXQWLOWKHUHTXLUHPHQWVDUHPHW  ),(/'48$/,7<&21752/ $ 8SRQGHOLYHU\RIWKHIOXPHWRVLWHEXWSULRUWRLQVWDOODWLRQ&2175$&725VKDOO SHUIRUPDMRLQWLQVSHFWLRQRIWKHIOXPHFRPSRQHQWVZLWK&$5DQG&281&,/ 0HWHULQJDQG$ODUPVWDII % 3ULRUWRSHUPDQHQWSODFHPHQWRIWKHIOXPHV\VWHP&2175$&725VKDOOILHOG YHULI\OHYHOWROHUDQFHVRIWKHLQVWDOOHGIOXPH & &2175$&725VKDOOUHPDLQUHVSRQVLEOHIRUWKH3DUVKDOOIOXPHXQWLOILHOG YHULILFDWLRQDQG,7/WHVWLQJDQGUHSRUWDUHVXFFHVVIXOO\FRPSOHWHGDQGIOXPHLV DFFHSWHGE\&281&,/  48$/,7<$6685$1&( $ 3ULRUWRSHUPDQHQWSODFHPHQWRIWKHIOXPHV\VWHP&281&,/ZLOOILHOGSHUIRUP VHFRQGDU\YHULILFDWLRQRIOHYHOWROHUDQFHVRIWKHLQVWDOOHGIOXPH % $IWHUSHUPDQHQWSODFHPHQWRIWKHIOXPHV\VWHP&281&,/ZLOOUHYHULI\OHYHO WROHUDQFHVRIWKHLQVWDOOHGIOXPHV\VWHP & &281&,/ZLOOILHOGFDOLEUDWHVHFRQGDU\PHDVXUHPHQWGHYLFH OHYHOVHQVRU DIWHUIORZKDVEHHQUHVWRUHG ' 8SRQFRPSOHWLRQRIWKHLQVWDOODWLRQRIWKHIOXPH&281&,/DQG&2175$&725 VKDOOYHULI\WKHLQVWUXPHQWDWLRQDQGGDWDDFTXLVLWLRQLVZRUNLQJSURSHUO\ ( $IWHUILHOGFDOLEUDWLRQRIWKHVHFRQGDU\PHDVXUHPHQWGHYLFHE\&281&,/ OHYHO VHQVLQJGHYLFH LQGHSHQGHQWWHVWLQJODERUDWRU\ ,7/ VKDOOYHULI\DFFXUDF\RIWKH SULPDU\PHDVXUHPHQWGHYLFH IOXPHDQGDFFHVVRULHV XVLQJG\HGLOXWLRQPHWKRGV  9HULILFDWLRQVKDOOEHFRPSOHWHGIRUWKUHHIORZVGLXUQDOSHDNIORZPHGLDQ GDLO\IORZDQGORZGLXUQDOIORZ  9HULILFDWLRQVKDOOFRPSO\ZLWK$670' (1'2)6(&7,21 &RXQFLO1R,([KLELW'3DJHRI Page 214 of 445 WWE/y ^K/>KZ/E' ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϴϱŽĨϭϬϮ Page 215 of 445 Soil Boring and Laboratory Testing Report Meter M657 Near 6923 200th Street West Farmington, Minnesota Prepared for CDM Smith Inc. Professional Certification: I hereby certify that this plan, specification, or report was prepared by me or under my direct supervision and that I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. Jeffrey D. Casmer, PE Project Engineer License Number: 52677 October 23, 2024 Project B2408775 Braun Intertec Corporation ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϴϲŽĨϭϬϮ Page 216 of 445 AA/EOE Braun Intertec Corporationp 11001 Hampshire Avenue S p Minneapolis, MN 55438 Phone: 952.995.2000 Fax: 952.995.2020 Web: braunintertec.com October 23, 2024 Project B2408775 Doug Youngblood, PE CDM Smith Inc. 652 Bielenberg Drive, Suite 203 Woodbury, MN 55125 Re: Soil Boring and Laboratory Testing Services Meter M657 Near 6923 200th Street West Farmington, Minnesota Dear Mr. Youngblood: We have completed the soil boring and laboratory testing services requested by CDM Smith Inc. for the Meter M657 project located at the above referenced address near the boundary between Lakeville and Farmington, Minnesota. Scope of Services We performed our scope of services for the project in accordance with the Professional Services Agreement between CDM Smith Inc. and Braun Intertec Corporation, dated August 13, 2024. The following list describes the tasks completed in accordance with our authorized scope of services. ƒStaking the boring location and coordinating the clearing of underground utilities. CDM Smith Inc. selected, and we staked the exploration location. ƒPerforming the requested standard penetration test (SPT) boring to a nominal depth of 50 feet below grade. ƒReviewing the recovered soil samples and preparing a boring log. ƒPerforming laboratory testing on samples selected by Braun Intertec. ƒPreparation of this factual soil boring and laboratory testing report. ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϴϳŽĨϭϬϮ Page 217 of 445 CDM Smith Inc. Project B2408775 October 23, 2024 Page 2 Provided Information Prior to mobilizing to the site, CDM Smith Inc. provided us with the approximate coordinates of the requested soil boring location. The coordinates were entered into our GPS unit for staking in the field. Exploration Location and Elevation The soil boring was located in a field used for agricultural purposes and at the time of our field exploration, the field was planted with a corn crop. Prior to staking the boring location, the farmer removed a portion of the corn to facilitate access. However, the corn was only removed along the western edge of the field and the provided coordinates for the requested boring location was east of the cut path approximately 100 feet into the corn. The final soil boring location was denoted as ST-1 and was performed at the approximate location shown on the attached figure. We acquired the surface elevation and coordinates with GPS technology using the State of Minnesota’s permanent GPS base station network. Drilling and Sampling Standard Penetration Test Borings The SPT boring was drilled with an ATV-mounted core and auger drill rig equipped with 3 1/4-inch diameter hollow-stem auger. We performed the borings in general accordance with ASTM D6151 taking penetration test samples at 2 1/2- or 5-foot intervals in general accordance with ASTM D1586. A 140-pound automatic hammer was used for the penetration tests. The boring log shows the actual sample intervals and corresponding depths. Sample Storage Representative soil samples will remain in our Minneapolis office for a period of 60 days to be available for your examination. After this time the samples will be disposed. Groundwater Observations and Borehole Abandonment The drillers checked for groundwater as the boring was advanced. The boring was checked again for the presence of groundwater after auger withdrawal. The borehole was then sealed with bentonite grout in accordance with Minnesota Department of Health regulations. ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϴϴŽĨϭϬϮ Page 218 of 445 CDM Smith Inc. Project B2408775 October 23, 2024 Page 3 Exploration Logs Log of Boring Sheets Log of Boring sheets are attached to this report. The log identifies and describes the penetrated geologic materials, and presents the results of penetration resistance tests, laboratory tests performed on penetration test samples, and groundwater measurements. We inferred strata boundaries from changes in the penetration test samples and/or the auger cuttings. Because we did not perform continuous sampling, the strata boundary depths are only approximate. The boundary depths likely vary away from the boring locations, and the boundaries themselves may also occur as gradual rather than abrupt transitions. Geologic Origins We assigned geologic origins to the materials shown on the log based on: (1) a review of local geology maps, (2) visual classification of the various geologic material samples retrieved during the course of our subsurface exploration, (3) penetration resistance testing performed for the project, and (4) available common knowledge of the geologic processes and environments that have impacted the site and surrounding area in the past. Material Classification and Testing Visual and Manual Classification We visually and manually classified the geologic materials encountered based on ASTM D2488. When we performed laboratory classification tests, we used the results to classify the geologic materials in accordance with ASTM D2487. The attached Descriptive Terminology includes a chart explaining the classification system we used. Laboratory Testing Laboratory testing was performed on samples recovered from the boring as selected by us. Laboratory testing performed included moisture content tests, Atterberg limits, and mechanical sieve analysis (#200 sieve only). The tests were performed in accordance with ASTM procedures. The results are noted on the boring log across from the corresponding sample. ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϴϵŽĨϭϬϮ Page 219 of 445 CDM Smith Inc. Project B2408775 October 23, 2024 Page 4 Groundwater Fluctuations Groundwater measurements were made under the conditions reported herein and shown on the exploration log. It should be noted that the observation period was relatively short, and groundwater can be expected to fluctuate in response to rainfall, flooding, irrigation, seasonal freezing and thawing, surface drainage modifications, and other seasonal and annual factors. Standard of Care In performing our services, Braun Intertec has used that degree of care and skill ordinarily exercised under similar circumstances by reputable members of our profession currently practicing in the same locality. No warranty, express or implied, is made. General We appreciate the opportunity to be of service to you on this project. If you have any questions regarding this report, please call Jeff Casmer at 952.995.2314. Sincerely, BRAUN INTERTEC CORPORATION Jeffrey D. Casmer, PE Project Engineer Joshua L. Kirk, PE Director, Senior Engineer Attachments: Soil Boring Location Sketch Log of Boring Sheets ST-1 (2 pages) Descriptive Terminology of Soil ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϵϬŽĨϭϬϮ Page 220 of 445 200TH STREET W. (CR 64)GABARDINE LANEST-1 Project No: B2408775 Drawn By: Date Drawn: Checked By: Last Modified: 10/9/24 Drawing No: F:\2024\B2408775\CAD\B2408775.dwg,Geotech,10/9/2024 1:51:21 PM B2408775 JAG 9/24/24 JC Meter M657 6923 200th Street W. Farmington, Minnesota Soil Boring Location Sketch 952.995.2000 Minneapolis, MN 55438 11001 Hampshire Avenue S braunintertec.com N DENOTES APPROXIMATE LOCATION OF STANDARD PENETRATION TEST BORING 0 SCALE:1"= 150' 150'75' &RXQFLO1R,([KLELW'3DJHRI Page 221 of 445 (OHY 'HSWK IW      :DWHU/HYHO'HVFULSWLRQRI0DWHULDOV 6RLO$670'RU5RFN86$&((0  6$1'<6,/7 0/ GDUNEURZQPRLVW 72362,/),// ),//6,/7ZLWK6$1' 0/ ZLWKOD\HUVRIQRQ RUJDQLFDQGRUJDQLF&OD\EURZQGDUNEURZQ DQGEODFNPRLVW /($1&/$< &/ FRQWDLQVVHDPVRI6LOW EURZQPRLVWPHGLXP */$&,$/7,// 6$1'</($1&/$< &/ WUDFH*UDYHOJUD\ PRLVWVRIWWRKDUG */$&,$/7,// :HW*UDYHOOD\HUDWIHHW &RQWLQXHGRQQH[WSDJH      6DPSOH%ORZV 19DOXH 5HFRYHU\                            TᏵ WVI      0&       7HVWVRU5HPDUNV 3  // 3/ 3,  1RUHFRYHU\ /2*2)%25,1* 6HH'HVFULSWLYH7HUPLQRORJ\VKHHWIRUH[SODQDWLRQRIDEEUHYLDWLRQV 3URMHFW1XPEHU% 6RLO%RULQJV 0HWHU0 WK6WUHHW:HVW )DUPLQJWRQ0LQQHVRWD %25,1*67 /2&$7,21&DSWXUHGZLWK57.*36 '$7801$'+$51$GM01'DNRWD 86)HHW 1257+,1*($67,1* '5,//(5% .DPPHUPHLHU /2**('%<- &DVPHU 67$57'$7((1''$7( 685)$&( (/(9$7,21IW 5,*0(7+2'+6$685)$&,1*)DUP :($7+(56XQQ\ %%UDXQ,QWHUWHF&RUSRUDWLRQ 3ULQW'DWH67 SDJHRI &RXQFLO1R,([KLELW'3DJHRI Page 222 of 445 (OHY 'HSWK IW    :DWHU/HYHO'HVFULSWLRQRI0DWHULDOV 6RLO$670'RU5RFN86$&((0  6$1'</($1&/$< &/ WUDFH*UDYHOJUD\ PRLVWVRIWWRKDUG */$&,$/7,// 3225/<*5$'('6$1' 63 ILQHWR PHGLXPJUDLQHGJUD\ZHWYHU\GHQVH */$&,$/287:$6+ (1'2)%25,1* %RULQJLPPHGLDWHO\EDFNILOOHGZLWKEHQWRQLWH JURXW      6DPSOH%ORZV 19DOXH 5HFRYHU\             TᏵ WVI    0&    7HVWVRU5HPDUNV 3  :DWHUREVHUYHGDWIHHW DWHQGRIGULOOLQJ /2*2)%25,1* 6HH'HVFULSWLYH7HUPLQRORJ\VKHHWIRUH[SODQDWLRQRIDEEUHYLDWLRQV 3URMHFW1XPEHU% 6RLO%RULQJV 0HWHU0 WK6WUHHW:HVW )DUPLQJWRQ0LQQHVRWD %25,1*67 /2&$7,21&DSWXUHGZLWK57.*36 '$7801$'+$51$GM01'DNRWD 86)HHW 1257+,1*($67,1* '5,//(5% .DPPHUPHLHU /2**('%<- &DVPHU 67$57'$7((1''$7( 685)$&( (/(9$7,21IW 5,*0(7+2'+6$685)$&,1*)DUP :($7+(56XQQ\ %%UDXQ,QWHUWHF&RUSRUDWLRQ 3ULQW'DWH67 SDJHRI &RXQFLO1R,([KLELW'3DJHRI Page 223 of 445 DescriptiveTerminologyofSoil BasedonStandardsASTMD2487/2488 (UnifiedSoilClassificationSystem) Group Symbol GroupNameB Cuш4and1чCcч3D GW WellͲgradedgravelE Cu<4and/or(Cc<1orCc>3)D GP PoorlygradedgravelE FinesclassifyasMLorMH GM SiltygravelEFG FinesClassifyasCLorCH GC ClayeygravelEFG Cuш6and1чCcч3D SW WellͲgradedsandI Cu<6and/or(Cc<1orCc>3)D SP PoorlygradedsandI FinesclassifyasMLorMH SM SiltysandFGI FinesclassifyasCLorCH SC ClayeysandFGI CL LeanclayKLM PI<4orplotsbelow"A"lineJ ML SiltKLM Organic OL CH FatclayKLM MH ElasticsiltKLM Organic OH PT PeatHighlyOrganicSoils SiltsandClays (Liquidlimitlessthan 50) SiltsandClays (Liquidlimit50or more) Primarilyorganicmatter,darkincolor,andorganicodor Inorganic Inorganic PI>7andplotsonorabove"A"lineJ PIplotsonorabove"A"line PIplotsbelow"A"line CriteriaforAssigningGroupSymbolsand GroupNamesUsingLaboratoryTestsA SoilClassification CoarseͲgrainedSoils(morethan50%retainedonNo.200sieve)FineͲgrainedSoils(50%ormorepassestheNo.200sieve)Sands (50%ormorecoarse fractionpassesNo.4 sieve) CleanGravels (Lessthan5%finesC) GravelswithFines (Morethan12%finesC) CleanSands (Lessthan5%finesH) SandswithFines (Morethan12%finesH) Gravels (Morethan50%of coarsefraction retainedonNo.4 sieve) LiquidLimitоovendried LiquidLimitоnotdried<0.75 OrganicclayKLMN OrganicsiltKLMO LiquidLimitоovendried LiquidLimitоnotdried<0.75 OrganicclayKLMP OrganicsiltKLMQ ParticleSizeIdentification Boulders..............over12" Cobbles................3"to12" Gravel Coarse.............3/4"to3"(19.00mmto75.00mm) Fine.................No.4to3/4"(4.75mmto19.00mm) Sand Coarse..............No.10toNo.4(2.00mmto4.75mm) Medium...........No.40toNo.10(0.425mmto2.00mm) Fine..................No.200toNo.40(0.075mmto0.425mm) Silt........................No.200(0.075mm)to.005mm Clay......................<.005mm RelativeProportionsL,M trace.............................0to5% little..............................6to14% with..............................ш15% InclusionThicknesses lens...............................0to1/8" seam.............................1/8"to1" layer..............................over1" ApparentRelativeDensityofCohesionlessSoils Veryloose.....................0to4BPF Loose............................5to10BPF Mediumdense..............11to30BPF Dense............................31to50BPF Verydense....................over50BPF A. Basedonthematerialpassingthe3Ͳinch(75Ͳmm)sieve. B. Iffieldsamplecontainedcobblesorboulders,orboth,add"withcobblesorboulders, orboth"togroupname. C.Gravelswith5to12%finesrequiredualsymbols: GWͲGM wellͲgradedgravelwithsilt GWͲGCwellͲgradedgravelwithclay GPͲGM poorlygradedgravelwithsilt GPͲGCpoorlygradedgravelwithclay D. Cu =D60 /D10 Cc =ܦ30 2 /ሺܦ10 ݔ ܦ60) E. Ifsoilcontainsш15%sand,add"withsand"togroupname. F. IffinesclassifyasCLͲML,usedualsymbolGCͲGMorSCͲSM. G.Iffinesareorganic,add"withorganicfines"togroupname. H.Sandswith5to12% finesrequiredualsymbols: SWͲSM wellͲgradedsandwithsilt SWͲSCwellͲgradedsandwithclay SPͲSM poorlygradedsandwithsilt SPͲSC poorlygradedsandwithclay I. Ifsoilcontainsш15%gravel,add"withgravel"togroupname. J.IfAtterberglimitsplotinhatchedarea,soilisCLͲML,siltyclay. K. Ifsoilcontains15to<30%plusNo.200,add"withsand"or"withgravel",whicheveris predominant. L.Ifsoilcontainsш30%plusNo.200,predominantlysand,add“sandy”togroupname. M.Ifsoilcontainsш30%plusNo.200predominantlygravel,add“gravelly”togroupname. N.PIш4andplotsonorabove“A”line. O.PI<4orplotsbelow“A”line. P.PIplotsonorabove“A”line. Q. PIplotsbelow“A”line. Laboratory Tests DD Drydensity,pcf qp Pocketpenetrometerstrength,tsf WD Wetdensity,pcf qU Unconfinedcompressiontest,tsf P200 %Passing#200sieve LL Liquidlimit MC Moisturecontent,%PL Plasticlimit OC Organiccontent,%PI Plasticityindex ConsistencyofBlows ApproximateUnconfined CohesiveSoils PerFoot CompressiveStrength Verysoft...................0to1BPF...................<0.25tsf Soft...........................2to4BPF...................0.25to0.5tsf Medium....................5to8BPF..................0.5to1tsf Stiff...........................9to15BPF.................1to2tsf VeryStiff...................16to30BPF...............2to4tsf Hard..........................over30BPF................>4tsf DrillingNotes: Blows/NͲvalue:Blowsindicatethedrivingresistancerecorded foreach6Ͳinchinterval.ThereportedNͲvalueistheblowsper footrecordedbysummingthesecondandthirdintervalin accordancewiththeStandardPenetrationTest,ASTMD1586. PartialPenetration:Ifthesamplercouldnotbedriven throughafull6Ͳinchinterval,thenumberofblowsforthat partialpenetrationisshownas#/x"(i.e.50/2").TheNͲvalueis reportedas"REF"indicatingrefusal. Recovery:Indicatestheinchesofsamplerecoveredfromthe sampledinterval.Forastandardpenetrationtest,fullrecovery is18",andis24"forathinwall/shelbytubesample. WOH:Indicatesthesamplerpenetratedsoilunderweightof hammerandrodsalone;drivingnotrequired. WOR:Indicatesthesamplerpenetratedsoilunderweightof rodsalone;hammerweightanddrivingnotrequired. WaterLevel:Indicatesthewaterlevelmeasuredbythe drillerseitherwhiledrilling(),attheendofdrilling(), oratsometimeafterdrilling(). MoistureContent: Dry:Absenceofmoisture,dusty,drytothetouch. Moist:Dampbutnovisiblewater. Wet:Visiblefreewater,usuallysoilisbelowwatertable. 5/2021 ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϵϰŽĨϭϬϮ Page 224 of 445 WWE/y ZKZZt/E'^ ŽƵŶĐŝůEŽ͘Ϯϰ/ϬϮϱ͕džŚŝďŝƚ͕WĂŐĞ͘ϵϱŽĨϭϬϮ Page 225 of 445 RECORD DRAWING - NOT FOR CONSTRUCTION&RXQFLO1R,([KLELW'3DJHRIPage 226 of 445 RECORD DRAWING - NOT FOR CONSTRUCTION&RXQFLO1R,([KLELW'3DJHRIPage 227 of 445 RECORD DRAWING - NOT FOR CONSTRUCTION&RXQFLO1R,([KLELW'3DJHRIPage 228 of 445 RECORD DRAWING - NOT FOR CONSTRUCTION&RXQFLO1R,([KLELW'3DJHRIPage 229 of 445 RECORD DRAWING - NOT FOR CONSTRUCTION&RXQFLO1R,([KLELW'3DJHRIPage 230 of 445 RECORD DRAWING - NOT FOR CONSTRUCTION&RXQFLO1R,([KLELW'3DJHRIPage 231 of 445 RECORD DRAWING - NOT FOR CONSTRUCTION&RXQFLO1R,([KLELW'3DJHRIPage 232 of 445 Exhibit E Lakeville Lennar Development Contract Page 233 of 445 $PVODJM/P* &YIJCJU& 1BHFPG Page 234 of 445 236081v6 Amelia Meadows 2 public or private improvements, or any buildings until all the following conditions have been satisfied: 1) this agreement has been fully executed by both parties and filed with the City Clerk, 2) the necessary security has been received by the City, 3) the necessary insurance for the Developer and its construction contractors has been received by the City, and 4) the plat has been filed with the Dakota County Recorder or Registrar of Titles’ office. 4. PHASED DEVELOPMENT. If the plat is a phase of a multi-phased preliminary plat, the City may refuse to approve final plats of subsequent phases if the Developer has breached this Contract and the breach has not been remedied. Development of subsequent phases may not proceed until Development Contracts for such phases are approved by the City. Park dedication charges referred to in this Contract are not being imposed on outlots, if any, in the plat that are designated in an approved preliminary plat for future subdivision into lots and blocks. Such charges will be calculated and imposed when the outlots are final platted into lots and blocks. 5. PRELIMINARY PLAT STATUS. If the plat is a phase of a multi-phased preliminary plat, the preliminary plat approval for all phases not final platted shall lapse and be void unless final platted into lots and blocks, not outlots, within three (3) years after preliminary plat approval. 6. CHANGES IN OFFICIAL CONTROLS. For two (2) years from the date of this Contract, no amendments to the City’s Comprehensive Plan, except an amendment placing the plat in the current metropolitan urban service area, or official controls shall apply to or affect the use, development density, lot size, lot layout or dedications of the approved plat unless required by state or federal law or agreed to in writing by the City and the Developer. Thereafter, notwithstanding anything in this Contract to the contrary, to the full extent permitted by state law, the City may require compliance with any amendments to the City’s Comprehensive Plan, official controls, platting or dedication requirements enacted after the date of this Contract. 7. DEVELOPMENT PLANS. The plat shall be developed in accordance with the following plans. The plans shall not be attached to this Contract. With the exception of Plans A, B, C, and F the plans may be prepared, subject to the City Engineer’s approval, after entering the Contract, but before &RXQFLO1R,([KLELW(3DJHRI Page 235 of 445 236081v6 Amelia Meadows 3 commencement of any work in the plat. The City Engineer may approve minor amendments to Plan B without City Council approval. The erosion control plan may also be approved by the Dakota County Soil and Water Conservation District. If the plans vary from the written terms of this Contract, the written terms shall control. The plans are: Plan A - Plat Plan B - Final Grading, Drainage, and Erosion Control Plan Plan C - Tree Preservation Plan Plan D - Plans and Specifications for Public Improvements Plan E - Street Lighting Plan Plan F - Landscape Plan 8. IMPROVEMENTS. The Developer shall install and pay for the following: A. Sanitary Sewer System B. Water System C. Storm Sewer System D. Streets E. Concrete Curb and Gutter F. Street Lights G. Site Grading, Stormwater Treatment/Infiltration Basins, and Erosion Control H. Underground Utilities I. Setting of Iron Monuments J. Surveying and Staking K. Sidewalks and Trails L. Retaining Walls The improvements shall be installed in accordance with the City subdivision ordinance; City standard specifications for utility and street construction; and any other ordinances including Section 11-16-7 of the City Code concerning erosion and drainage and Section 4-1-4-2 prohibiting grading, construction activity, &RXQFLO1R,([KLELW(3DJHRI Page 236 of 445 236081v6 Amelia Meadows 4 and the use of power equipment between the hours of 10 o’clock p.m. and 7 o’clock a.m. The Developer shall submit plans and specifications which have been prepared by a competent registered professional engineer to the City for approval by the City Engineer. The Developer shall instruct its engineer to provide adequate field inspection personnel to assure an acceptable level of quality control to the extent that the Developer’s engineer will be able to certify that the construction work meets the approved City standards as a condition of City acceptance. In addition, the City may, at the City’s discretion and at the Developer’s expense, have one or more City inspectors and a soil engineer inspect the work on a full or part-time basis. The Developer, its contractors and subcontractors, shall follow all instructions received from the City’s inspectors. The Developer’s engineer shall provide for on-site project management. The Developer’s engineer is responsible for design changes and contract administration between the Developer and the Developer’s contractor. The Developer or its engineer shall schedule a pre-construction meeting at a mutually agreeable time at the City with all parties concerned, including the City staff, to review the program for the construction work. In accordance with Minnesota Statutes 505.021, the final placement of iron monuments for all lot corners must be completed before the applicable security is released. The Developer’s surveyor shall also submit a written notice to the City certifying that the monuments have been installed following site grading, utility and street construction. 9. CONTRACTORS/SUBCONTRACTORS. City Council members, City employees, and City Planning Commission members, and corporations, partnerships, and other entities in which such individuals have greater than a 25% ownership interest or in which they are an officer or director may not act as contractors or subcontractors for the public improvements identified in Paragraph 8 above. 10. PERMITS. The Developer shall obtain or require its contractors and subcontractors to obtain all necessary permits, which may include: A. Dakota County for County Road Access and Work in County Rights-of-Way B. MnDot for State Highway Access C. MnDot for Work in Right-of-Way D. Minnesota Department of Health for Watermains &RXQFLO1R,([KLELW(3DJHRI Page 237 of 445 236081v6 Amelia Meadows 5 E. MPCA NPDES Permit for Construction Activity F. MPCA for Sanitary Sewer and Hazardous Material Removal and Disposal G. DNR for Dewatering H. City of Lakeville for Building Permits I. MCES for Sanitary Sewer Connections J. City of Lakeville for Retaining Walls 11. DEWATERING. Due to the variable nature of groundwater levels and stormwater flows, it will be the Developer’s and the Developer’s contractors and subcontractors responsibility to satisfy themselves with regard to the elevation of groundwater in the area and the level of effort needed to perform dewatering and storm flow routing operations. All dewatering shall be in accordance with all applicable county, state, and federal rules and regulations. DNR regulations regarding appropriations permits shall also be strictly followed. 12. TIME OF PERFORMANCE. The Developer shall install all required public improvements by November 30, 2025, with the exception of the final wear course of asphalt on streets. The final wear course on streets shall be installed between August 15th and October 15th the first summer after the base layer of asphalt has been in place one freeze thaw cycle. The Developer may, however, request an extension of time from the City. If an extension is granted, it shall be conditioned upon updating the security posted by the Developer to reflect cost increases and the extended completion date. Final wear course placement outside of this time frame must have the written approval of the City Engineer. 13. LICENSE. The Developer hereby grants the City, its agents, employees, officers and contractors a license to enter the plat to perform all work and inspections deemed appropriate by the City in conjunction with plat development. 14. EROSION CONTROL. Prior to initiating site grading, the erosion control plan, Plan B, shall be implemented by the Developer and inspected and approved by the City. The City may impose additional erosion control requirements if they would be beneficial. All areas disturbed by the grading operations shall be stabilized per the MPCA Stormwater Permit for Construction Activity. Seed shall be in accordance with the City’s current seeding specification which may include temporary seed to provide ground cover as rapidly &RXQFLO1R,([KLELW(3DJHRI Page 238 of 445 236081v6 Amelia Meadows 6 as possible. All seeded areas shall be fertilized, mulched, and disc anchored as necessary for seed retention. The parties recognize that time is of the essence in controlling erosion. If the Developer does not comply with the MPCA Stormwater Permit for Construction Activity or with the erosion control plan and schedule or supplementary instructions received from the City, the City may take such action as it deems appropriate to control erosion. The City will endeavor to notify the Developer in advance of any proposed action, but failure of the City to do so will not affect the Developer’s and City’s rights or obligations hereunder. If the Developer does not reimburse the City for any cost the City incurred for such work within ten (10) days, the City may draw down the letter of credit to pay any costs. No development, utility or street construction will be allowed and no building permits will be issued unless the plat is in full compliance with the approved erosion control plan. The Developer is responsible for meeting all the requirements of the MPCA Construction Permit. Redundant silt fence is required along all wetlands and waterways that do not have a 50-foot established buffer. The Developer is responsible for the establishment of native vegetation around all stormwater treatment basins, channel restoration and buffer areas. The Developer shall submit a management plan including a schedule for maintenance to the city for approval. Additional erosion control measures may be required during construction as deemed necessary by City staff or the Vermillion River Watershed JPO. Any additional measures required shall be installed and maintained by the Developer. The MS4 Administration Fee has not been collected on the parent parcels and is required with the final plat, calculated as follows: $1,999,483.00 x 2% Grading Costs = $39,989.66 Grading Cost Amelia Meadows 2025 Rate MS4 Administration Fee Amelia Meadows 15. GRADING. The plat shall be graded in accordance with the approved grading development and erosion control plan, Plan “B”. The plan shall conform to City of Lakeville specifications. Within thirty (30) days after completion of the grading and before the City approves individual building permits (except &RXQFLO1R,([KLELW(3DJHRI Page 239 of 445 236081v6 Amelia Meadows 7 three (3) model home permits on lots acceptable to the Building Official), the Developer shall provide the City with an “as constructed” grading plan certified by a registered land surveyor or engineer that all storm water treatment/infiltration basins and swales, have been constructed on public easements or land owned by the City. The “as constructed” plan shall include field verified elevations of the following: a) cross sections of storm water treatment/infiltration basins; b) location and elevations along all swales, wetlands, wetland mitigation areas if any, locations and dimensions of borrow areas/stockpiles, and installed “conservation area” posts; and c) lot corner elevations and house pads, and all other items listed in City Code Section 10- 3-5.NN. The City will withhold issuance of building permits until the approved certified grading plan is on file with the City and all erosion control measures are in place as determined by the City Engineer. The Developer certifies to the City that all lots with house footings placed on fill have been monitored and constructed to meet or exceed FHA/HUD 79G specifications. The soils observation and testing report, including referenced development phases and lot descriptions, shall be submitted to the Building Official for review prior to the issuance of building permits. Before a building permit is issued, a cash escrow of $1,000.00 per lot shall be furnished to the City to guarantee compliance with the erosion control and grading requirements and the submittal of an as-built certificate of survey. Prior to the release of the required individual lot grading and erosion control security that is submitted with the building permit, an as-built certificate of survey for single family lots must be submitted to verify that the final as-built grades and elevations of the specific lot and all building setbacks are consistent with the approved grading plan for the development, and amendments thereto as approved by the City Engineer, and that all required property monuments are in place. If the final grading, erosion control and as-built survey is not timely completed, the City may enter the lot, perform the work, and apply the cash escrow toward the cost. Upon satisfactory completion of the grading, erosion control and as-built survey, the escrow funds, without interest, less any draw made by the City, shall be returned to the person who deposited the funds with the City. The final grading plan shall identify all fill lots in which the building footings will be placed on fill material. The grading specifications shall also indicate that all embankments meet FHA/HUD 79G &RXQFLO1R,([KLELW(3DJHRI Page 240 of 445 236081v6 Amelia Meadows 8 specifications. The Developer shall certify to the City that all lots with footings placed on fill material are appropriately constructed. Building permits will not be issued until a soils report and an as-built certified grading plan have been submitted and approved by City staff. Amelia Meadows contains more than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required from the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. 16. CLEAN UP. The Developer shall clean dirt and debris from streets that has resulted from construction work by the Developer, home builders, subcontractors, their agents or assigns. Prior to any construction in the plat, the Developer shall identify in writing a responsible party and schedule for erosion control, street cleaning, and street sweeping. 17. OWNERSHIP OF IMPROVEMENTS. Upon completion of the work and construction required by this Contract and final acceptance by the City, the improvements lying within public easements shall become City property without further notice or action. 18. CITY ENGINEERING ADMINISTRATION, CONSTRUCTION OBSERVATION AND AS-BUILT RECORD DRAWING PREPARATION. The Developer shall pay a fee for in-house engineering administration. City engineering administration will include monitoring of construction observation, consultation with Developer and its engineer on status or problems regarding the project, coordination for final inspection and acceptance, project monitoring during the warranty period, and processing of requests for reduction in security. Fees for this service shall be three percent (3%) of construction costs identified in the Summary of Security Requirements if using a letter of credit, assuming normal construction and project scheduling. The Developer shall pay for construction observation and as-built record drawing preparation performed by the City’s in- house engineering staff or consulting engineer. Construction observation shall include part or full time inspection of proposed public utilities and street construction and will be billed on hourly rates estimated to be five percent (5%) of the estimated construction cost. Construction as-built record drawing preparation shall include field surveying, preparation of as-built record drawings and updating the City’s GIS database &RXQFLO1R,([KLELW(3DJHRI Page 241 of 445 236081v6 Amelia Meadows 9 and will be billed on hourly rates estimated to be one half of a percent (0.5%) of the estimated construction cost. 19. STORM SEWER. The Developer shall construct seven (7) publicly owned and maintained stormwater management basins and stabilization and alteration of one (1) publicly owned and maintained channel to collect and treat the stormwater runoff generated from the site. The basins will outlet to the channel within the final plat area. The channel flows west to east into the City of Farmington. The stormwater management basins and channel will be located within Outlots C, D and E which will be conveyed to the City with the final plat. The stormwater basin design is consistent with City requirements. The Developer shall install public storm sewer within the subdivision to collect and convey stormwater runoff generated from within the public right-of-way and lots to the public stormwater management basins and channel located within Outlots C, D and E. The channel conveys the stormwater off site to the eastern plat boundary into City of Farmington. Draintile construction is required in areas of non-granular soils within Amelia Meadows for the street sub-cuts and lots. Any additional draintile construction, including perimeter draintile required for building footings, which is deemed necessary during construction shall be the Developer’s responsibility to install and finance. The Storm Sewer Charge has not been collected on the parent parcels and is required with the final plat, calculated as follows: Storm Sewer Charge Summary Gross Area of Amelia Meadows 3,315,538.00 s.f. Less Area of Outlot A (Future Development) (-) 2,327,148.00 s.f. Less Area of Outlot B (Future Development) Less Area of Cedar Avenue and 200th Street Right-of-Way (-) 27,782.00 s.f. (-) 190,793.00 s.f. Total Storm Sewer Charge Area (Single-Family) = 769,815.00 s.f. 769,815.00 s.f. x $0.178/s.f. = $137,027.07 Net Area Amelia Meadows 2025 Unit Rate (Single-Family) Storm Sewer Charge Amelia Meadows &RXQFLO1R,([KLELW(3DJHRI Page 242 of 445 236081v6 Amelia Meadows 10 The Storm Sewer Charge for Outlots A and B will be collected with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. 20. SANITARY SEWER. Amelia Meadows is located within subdistrict FO-60100 of the Farmington Outlet sanitary sewer district as identified in the City’s Sanitary Sewer Comprehensive Plan. The Developer shall construct and extend 8-inch sanitary sewer within the subdivision. The wastewater from the development will be conveyed via existing trunk sanitary sewer to the MCES Farmington Interceptor and continue to the Empire Wastewater Treatment Facility. Cedar Hills North will extend the trunk sanitary sewer line through the development to the northern plat boundary. A Direct Connection Permit is required from the Metropolitan Council for the connection to the interceptor. The development shall coordinate placement of a sanitary sewer meter within the development in accordance with requirements set forth by the Metropolitan Council. The City shall credit the Developer $329,430.60 for the oversizing of the trunk sanitary sewer constructed with the development improvements. The credit will be based on the cost difference between 8-inch sewer and the sewer that will be installed. The credit will be applied to the Developer’s final plat cash fees and will be based on an estimate provided by the Developer’s engineer. The Sanitary Sewer Availability Charge has not been collected on the parent parcels and shall be paid by the Developer with the final plat, calculated as follows: 49 units x $327.00 = $16,023.00 Total Units Amelia Meadows 2025 Unit Rate Sanitary Sewer Availability Charge Amelia Meadows The Sanitary Sewer Availability Charge for Outlots A and B will be collected with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks, at the rate in effect at the time of final plat approval. 21. WATERMAIN. The Developer shall extend 8-inch watermain within the development to provide water service to the subdivision. The Developer shall extend 8-inch watermain to the northern plat boundary at Gallifrey Way and Road 11 to service future development. &RXQFLO1R,([KLELW(3DJHRI Page 243 of 445 236081v6 Amelia Meadows 11 Consistent with the City’s Comprehensive Water System Plan, trunk watermain extensions are required to be completed with the preliminary plat. The Developer shall extend 16-inch trunk watermain along the east side of Cedar Avenue from 200th Street to the north plat boundary. The Developer shall extend 12-inch trunk watermain along Gadfly Way and Road 6 to the north plat boundary. The City shall credit the Developer $39,535.00 for the oversizing of the trunk watermains in the development. The credit will be based on the cost difference between 8-inch watermain and the oversized watermain that will be installed. The credit will be applied to the Developer’s final plat cash fees and will be based on an estimate provided by the Developer’s engineer. 22. CONSTRUCTION ACCESS. Construction traffic access and egress for grading, utility and street construction will be from 200th Street. 23. UNDERGROUNDING. Overhead electric service lines and poles are located along the east side of Cedar Avenue within the western final plat area. The Developer is required to remove the poles and place the service utilities underground with the final plat, consistent with the City’s Public Ways and Property Ordinance. The developer shall provide a $5,000.00 security with the final plat to ensure the work is completed and certified in accordance with all applicable codes and regulations. 24. 200 TH STREET IMPROVEMENTS. The Developer shall install two (2) full access intersections along 200th Street with the development improvements. The Developer shall be responsible for construction of right turn and acceleration lanes as required by Dakota County at the proposed access locations. Building permits will not be permitted until the improvements are completed. 25. PARK, TRAILS, AND SIDEWALKS. The City’s Parks, Trails and Open Space Plan does not designate a park within Amelia Meadows. The Developer shall install five-foot wide concrete sidewalks, with pedestrian curb ramps along one side of all local streets except for the Gadston Lane Cul-de-Sac. The Developer shall install five-foot- concrete sidewalks, with pedestrian curb ramps along both sides of Gallifrey Way. The Developer shall install bituminous trails along the north side of 200th Street (10-feet wide) from the eastern plat boundary to the western plat boundary, the east side of Cedar Avenue (10-feet wide) from the southern plat boundary &RXQFLO1R,([KLELW(3DJHRI Page 244 of 445 236081v6 Amelia Meadows 12 to the northern plat boundary, and along the proposed drainageway (8-feet-wide from 200th Street to Gadfly Way. The Developer shall complete an ADA-compliant pedestrian crossing of 200th Street at the intersection of 200th Street and Cedar Avenue. The Developer will be responsible for 100% of the grading and restoration for the bituminous trails. The City shall provide a credit to the Developer in the amount of $49,275.00 to the final plat cash fees for the City’s 3/8th share (excluding grading and restoration) of the trail construction costs for the trails along 200th Street and Cedar Avenue. The Park Dedication requirement has not been collected on the parent parcels and will be satisfied through a cash contribution to be paid with the final plat, calculated as follows: 49 units x $5,832.00 = $285,768.00 Total Units (Low-Density) Amelia Meadows 2025 Unit Rate (Low-Density) Park Dedication Fee Amelia Meadows The Developer shall satisfy the park dedication requirement for Outlots A and B with subsequent phases of the Cedar Hills North (now known as Amelia Meadows) preliminary plat at the time they are final platted into lots and blocks through a cash contribution at the rate in effect at the time of final plat approval. 26. TRAFFIC CONTROL SIGNS AND STREET LIGHT OPERATION COSTS. The Developer shall pay a cash fee of $5,525.00 for traffic control signs with the final plat. If street signs are installed during frost conditions, the Developer shall pay an additional $150.00 for each traffic control sign location. If multiple mobilizations are needed, the Developer shall pay an additional $300.00 for each mobilization. The Developer shall pay a cash fee for one-year of streetlight operating expenses with the final plat, calculated as follows: 49 units x $40.48/unit = $1,983.52 Total Units Amelia Meadows 2025 Rate Streetlight Operating Fee Amelia Meadows 27. ENVIRONMENTAL RESOURCES EXPENSES. The Developer shall pay a cash fee for one-year of environmental resources management expenses with the final plat, calculated as follows: 49 units x $61.52/unit = $3,014.48 Total Units (Single Family) Amelia Meadows 2025 Rate Environmental Resources Fee Amelia Meadows 28. LANDSCAPING. Unless the single-family home lot already has two (2) trees on it, the Developer or lot purchaser shall plant sufficient trees so that there are at least two (2) trees on every lot in &RXQFLO1R,([KLELW(3DJHRI Page 245 of 445 236081v6 Amelia Meadows 13 the plat, one of which must be planted in the front yard. Trees that are chosen by the Developer or property owner cannot cause a public nuisance, such as cotton producing trees, or trees that may become a public hazard due to insect infestation or weak bark. The minimum deciduous tree size shall be two and one-half (2½) inches caliper, balled and burlapped. Evergreen trees must be at least eight feet (8’) tall. The trees may not be planted in the right-of-way. The Developer or lot purchaser shall sod the front yard, boulevard, and side yards to the rear of the structure on every lot. Weather permitting, the trees, sod, and seed shall be planted within sixty (60) days after a home has received a certificate of occupancy. Before a building permit is issued, a cash escrow of $1,000.00 per lot shall be furnished the City to guarantee compliance with the landscaping requirements. If the landscaping is not completed in a timely manner, the City may enter the lot, perform the work, and apply the cash escrow toward the cost. Upon satisfactory completion of the landscaping the escrow funds, without interest, less any draw made by the City, shall be returned to the person who deposited the funds with the City. All trees shall be warranted to be alive, of good quality, and disease free for twelve (12) months after planting. Any replacements shall be warranted for twelve (12) months from the time of planting. The Developer or property owner is responsible for contacting the City when all the landscaping has been installed to set up an inspection. Fifty percent (50%) of the security will be released when all the landscaping has been installed and inspected by City staff and the remaining fifty percent (50%) will be released one year after the landscaping inspection and any warranty work has been completed. Landscaping shall be installed in accordance with the approved landscape plan. The Developer shall post a $115,460.00 landscaping security at the time of final plat approval to ensure that the landscaping is installed in accordance with the approved plan. 29. BUFFER YARD BERM/LANDSCAPE SCREEN. 200th Street is a major collector roadway as identified in the City’s Transportation Plan. The Developer shall provide a buffer yard containing earth berms and/or plantings of a sufficient density to provide a visual screen and a reasonable buffer a minimum of ten feet in height adjacent to 200th Street consistent with the Zoning Ordinance. A certified as-built &RXQFLO1R,([KLELW(3DJHRI Page 246 of 445 236081v6 Amelia Meadows 14 grading plan of the buffer yard berm must be submitted and approved by City staff prior to the installation of any buffer yard plantings. The Developer shall submit a $1,000.00 cash escrow with the building permit applications for the following lots to guarantee installation of the buffer side/rear yard sod to the edge of the trail to be constructed on the north side of 200th Street. This escrow will be in addition to the two trees/lot and front yard sod escrow required at the time of building permit: x Lots 1-6, Block 1; x Lots 1-9, Block 3; and x Lot 7, Block 5. 30. WETLANDS. The wetland delineation for the site was approved on February 27, 2024. The wetland delineation was completed by MNR. The delineation identified two small wetlands on the site adjacent to the Vermillion River Watershed Water Quality Corridor. As part to of the development, the previously farmed and eroded channel will be realigned and restored. The development will be impacting 0.29 acres of wetland for a road crossing and restoring the channel. The Developer has purchased a total of 0.58 acres of banking credits to offset the impacts. The wetland replacement plan was approved on October 28, 2024. Based on the information provided in the report the impacts indicated for the areas outlined in the report have been determined to be acceptable for use in implementing the Wetland Conservation Act. All wetlands, channel and buffers will be placed in a city owned outlot that will be dedicated at final plat. The Developer is responsible for the establishment of the channel with native vegetation and will be required to manage the site for a minimum of five (5) years or until it is fully established. The Developer shall install “Natural Area” signs along the channel and buffer areas. Final locations (21) will be approved by the city prior to installation. &RXQFLO1R,([KLELW(3DJHRI Page 247 of 445 236081v6 Amelia Meadows 15 31. SPECIAL PROVISIONS. The following special provisions shall apply to plat development: A. Implementation of the recommendations listed in the April 29, 2025, Engineering Report and April 29, 2025, Planning Report. B. Before the City signs the final plat, the Developer shall convey Outlots C, D, and E to the City by warranty deed, free and clear of any and all encumbrances. C. The Developer shall construct a temporary Cul-de-Sac at the east end of Gadston Lane and enter into a temporary public roadway, drainage and utility easement with the City in a recordable form approved by the City for recording with the final plat. The Developer shall install a “Future Street Extension” sign and barricades at the east end of Gadston Lane. The Developer shall provide a $2,500.00 security for the future removal and restoration. D. Prior to City Council approval of the final plat, the Developer shall furnish a boundary survey of the proposed property to be platted with all property corner monumentation in place and marked with lath and a flag. Any encroachments on or adjacent to the property shall be noted on the survey. The Developer shall post a $5,400.00 security for the final placement of interior subdivision iron monuments at property corners. The security was calculated as follows: fifty- four (54) lots/outlots at $100.00 per lot/outlot. The security will be held by the City until the Developer's land surveyor certifies that all irons have been set following site grading and utility and street construction. In addition, the certificate of survey must also include a certification that all irons for a specific lot have either been found or set prior to the issuance of a building permit for that lot. E. The Developer shall pay a cash fee for the preparation of addressing, property data, and City base map updating. This fee is $90.00 per lot/outlot for a total charge of $4,860.00. F. The Developer shall be responsible for the cost of street light installation consistent with a street lighting plan approved by the City. Before the City signs the final plat, the Developer shall post a security for street light installation consistent with the approved plan. The estimated amount of &RXQFLO1R,([KLELW(3DJHRI Page 248 of 445 236081v6 Amelia Meadows 16 this security is $13,600.00 and consists of nine (9) post-top streetlights at $1,200.00, and two (2) mast arm lights at $1,400.00 each. G. The Developer is required to submit the final plat in electronic format. The electronic format shall be either AutoCAD.DWG file or a .DXF file. All construction record drawings (e.g., grading, utilities, streets) shall be in electronic format in accordance with standard City specifications. H. The following lots are prohibited from having driveway access to Gallifrey Way: x Lots 1 and 14, Block 1; x Lot 1, Block 2; and x Lot 1, Block 3. 32. SUMMARY OF SECURITY REQUIREMENTS. To guarantee compliance with the terms of this Contract, payment of real estate taxes including interest and penalties, payment of special assessments, payment of the costs of all public improvements, and construction of all public improvements, the Developer shall furnish the City with a cash escrow, or letter of credit, in the form attached hereto, from a bank ("security") for $5,070,814.29. The amount of the security was calculated as follows: CONSTRUCTION COSTS: A. Sanitary Sewer $755,225.71 B. Watermain 523,918.10 C. Storm Sewer/Draintile 969,575.20 D. Streets 1,045,039.50 E. Grading, Drainage, Erosion Control and Restoration 725,812.50 F. Vegetation Establishment 150,000.00 G. 200 th Street Turn Lanes 248,101.00 CONSTRUCTION SUB-TOTAL $4,417,672.01 OTHER COSTS: A. Developer’s Design (3.0%) $132,530.16 B. Developer’s Construction Survey (2.5%) 110,411.80 C. City Legal Expenses (Est. 0.5%) 22,088.36 D. City Construction Observation (Est. 5.0%) 220,883.60 E. City Record Drawings (0.5%) 22,088.36 &RXQFLO1R,([KLELW(3DJHRI Page 249 of 445 236081v6 Amelia Meadows 17 F. Natural Area Signs 3,150.00 G. Gadston Lane Temporary Cul-de-Sac Removal 2,500.00 H. Undergrounding 5,000.00 I. Landscaping 115,460.00 J. Streetlights 13,600.00 K. Lot Corners/Iron Monuments 5,400.00 OTHER COSTS SUB-TOTAL $653,142.28 TOTAL SECURITIES:$5,070,814.29 This breakdown is for historical reference; it is not a restriction on the use of the security. The bank shall be subject to the approval of the City Administrator. The City may draw down the security, on five (5) business days written notice to the Developer, for any violation of the terms of this Contract or without notice if the security is allowed to lapse prior to the end of the required term. If the required public improvements are not completed at least thirty (30) days prior to the expiration of the security, the City may also draw it down without notice. If the security is drawn down, the proceeds shall be used to cure the default. Upon receipt of proof satisfactory to the City that work has been completed and financial obligations to the City have been satisfied, with City approval the security may be reduced from time to time by ninety percent (90%) of the financial obligations that have been satisfied. Ten percent (10%) of the amounts certified by the Developer's engineer shall be retained as security until all improvements have been completed, all financial obligations to the City satisfied, the required "as constructed" plans have been received by the City, a warranty security is provided, and the public improvements are accepted by the City Council. The City’s standard specifications for utility and street construction outline procedures for security reductions. 33. SUMMARY OF CASH REQUIREMENTS. The following is a summary of the cash requirements under this Contract which must be furnished to the City prior to the City Council signing the final plat: A. Park Dedication $285,768.00 B. Sanitary Sewer Availability Charge 16,023.00 C. Storm Sewer Charge 137,027.07 D. MS4 Administration Fee 39,989.66 &RXQFLO1R,([KLELW(3DJHRI Page 250 of 445 236081v6 Amelia Meadows 18 E. Traffic Control Signs 5,525.00 F. Streetlight Operating Fee 1,983.52 G. Environmental Resources Management Fee 3,014.48 H. Property Data and Asset/Infrastructure Management Fee 4,860.00 I. City Engineering Administration (3% for letters of credit) 132,530.16 SUBTOTAL CASH REQUIREMENTS $626,720.89 CREDITS TO THE CASH REQUIREMENTS Trunk Watermain Oversizing Credit $39,535.00 Trunk Sanitary Sewer Oversizing Credit 329,430.60 City 3/8 Trail Cost – 200th Street and Cedar Avenue $30,331.50 SUBTOTAL – CREDITS TO THE CASH REQUIREMENTS $399,297.10 TOTAL CASH REQUIREMENTS $227,423.79 34. WARRANTY. The Developer warrants all improvements required to be constructed by it pursuant to this Contract against poor material and faulty workmanship. The warranty period for streets is one year. The warranty period for underground utilities is two years and shall commence following completion and acceptance by the City. The one year warranty period on streets shall commence after the final wear course has been installed and accepted by the City. The Developer shall post maintenance bonds in the amount of twenty-five percent (25%) of final certified construction costs to secure the warranties. The City shall retain ten percent (10%) of the security posted by the Developer until the maintenance bonds are furnished to the City or until the warranty period expires, whichever first occurs. The retainage may be used to pay for warranty work. The City’s standard specifications for utility and street construction identify the procedures for final acceptance of streets and utilities. 35. RESPONSIBILITY FOR COSTS. A. Except as otherwise specified herein, the Developer shall pay all costs incurred by it or the City in conjunction with the development of the plat, including but not limited to Soil and Water Conservation District charges, legal, planning, engineering and construction observation inspection expenses incurred in connection with approval and acceptance of the plat, the &RXQFLO1R,([KLELW(3DJHRI Page 251 of 445 236081v6 Amelia Meadows 19 preparation of this Contract, review of construction plans and documents, and all costs and expenses incurred by the City in monitoring and inspecting development of the plat. B. The Developer shall hold the City and its officers, employees, and agents harmless from claims made by itself and third parties for damages sustained or costs incurred resulting from plat approval and development. The Developer shall indemnify the City and its officers, employees, and agents for all costs, damages, or expenses which the City may pay or incur in consequence of such claims, including attorneys' fees. C. The Developer shall reimburse the City for costs incurred in the enforcement of this Contract, including engineering and attorneys' fees. D. The Developer shall pay, or cause to be paid when due, and in any event before any penalty is attached, all special assessments referred to in this Contract. This is a personal obligation of the Developer and shall continue in full force and effect even if the Developer sells one or more lots, the entire plat, or any part of it. E. The Developer shall pay in full all bills submitted to it by the City for obligations incurred under this Contract within thirty (30) days after receipt. If the bills are not paid on time, the City may halt plat development and construction until the bills are paid in full. Bills not paid within thirty (30) days shall accrue interest at the rate of eighteen percent (18%) per year. Additionally, the Developer shall pay in full all bills submitted to it by the City prior to any reductions in the security for the development. F. In addition to the charges and special assessments referred to herein, other charges and special assessments may be imposed such as but not limited to City or MCES sewer availability charges ("SAC"), City water connection charges, City sewer connection charges, and building permit fees. 36. DEVELOPER’S DEFAULT. In the event of default by the Developer as to any of the work to be performed by it hereunder, the City may, at its option, perform the work and the Developer shall promptly reimburse the City for any expense incurred by the City, provided the Developer, except in an emergency as determined by the City, is first given notice of the work in default, not less than forty-eight (48) hours in &RXQFLO1R,([KLELW(3DJHRI Page 252 of 445 236081v6 Amelia Meadows 20 advance. This Contract is a license for the City to act, and it shall not be necessary for the City to seek a Court order for permission to enter the land. When the City does any such work, the City may, in addition to its other remedies, assess the cost in whole or in part. 37. FORCE MAJEURE. If Developer is delayed at any time in progress of the plat by acts of God, casualty, insurrection, strikes, war, terrorism, lockouts, pandemic, governmental order (including health orders), labor disputes, adverse weather conditions which could not reasonably be anticipated, or any causes, acts, or occurrences beyond Developer’s control (financial inability excluded) (collectively, “Force Majeure Items”), then the commencement date and completion dates (without adjustment to the Development Contract sums) shall be extended for such reasonable time as the Force Majeure Items continue. 38. MISCELLANEOUS. A. The Developer represents to the City that the plat complies with all city, county, metropolitan, state, and federal laws and regulations, including but not limited to: subdivision ordinances, zoning ordinances, and environmental regulations. If the City determines that the plat does not comply, the City may, at its option, refuse to allow construction or development work in the plat until the Developer does comply. Upon the City's demand, the Developer shall cease work until there is compliance. B. Third parties shall have no recourse against the City under this Contract. C. Breach of the terms of this Contract by the Developer shall be grounds for denial of building permits, including lots sold to third parties. D. If any portion, section, subsection, sentence, clause, paragraph, or phrase of this Contract is for any reason held invalid, such decision shall not affect the validity of the remaining portion of this Contract. E. Grading, curbing, and one lift of asphalt shall be installed on all public and private streets prior to issuance of any building permits, except three (3) model homes on lots acceptable to the Building &RXQFLO1R,([KLELW(3DJHRI Page 253 of 445 236081v6 Amelia Meadows 21 Official. Approval of an administrative permit in compliance with Chapter 27 of the City’s zoning ordinance is required prior to the construction of any model homes. F. If building permits are issued prior to the acceptance of public improvements, the Developer assumes all liability and costs resulting in delays in completion of public improvements and damage to public improvements caused by the City, Developer, its contractors, subcontractors, material men, employees, agents, or third parties. No sewer and water connections or inspections may be conducted and no one may occupy a building for which a building permit is issued on either a temporary or permanent basis until the streets needed for access have been paved with a bituminous surface and the utilities are accepted by the City Engineer. G. The action or inaction of the City shall not constitute a waiver or amendment to the provisions of this Contract. To be binding, amendments or waivers shall be in writing, signed by the parties and approved by written resolution of the City Council. The City's failure to promptly take legal action to enforce this Contract shall not be a waiver or release. H. This Contract shall run with the land and may be recorded against the title to the property. In the event this Contract is recorded, upon request by Developer, the City covenants to provide a recordable Certificate of Completion within a reasonable period of time following the request, upon the completion of the work and responsibilities required herein, payment of all costs and fees required and compliance with all terms of the Contract. A release of this Contract may be provided in the same manner and subject to the same conditions as a Certificate of Completion provided there are no outstanding or ongoing obligations of Developer under the terms of this Contract. The Developer covenants with the City, its successors and assigns, that the Developer is well seized in fee title of the property being final platted and/or has obtained consents to this Contract, in the form attached hereto, from all parties who have an interest in the property; that there are no unrecorded interests in the property being final platted; and that the Developer will indemnify and hold the City harmless for any breach of the foregoing covenants. &RXQFLO1R,([KLELW(3DJHRI Page 254 of 445 236081v6 Amelia Meadows 22 I. Insurance. Developer and Contractor shall provide a copy of the Development Contract to their insurance professional for verification that the certificate of insurance is in compliance with the requirements of the Development Contract. Prior to execution of the final plat, Developer and its general contractor shall furnish to the City a certificate of insurance showing proof of the required insurance required under this Paragraph. Developer and its general contractor shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, such insurance as shall protect Developer and its general contractor and the City for work covered by the Contract including workers’ compensation claims and property damage, bodily and personal injury which may arise from operations under this Contract, whether such operations are by Developer and its general contractor or anyone directly or indirectly employed by either of them. The minimum amounts of insurance shall be as follows: Commercial General Liability (or in combination with an umbrella policy) $2,000,000 Each Occurrence $2,000,000 Products/Completed Operations Aggregate $2,000,000 Annual Aggregate The following coverages shall be included: Premises and Operations Bodily Injury and Property Damage Personal and Advertising Injury Blanket Contractual Liability Products and Completed Operations Liability Automobile Liability $2,000,000 Combined Single Limit – Bodily Injury & Property Damage Including Owned, Hired & Non-Owned Automobiles Workers Compensation Workers’ Compensation insurance in accordance with the statutory requirements of the State of Minnesota, including Employer’s Liability with minimum limits are as follows: x $500,000 – Bodily Injury by Disease per employee x $500,000 – Bodily Injury by Disease aggregate x $500,000 – Bodily Injury by Accident The Developer’s and general contractor’s insurance must be “Primary and Non-Contributory”. &RXQFLO1R,([KLELW(3DJHRI Page 255 of 445 236081v6 Amelia Meadows 23 All insurance policies (or riders) required by this Contract shall be (i) taken out by and maintained with responsible insurance companies organized under the laws of one of the states of the United States and qualified to do business in the State of Minnesota, (ii) shall name the City, its employees and agents as additional insureds (CGL and umbrella only) by endorsement which shall be filed with the City and (iii) shall identify the name of the plat. A copy of the endorsement must be submitted with the certificate of insurance. Developer’s and general contractor’s policies and Certificate of Insurance shall contain a provision that coverage afforded under the policies shall not be cancelled without at least thirty (30) days’ advanced written notice to the City, or ten (10) days’ notice for non-payment of premium. An Umbrella or Excess Liability insurance policy may be used to supplement Developer’s or general contractor’s policy limits on a follow-form basis to satisfy the full policy limits required by this Contract. J. Indemnification. To the fullest extent permitted by law, Developer agrees to defend, indemnify and hold harmless the City, and its employees, officials, and agents from and against all claims, actions, damages, losses and expenses, including reasonable attorney fees, arising out of Developer’s negligence or its performance or failure to perform its obligations under this Contract. Developer’s indemnification obligation shall apply to Developer’s general contractor, subcontractor(s), or anyone directly or indirectly employed or hired by Developer, or anyone for whose acts Developer may be liable. Developer agrees this indemnity obligation shall survive the completion or termination of this Contract. K. Each right, power or remedy herein conferred upon the City is cumulative and in addition to every other right, power or remedy, express or implied, now or hereafter arising, available to City, at law or in equity, or under any other agreement, and each and every right, power and remedy herein set forth or otherwise so existing may be exercised from time to time as often and in such order &RXQFLO1R,([KLELW(3DJHRI Page 256 of 445 236081v6 Amelia Meadows 24 as may be deemed expedient by the City and shall not be a waiver of the right to exercise at any time thereafter any other right, power or remedy. L. The Developer may not assign this Contract without the written permission of the City Council. The Developer's obligation hereunder shall continue in full force and effect even if the Developer sells one or more lots, the entire plat, or any part of it, until the City’s issuance of a Certificate of Completion and Release. M. Retaining walls that require a building permit shall be constructed in accordance with plans and specifications prepared by a structural or geotechnical engineer licensed by the State of Minnesota. Following construction, a certification signed by the design engineer shall be filed with the Building Official evidencing that the retaining wall was constructed in accordance with the approved plans and specifications. All retaining walls identified on the development plans and by special conditions referred to in this Contract shall be constructed before any other building permit is issued for a lot on which a retaining wall is required to be built. N. Should the Developer convey any lot or lots in the Development to a third party, the City and the owner of that lot or those lots may amend this Development Contract or other city approvals or agreements for development or use of those lots without the approval or consent of the Developer or other lot owners in the Development. Private agreements between the owners of lots within the Development for shared service or access and related matters necessary for the efficient use of the Development shall be the responsibility of the lot owners and shall not bind or restrict City authority to approve applications from any lot owner in the Development. 39. NOTICES. Required notices to the Developer shall be in writing, and shall be either hand delivered to the Developer, its employees or agents, or mailed to the Developer by certified mail at the following address: 2780 Snelling Avenue N Suite 101 Roseville, MN 55113. Notices to the City shall be in writing and shall be either hand delivered to the City Administrator, or mailed to the City by certified mail in care of the City Administrator at the following address: Lakeville City Hall, 20195 Holyoke Avenue, Lakeville, Minnesota 55044. &RXQFLO1R,([KLELW(3DJHRI Page 257 of 445 $PVODJM/P* &YIJCJU& 1BHFPG Page 258 of 445 $PVODJM/P* &YIJCJU& 1BHFPG Page 259 of 445 $PVODJM/P* &YIJCJU& 1BHFPG Page 260 of 445 236081v6 Amelia Meadows 28 EXHIBIT “A” TO DEVELOPMENT CONTRACT Legal Description of Property Being Final Platted as AMELIA MEADOWS That part of the Southwest Quarter of Section 22, Township 114 North, Range 20 West, Dakota County, Minnesota described as follows: The South 225.0 feet of said Southwest Quarter, except the East 1320.0 feet, and except the West 547.83 feet thereof. And The West 678.00 feet of the South 300.00 feet of the North 2,055.00 feet of the Southwest Quarter of Section 22, Township 114 North, Range 20 West, Dakota County, Minnesota. And The South half of the Southwest Quarter of Section 22, Township 114 North, Range 20 West, Dakota County, Minnesota. EXCEPT The West 261.37 feet of the East 522.74 feet of the South 533.00 feet thereof. ALSO EXCEPT The South 225.00 feet of said Southwest Quarter lying West of the East 1320.00 feet and East of the West 547.83 feet thereof. ALSO EXCEPT The West 678.00 feet of the South 300 feet of the North 2055.00 feet of said Southwest Quarter. (Abstract Property) [Platted as Amelia Meadows, Dakota County, Minnesota.] &RXQFLO1R,([KLELW(3DJHRI Page 261 of 445 Date: 3/16/2026 Resolution Authorizing Issuance and Sale of General Obligation Bonds, Series 2026A Proposed Action Staff recommends adoption of the following motion: Move to approve Resolution Authorizing the Issuance and Sale of General Obligation Bonds, Series 2026A Overview Recommendations and financial impacts for 2026A bonds were discussed at the March 2, 2026 Council meeting. The estimated true interest cost (TIC) is 3.67% as shown in the March 2nd Finance Plan from Northland. Passage of this motion will result in the financing of the following projects: • #26-02 – 2026 Street Reconstruction Project • #26-03 – 2026 Collector Rehabilitation • #26-09 – 215th St Public Improvements (CSAH 5-CSAH 70) • #25-11 - Capital Improvement Project (CIP) – Fire Station #2 The debt will be repaid with property taxes and franchise fees. The 2026A bond issuance is estimated to be $39,505,000. It reflects the following: • The term of the bonds is 20 years: 1. $4,945,000 - Street reconstruction portion = 10 years 2. $5,300,000 – Utility portion = 10 years 3. $29,260,000 – CIP portion = 20 years • The structure of the 2026A bonds is compliant with the City’s Debt Policy such that the total maturity length is equal to or less than 20 years and at least 50% of the principal will be retired within 10 years. • Call Provision - Bonds maturing on or after 2/1/2035 may be prepaid at a price of par plus accrued interest on or after 2/1/2034. Supporting Information 1. 2026A Set Sale Resolution 2. Finance Plan 2026A Page 262 of 445 Financial Impact: $39,505,000 Budgeted: Yes Source: Taxes and franchise fees Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Julie Stahl, Finance Director Page 263 of 445 4907-2850-2670\3 CITY OF LAKEVILLE RESOLUTION Date: March 16, 2026 Resolution No. _______________________ RESOLUTION AUTHORIZING ISSUANCE AND SALE OF GENERAL OBLIGATION BONDS, SERIES 2026A BE IT RESOLVED by the City Council of the City of Lakeville, Minnesota (the “City”), as follows: SECTION 1. PURPOSE. It is hereby determined to be in the best interests of the City to issue its General Obligation Bonds, Series 2026A, in the principal amount of approximately $39,505,000 (the “Bonds”), pursuant to Minnesota Statutes, Sections 444.075; 475.58, Subdivision 3(b); 475.521 and Chapter 475, to: (a) finance the City’s 2026 Street Reconstruction and Collector Rehab projects; (b) finance various capital improvements, as described in the City’s five-year capital improvement plan, including land purchase and construction of a fire station; (c) finance the City’s 2026 utility improvements; and (d) pay costs associated with the issuance of the Bonds. SECTION 2. TERMS OF PROPOSAL. Northland Securities, Inc., municipal advisor to the City, has presented to this Council a form of Terms of Proposal for the Bonds which is attached hereto and hereby approved and shall be placed on file by the Administrator. Each and all of the provisions of the Terms of Proposal attached hereto are hereby adopted as the terms and conditions of the Bonds and of the sale thereof. Northland Securities, Inc. is hereby authorized, pursuant to Minnesota Statutes, Section 475.60, Subdivision 2, paragraph (9), to solicit proposals for the Bonds on behalf of the City on a competitive basis without requirement of published notice. SECTION 3. SALE MEETING. This Council shall meet at the time and place shown in the Terms of Proposal for the purpose of considering sealed bids for the purchase of the Bonds and of taking such action thereon as may be in the best interests of the City. Adopted this 16th day of March, 2026. CITY OF LAKEVILLE By: Luke M. Hellier, Mayor ATTEST: Ann Orlofsky, City Clerk VOTE Hellier Bermel Lee Volk Wolter Aye ☐ ☐ ☐ ☐ ☐ Nay ☐ ☐ ☐ ☐ ☐ Abstain ☐ ☐ ☐ ☐ ☐ Absent ☐ ☐ ☐ ☐ ☐ Page 264 of 445 4907-2850-2670\3 TERMS OF PROPOSAL $39,505,000* GENERAL OBLIGATION BONDS, SERIES 2026A CITY OF LAKEVILLE, MINNESOTA (Book-Entry Only) NOTICE IS HEREBY GIVEN that these Bonds will be offered for sale according to the following terms: TIME AND PLACE: Proposals (also referred to herein as “bids”) will be opened by the City’s Finance Director, or designee, on Monday, April 20, 2026, at 10:00 A.M., CT, at the offices of Northland Securities, Inc. (the Issuer’s “Municipal Advisor”), 150 South 5th Street, Suite 3300, Minneapolis, Minnesota 55402. Consideration of the Proposals for award of the sale will be by the City Council at its meeting at the City Offices beginning Monday, April 20, 2026 at 6:00 P.M., CT. SUBMISSION OF PROPOSALS Proposals may be: a) submitted to the office of Northland Securities, Inc., b) emailed to PublicSale@northlandsecurities.com, or c) submitted electronically. Notice is hereby given that electronic proposals will be received via PARITY™, or its successor, in the manner described below, until 10:00 A.M., CT, on April 20, 2026. Proposals may be submitted electronically via PARITY™ or its successor, pursuant to this Notice until 10:00 A.M., CT, but no Proposal will be received after the time for receiving Proposals specified above. To the extent any instructions or directions set forth in PARITY™, or its successor, conflict with this Notice, the terms of this Notice shall control. For further information about PARITY™, or its successor, potential bidders may contact Northland Securities, Inc. or i-Deal at 1359 Broadway, 2nd floor, New York, NY 10018, telephone 212-849-5021. Neither the Issuer nor Northland Securities, Inc. assumes any liability if there is a malfunction of PARITY™ or its successor. All bidders are advised that each Proposal shall be deemed to constitute a contract between the bidder and the Issuer to purchase the Bonds regardless of the manner in which the Proposal is submitted. BOOK-ENTRY SYSTEM The Bonds will be issued by means of a book-entry system with no physical distribution of bond certificates made to the public. The Bonds will be issued in fully registered form and one bond certificate, representing the aggregate principal amount of the Bonds maturing in each year, will be registered in the name of Cede & Co. as nominee of Depository Trust Company (“DTC”), New York, New York, which will act as securities depository of the Bonds. Individual purchases of the Bonds may be made in the principal amount of $5,000 or any multiple thereof of a single maturity through book entries made on the books and records of DTC and its participants. Principal and interest are payable by the Issuer through U.S. Bank Trust Company, National Association, St. Paul, Minnesota (the “Paying Agent/Registrar”), to DTC, or its nominee as registered owner of the Bonds. Transfer of principal and interest payments to participants of DTC will be the responsibility of DTC; transfer of principal and interest payments to beneficial owners by participants will be the responsibility of such participants and other nominees of beneficial owners. The successful bidder, as a condition of delivery of the Bonds, will be required to deposit the * The Issuer reserves the right to increase or decrease the principal amount of the Bonds. Any such increase or decrease will be made in multiples of $5,000 and may be made in any maturity. If any maturity is adjusted, the purchase price will also be adjusted to maintain the same gross spread. Page 265 of 445 4907-2850-2670\3 bond certificates with DTC. The Issuer will pay reasonable and customary charges for the services of the Paying Agent/Registrar. DATE OF ORIGINAL ISSUE OF BONDS Date of Delivery (Estimated to be May 14, 2026) AUTHORITY/PURPOSE/SECURITY The Bonds are being issued pursuant to Minnesota Statutes, Chapters 475 and 444 and Sections 475.58, Subdivision 3b and 475.521, as amended. Proceeds will be used to finance a land purchase and construction of a fire hall, the City’s 2026 street reconstruction and collector rehab projects and utility projects, and to pay costs associated with the issuance of the Bonds. The Bonds are payable from net water and sewer utility revenues and ad valorem taxes on all taxable property within the City. The full faith and credit of the Issuer is pledged to their payment and the Issuer has validly obligated itself to levy ad valorem taxes in the event of any deficiency in the debt service account established for this issue. INTEREST PAYMENTS Interest is due semiannually on each February 1 and August 1, commencing February 1, 2027, to registered owners of the Bonds appearing of record in the Bond Register as of the close of business on the fifteenth day (whether or not a business day) of the calendar month next preceding such interest payment date. MATURITIES Principal is due annually on February 1, inclusive, in each of the years and amounts as follows: Year Amount Year Amount Year Amount 2027 $510,000 2034 $2,340,000 2041 $1,590,000 2028 2,010,000 2035 2,405,000 2042 1,650,000 2029 2,055,000 2036 2,470,000 2043 1,715,000 2030 2,110,000 2037 1,945,000 2044 1,785,000 2031 2,165,000 2038 1,430,000 2045 1,860,000 2032 2,220,000 2039 1,480,000 2046 1,935,000 2033 2,280,000 2040 1,530,000 2047 2,020,000 Proposals for the Bonds may contain a maturity schedule providing for any combination of serial bonds and term bonds, subject to mandatory redemption, so long as the amount of principal maturing or subject to mandatory redemption in each year conforms to the maturity schedule set forth above. INTEREST RATES All rates must be in integral multiples of 1/20th or 1/8th of 1%. The rate for any maturity may not be more than 2.00% less than the rate for any preceding maturity. All Bonds of the same maturity must bear a single uniform rate from date of issue to maturity. ESTABLISHMENT OF ISSUE PRICE (HOLD-THE-OFFERING-PRICE RULE MAY APPLY – BIDS NOT CANCELLABLE) In order to establish the issue price of the Bonds for federal income tax purposes, the Issuer requires bidders to agree to the following, and by submitting a bid, each bidder agrees to the following. If a bid is submitted by a potential underwriter, the bidder confirms that (i) the underwriters have offered or reasonably expect to offer the Bonds to the public on or before the date of the award at the offering price (the “initial Page 266 of 445 4907-2850-2670\3 offering price”) for each maturity as set forth in the bid and (ii) the bidder, if it is the winning bidder, shall require any agreement among underwriters, selling group agreement, retail distribution agreement or other agreement relating to the initial sale of the Bonds to the public to which it is a party to include provisions requiring compliance by all parties to such agreements with the provisions contained herein. For purposes hereof, Bonds with a separate CUSIP number constitute a separate “maturity,” and the public does not include underwriters of the Bonds (including members of a selling group or retail distribution group) or persons related to underwriters of the Bonds. If, however, a bid is submitted for the bidder’s own account in a capacity other than as an underwriter of the Bonds, and the bidder has no current intention to sell, reoffer, or otherwise dispose of the Bonds, the bidder shall notify the Issuer to that effect at the time it submits its bid and shall provide a certificate to that effect in place of the certificate otherwise required below. If the winning bidder intends to act as an underwriter, the Issuer shall advise the winning bidder at or prior to the time of award whether (i) the competitive sale rule or (ii) the “hold-the-offering price” rule applies, as described in the following paragraph. If the Issuer advises the winning bidder that the requirements for a competitive sale have not been satisfied and that the hold-the-offering price rule applies, the winning bidder shall (1) upon the request of the Issuer confirm that the underwriters did not offer or sell any maturity of the Bonds to any person at a price higher than the initial offering price of that maturity during the period starting on the award date and ending on the earlier of (a) the close of the fifth business day after the sale date or (b) the date on which the underwriters have sold at least 10% of that maturity to the public at or below the initial offering price; and (2) at or prior to closing, deliver to the Issuer a certification substantially in the form attached hereto as Exhibit A, together with a copy of the pricing wire. If the Issuer advises the winning bidder that the requirements for a competitive sale have been satisfied and that the competitive sale rule applies, the winning bidder will be required to deliver to the Issuer at or prior to closing a certification, substantially in the form attached hereto as Exhibit B, as to the reasonably expected initial offering price as of the award date. Any action to be taken or documentation to be received by the Issuer pursuant hereto may be taken or received on behalf of the Issuer by the Municipal Advisor. Bidders should prepare their bids on the assumption that the Bonds will be subject to the “hold-the-offering- price” rule. Any bid submitted pursuant to the Notice of Sale shall be considered a firm offer for the purchase of the Bonds, and bids submitted will not be subject to cancellation or withdrawal. ADJUSTMENTS TO PRINCIPAL AMOUNT AFTER PROPOSALS The Issuer reserves the right to increase or decrease the principal amount of the Bonds. Any such increase or decrease will be made in multiples of $5,000 and may be made in any maturity. If any maturity is adjusted, the purchase price will also be adjusted to maintain the same gross spread. Such adjustments shall be made promptly after the sale and prior to the award of Proposals by the Issuer and shall be at the sole discretion of the Issuer. The successful bidder may not withdraw or modify its Proposal once submitted to the Issuer for any reason, including post-sale adjustment. Any adjustment shall be conclusive and shall be binding upon the successful bidder. OPTIONAL REDEMPTION Bonds maturing on and after February 1, 2035 are subject to redemption and prepayment at the option of the Issuer on February 1, 2034 and any date thereafter, at a price of par plus accrued interest. Redemption may be in whole or in part of the Bonds subject to prepayment. If redemption is in part, the maturities and principal amounts within each maturity to be redeemed shall be determined by the Issuer and if only part of the Bonds having a common maturity date are called for prepayment, the specific Bonds to be prepaid shall be chosen by lot by the Bond Registrar. CUSIP NUMBERS Page 267 of 445 4907-2850-2670\3 If the Bonds qualify for assignment of CUSIP numbers such numbers will be printed on the Bonds, but neither the failure to print such numbers on any Bond nor any error with respect thereto shall constitute cause for a failure or refusal by the successful bidder thereof to accept delivery of and pay for the Bonds in accordance with terms of the purchase contract. The CUSIP Service Bureau charge for the assignment of CUSIP identification numbers shall be paid by the successful bidder. DELIVERY Delivery of the Bonds will be within thirty days after award, subject to an approving legal opinion by Dorsey & Whitney LLP, Bond Counsel. The legal opinion will be paid by the Issuer and delivery will be anywhere in the continental United States without cost to the successful bidder at DTC. TYPE OF PROPOSAL Proposals of not less than $39,228,465 (99.30%) and accrued interest on the principal sum of $39,505,000 must be filed with the undersigned prior to the time of sale. Proposals must be unconditional except as to legality. Proposals for the Bonds should be delivered to Northland Securities, Inc. and addressed to: Julie Stahl, Finance Director Lakeville City Hall 20195 Holyoke Ave. Lakeville, MN 55044 A good faith deposit (the “Deposit”) in the amount of $500,000 in the form of a federal wire transfer (payable to the order of the Issuer) is only required from the apparent winning bidder, and must be received within two hours after the time stated for the receipt of Proposals. The apparent winning bidder will receive notification of the wire instructions from the Municipal Advisor promptly after the sale. If the Deposit is not received from the apparent winning bidder in the time allotted, the Issuer may choose to reject their Proposal and then proceed to offer the Bonds to the next lowest bidder based on the terms of their original proposal, so long as said bidder wires funds for the Deposit amount within two hours of said offer. The Issuer will retain the Deposit of the successful bidder, the amount of which will be deducted at settlement and no interest will accrue to the successful bidder. In the event the successful bidder fails to comply with the accepted Proposal, said amount will be retained by the Issuer. No Proposal can be withdrawn after the time set for receiving Proposals unless the meeting of the Issuer scheduled for award of the Bonds is adjourned, recessed, or continued to another date without award of the Bonds having been made. AWARD The Bonds will be awarded on the basis of the lowest interest rate to be determined on a true interest cost (TIC) basis. The Issuer’s computation of the interest rate of each Proposal, in accordance with customary practice, will be controlling. In the event of a tie, the sale of the Bonds will be awarded by lot. The Issuer will reserve the right to: (i) waive non-substantive informalities of any Proposal or of matters relating to the receipt of Proposals and award of the Bonds, (ii) reject all Proposals without cause, and (iii) reject any Proposal which the Issuer determines to have failed to comply with the terms herein. INFORMATION FROM SUCCESSFUL BIDDER The successful bidder will be required to provide, in a timely manner, certain information relating to the initial offering price of the Bonds necessary to compute the yield on the Bonds pursuant to the provisions of the Internal Revenue Code of 1986, as amended. OFFICIAL STATEMENT Page 268 of 445 4907-2850-2670\3 By awarding the Bonds to any underwriter or underwriting syndicate submitting a Proposal therefor, the Issuer agrees that, no more than seven business days after the date of such award, it shall provide to the senior managing underwriter of the syndicate to which the Bonds are awarded, the Final Official Statement in an electronic format as prescribed by the Municipal Securities Rulemaking Board (MSRB). FULL CONTINUING DISCLOSURE UNDERTAKING The Issuer will covenant in the resolution awarding the sale of the Bonds and in a Continuing Disclosure Undertaking to provide, or cause to be provided, annual financial information, including audited financial statements of the Issuer, and notices of certain material events, as required by SEC Rule 15c2-12. NOT BANK QUALIFIED The Issuer will not designate the Bonds as qualified tax-exempt obligations for purposes of Section 265(b)(3) of the Internal Revenue Code of 1986, as amended. BOND INSURANCE AT UNDERWRITER’S OPTION If the Bonds qualify for issuance of any policy of municipal bond insurance or commitment therefor at the option of the successful bidder, the purchase of any such insurance policy or the issuance of any such commitment shall be at the sole option and expense of the successful bidder of the Bonds. Any increase in the costs of issuance of the Bonds resulting from such purchase of insurance shall be paid by the successful bidder, except that, if the Issuer has requested and received a rating on the Bonds from a rating agency, the Issuer will pay that rating fee. Any other rating agency fees shall be the responsibility of the successful bidder. Failure of the municipal bond insurer to issue the policy after the Bonds have been awarded to the successful bidder shall not constitute cause for failure or refusal by the successful bidder to accept delivery on the Bonds. The Issuer reserves the right to reject any and all Proposals, to waive informalities and to adjourn the sale. Dated: March 16, 2026 BY ORDER OF THE LAKEVILLE CITY COUNCIL /s/ Julie Stahl Finance Director Additional information may be obtained from: Northland Securities, Inc. 150 South 5th Street, Suite 3300 Minneapolis, Minnesota 55402 Telephone No.: 612-851-5900 Page 269 of 445 4907-2850-2670\3 EXHIBIT A ISSUE PRICE CERTIFICATE – COMPETITIVE SALES WITH AT LEAST THREE BIDS FROM ESTABLISHED UNDERWRITERS $[PRINCIPAL AMOUNT] [BOND CAPTION] ISSUE PRICE CERTIFICATE The undersigned, on behalf of [NAME OF UNDERWRITER] (“[SHORT NAME OF UNDERWRITER]”), hereby certifies as set forth below with respect to the sale of the obligations named above (the “Bonds”). 1. Reasonably Expected Initial Offering Price. (a) As of the Sale Date, the reasonably expected initial offering prices of the Bonds to the Public by [SHORT NAME OF UNDERWRITER] are the prices listed in Schedule A (the “Expected Offering Prices”). The Expected Offering Prices are the prices for the Maturities of the Bonds used by [SHORT NAME OF UNDERWRITER] in formulating its bid to purchase the Bonds. Attached as Schedule B is a true and correct copy of the bid provided by [SHORT NAME OF UNDERWRITER] to purchase the Bonds. (b) [SHORT NAME OF UNDERWRITER] was not given the opportunity to review other bids prior to submitting its bid. (c) The bid submitted by [SHORT NAME OF UNDERWRITER] constituted a firm offer to purchase the Bonds. 2. Defined Terms. For purposes of this Issue Price Certificate: (a) Issuer means [DESCRIBE ISSUER]. (b) Maturity means Bonds with the same credit and payment terms. Any Bonds with different maturity dates, or with the same maturity date but different stated interest rates, are treated as separate Maturities. (c) Member of the Distribution Group means (i) any person that agrees pursuant to a written contract with the Issuer (or with the lead underwriter to form an underwriting syndicate) to participate in the initial sale of the Bonds to the Public, and (ii) any person that agrees pursuant to a written contract directly or indirectly with a person described in clause (i) of this paragraph to participate in the initial sale of the Bonds to the Public (including a member of a selling group or a party to a retail distribution agreement participating in the initial sale of the Bonds to the Public). (d) Public means any person (i.e., an individual, trust, estate, partnership, association, company, or corporation) other than a Member of the Distribution Group or a related party to a Member of the Distribution Group. A person is a “related party” to a Member of the Distribution Group if the Member of the Distribution Group and that person are subject, directly or indirectly, to (i) at least 50% common ownership of the voting power or the total value of their stock, if both entities are corporations (including direct ownership by one corporation of another), (ii) more than 50% common ownership of their capital interests or profits interests, if both entities are partnerships (including direct ownership by one partnership of another), or (iii) more than 50% common ownership of the value of the outstanding stock of the corporation or the capital interests or profit interests of the partnership, as applicable, if one entity is a corporation and the other entity is a partnership (including direct ownership of the applicable stock or interests by one entity of the other). (e) Sale Date means the first day on which there is a binding contract in writing for the sale of the respective Maturity. The Sale Date of each Maturity was [DATE]. Page 270 of 445 4907-2850-2670\3 The representations set forth in this certificate are limited to factual matters only. Nothing in this certificate represents [SHORT NAME OF UNDERWRITER]’s interpretation of any laws, including specifically Sections 103 and 148 of the Internal Revenue Code of 1986, as amended, and the Treasury Regulations thereunder. The undersigned understands that the foregoing information will be relied upon by the Issuer[ and BORROWER (the “Borrower”)] with respect to certain of the representations set forth in the [Tax Certificate][Tax Exemption Agreement] and with respect to compliance with the federal income tax rules affecting the Bonds, and by [BOND COUNSEL] in connection with rendering its opinion that the interest on the Bonds is excluded from gross income for federal income tax purposes, the preparation of the Internal Revenue Service Form 8038[-G][-GC][-TC], and other federal income tax advice that it may give to the Issuer[ and the Borrower] from time to time relating to the Bonds. [UNDERWRITER] By:_______________________________________ Name:_____________________________________ Dated: [ISSUE DATE] ISSUE PRICE CERTIFICATE – COMPETITIVE SALES WITH FEWER THAN THREE BIDS FROM ESTABLISHED UNDERWRITERS $[PRINCIPAL AMOUNT] [BOND CAPTION] ISSUE PRICE CERTIFICATE The undersigned, on behalf of [NAME OF UNDERWRITER/REPRESENTATIVE] ([“[SHORT NAME OF UNDERWRITER]”)][the “Representative”)][, on behalf of itself and [NAMES OF OTHER UNDERWRITERS] (together, the “Underwriting Group”),] hereby certifies as set forth below with respect to the sale of the obligations named above (the “Bonds”). 1. Initial Offering Price of the Bonds. [SHORT NAME OF UNDERWRITER][The Underwriting Group] offered the Bonds to the Public for purchase at the specified initial offering prices listed in Schedule A (the “Initial Offering Prices”) on or before the Sale Date. A copy of the pricing wire for the Bonds is attached to this certificate as Schedule B. 2. Hold the Offering Price Rule. [SHORT NAME OF UNDERWRITER][Each member of the Underwriting Group] has agreed in writing that, (i) for each Maturity, it would neither offer nor sell any of the Bonds of such Maturity to any person at a price that is higher than the Initial Offering Price for such Maturity during the Holding Period for such Maturity (the “Hold-the-Offering-Price Rule”), and (ii) any agreement among underwriters, selling group agreement, or third-party distribution agreement contains the agreement of each underwriter, dealer, or broker-dealer who is a party to such agreement to comply with the Hold-the-Offering-Price Rule. Based on the [Representative][SHORT NAME OF UNDERWRITER]’s own knowledge and, in the case of sales by other Members of the Distribution Group, representations obtained from the other Members of the Distribution Group, no Member of the Distribution Group has offered or sold any such Maturity at a price that is higher than the respective Initial Offering Price during the respective Holding Period. 3. Defined Terms. For purposes of this Issue Price Certificate: (a) Holding Period means the period starting on the Sale Date and ending on the earlier of (i) the close of the fifth business day after the Sale Date ([DATE]), or (ii) the date on which Members of the Distribution Group have sold at least 10% of such Maturity to the Public at one or more prices, none of which is higher than the Initial Offering Price for such Maturity. (b) Issuer means [DESCRIBE ISSUER]. Page 271 of 445 4907-2850-2670\3 (c) Maturity means Bonds with the same credit and payment terms. Any Bonds with different maturity dates, or with the same maturity date but different stated interest rates, are treated as separate Maturities. (d) Member of the Distribution Group means (i) any person that agrees pursuant to a written contract with the Issuer (or with the lead underwriter to form an underwriting syndicate) to participate in the initial sale of the Bonds to the Public, and (ii) any person that agrees pursuant to a written contract directly or indirectly with a person described in clause (i) of this paragraph to participate in the initial sale of the Bonds to the Public (including a member of a selling group or a party to a retail distribution agreement participating in the initial sale of the Bonds to the Public). (e) Public means any person (i.e., an individual, trust, estate, partnership, association, company, or corporation) other than a Member of the Distribution Group or a related party to a Member of the Distribution Group. A person is a “related party” to a Member of the Distribution Group if the Member of the Distribution Group and that person are subject, directly or indirectly, to (i) at least 50% common ownership of the voting power or the total value of their stock, if both entities are corporations (including direct ownership by one corporation of another), (ii) more than 50% common ownership of their capital interests or profits interests, if both entities are partnerships (including direct ownership by one partnership of another), or (iii) more than 50% common ownership of the value of the outstanding stock of the corporation or the capital interests or profit interests of the partnership, as applicable, if one entity is a corporation and the other entity is a partnership (including direct ownership of the applicable stock or interests by one entity of the other). (f) Sale Date means the first day on which there is a binding contract in writing for the sale of the respective Maturity. The Sale Date of each Maturity was [DATE]. The representations set forth in this certificate are limited to factual matters only. Nothing in this certificate represents [NAME OF UNDERWRITING FIRM][the Representative’s] interpretation of any laws, including specifically Sections 103 and 148 of the Internal Revenue Code of 1986, as amended, and the Treasury Regulations thereunder. The undersigned understands that the foregoing information will be relied upon by the Issuer[ and BORROWER (the “Borrower”)] with respect to certain of the representations set forth in the [Tax Certificate][Tax Exemption Agreement] and with respect to compliance with the federal income tax rules affecting the Bonds, and by [BOND COUNSEL] in connection with rendering its opinion that the interest on the Bonds is excluded from gross income for federal income tax purposes, the preparation of the Internal Revenue Service Form 8038[-G][- GC][-TC], and other federal income tax advice that it may give to the Issuer[ and the Borrower] from time to time relating to the Bonds. [UNDERWRITER][REPRESENTATIVE] By:_______________________________________ Name:_____________________________________ Dated: [ISSUE DATE] Page 272 of 445 Finance Plan City of Lakeville, Minnesota $39,505,000 General Obligation Bonds, Series 2026A March 2, 2026 150 South 5th Street, Suite 3300 Minneapolis, MN 55402 612-851-5900 800-851-2920 www.northlandsecurities.com Member FINRA and SIPC | Registered with SEC and MSRB Page 273 of 445 Northland Securities, Inc. Page 2 Contents Executive Summary ............................................................................................................................... 2 Issue Overview ....................................................................................................................................... 3 Purpose ........................................................................................................................................................ 3 Authority ..................................................................................................................................................... 3 Structure ...................................................................................................................................................... 4 Security and Source of Repayment ................................................................................................... 4 Plan Rationale ............................................................................................................................................ 5 Issuing Process .......................................................................................................................................... 5 Attachment 1 – Preliminary Debt Service Schedules ........................................................................ 6 Attachment 2 – Estimated Levy Schedules ......................................................................................... 8 Attachment 3 – Related Considerations ............................................................................................ 10 Not Bank Qualified ........................................................................................................................ 10 Arbitrage Compliance .................................................................................................................. 10 Continuing Disclosure .................................................................................................................. 10 Premiums ........................................................................................................................................... 10 Rating .................................................................................................................................................. 11 Attachment 4 – Calendar of Events .................................................................................................... 12 Attachment 5 - Risk Factors ................................................................................................................. 14 Page 274 of 445 Northland Securities, Inc. Page 2 Executive Summary The following is a summary of the recommended terms for the issuance of $39,505,000 General Obligation Bonds, Series 2026A (the “Bonds”). Additional information on the proposed finance plan and issuing process can be found after the Executive Summary, in the Issue Overview and Attachment 3 – Related Considerations. Purpose Proceeds from the Bonds will be used to finance the City’s 2026 street reconstruction and collector rehabilitation projects, utility and facility improvements, and to finance the costs associated with the issuance of the Bonds. Security The Bonds will be a general obligation of the City. The City will pledge water and sewer revenues and ad valorem taxes for payment of the Bonds. Repayment Term The Bonds will mature annually each February 1 in the years 2027 through 2047. Interest on the Bonds will be payable on February 1, 2027, and semiannually thereafter on each February 1 and August 1. Estimated Interest Rate True interest cost (TIC): 3.67% Interest rates are estimated based on Non-BQ “Aaa” rates as of February 20, 2026, plus 0.25% for planning purposes. Prepayment Option Bonds maturing on and after February 1, 2035, will be subject to redemption on February 1, 2034, and any day thereafter at a price of par plus accrued interest. Rating A rating will be requested from Moody’s Ratings (Moody’s). The City’s general obligation debt is currently rated "Aaa” by Moody’s. Tax Status The Bonds will be tax-exempt, non-bank qualified obligations. Risk Factors There are certain risks associated with all debt. Risk factors related to the Bonds are discussed in Attachment 5. Type of Bond Sale Public Sale – Competitive Bids Proposals Received Monday, April 20, 2026 @ 10:00 A.M. Council Consideration Monday, April 20, 2026 @ 6:00 P.M. Page 275 of 445 Northland Securities, Inc. Page 3 Issue Overview Purpose Proceeds from the Bonds will be used to finance the following projects (together, the “Projects”): • a fire station and land purchase as described in the Capital Improvement Plan approved on October 6, 2025 (the “CIP Portion)” • the 2026 street reconstruction and collector rehabilitation projects (the “Street Reconstruction Portion”); and • the 2026 water and sewer utility projects (the “Utility Portion”). The proceeds will also be used to pay costs associated with issuing the Bonds. The Bonds have been sized based on cost estimates provided by City Staff as of February 20, 2026. The table below contains the estimated sources and uses of funds for the bond issue. Authority The Bonds will be issued pursuant to the authority of Minnesota Statutes, Chapters 475 and 444 and Sections 475.58, Subdivision 3b and 475.521. CIP Portion Under Section 475.521, a capital improvement is a major expenditure of City funds for the acquisition or betterment of public lands, buildings, or other improvements used, such as a city hall, library, public safety, or public works facility, which has a useful life of five years or more. The maximum amount of principal and interest for capital improvement bonds cannot exceed 0.16% of the estimated market value of taxable property in the City. The City’s 2026 preliminary estimated market value is $13,940,494,700 ($13,940,494,700 x 0.0016 = $22,304,792). The maximum amount of principal and interest due in a calendar year on the Bonds plus the City’s outstanding CIP Bonds is estimated to be approximately $4,251,858, which is less than $22,304,792. Before issuing bonds under a Capital Improvement Plan (“CIP”), the City must hold a public hearing on the CIP and the proposed bonds and must then approve the CIP and authorize the issuance of the bonds by at least a 3/5 majority. The City held the required public hearing and approved the CIP on October 6, 2025. If a petition signed by voters equal to at least 5 percent of the votes cast in the last general election requesting a vote on the issuance of bonds is received by the clerk within 30 days after the public CIP (Fire Station) Street Reconstruction & Collector Rehab Utility Improvements Issue Summary Sources Of Funds Par Amount of Bonds $29,260,000.00 $4,945,000.00 $5,300,000.00 $39,505,000.00 Total Sources $29,260,000.00 $4,945,000.00 $5,300,000.00 $39,505,000.00 Uses Of Funds Deposit to Project Construction Fund 28,200,000.00 4,790,584.00 5,240,000.00 38,230,584.00 Deposit to Capitalized Interest (CIF) Fund 725,564.54 97,638.58 -823,203.12 Total Underwriter's Discount (0.700%)204,820.00 34,615.00 37,100.00 276,535.00 Costs of Issuance 128,753.99 21,759.70 23,321.81 173,835.50 Rounding Amount 861.47 402.72 (421.81)842.38 Total Uses $29,260,000.00 $4,945,000.00 $5,300,000.00 $39,505,000.00 Page 276 of 445 Northland Securities, Inc. Page 4 hearing, then the bonds may not be issued unless approved by the voters at an election. The 30- day period expired on November 6, 2025. Street Reconstruction Portion Under Section 475.58, Subdivision 3b., street reconstruction bonds can be used to finance the reconstruction and bituminous overlay of existing city streets. Eligible improvements may include turn lanes and other improvements having a substantial public safety function, realignments, other modifications to intersect with state and county roads and the local share of state and county road projects. Eligible improvements do not include the portion of project cost allocable to widening a street or adding curbs and gutters where none previously existed. Before issuing street reconstruction bonds, the City must hold a public hearing on the street reconstruction project and the proposed bonds, and then must pass a resolution approving the Street Reconstruction Plan and issuance of street reconstruction bonds. The City held the required public hearing and approved the Street Reconstruction Plan on October 6, 2025. Utility Portion Under Chapter 444, cities may add their general obligation pledge of net utility revenues for general obligation bonds issued to build, construct, reconstruct, repair, enlarge, improve, or obtain sanitary sewer, water and storm sewer facilities, and maintain and operate the facilities inside or outside its corporate limits. Structure The CIP Portion has been structured to result in relatively level annual debt service payments over 20 years with principal payments beginning in 2028. The Street Reconstruction Portion of the Bonds has been structured to result in relatively level annual debt service payments over 10 years with principal payments beginning in 2028. The Utility portion has been structured to result in relatively level annual debt service payments over 10 years with principal payments beginning in 2027. The proposed structure for the bond issue and preliminary debt service projections for each portion of the bond issue are illustrated in Attachment 1 and the estimated levies are illustrated in Attachment 2. Security and Source of Repayment The Bonds will be general obligations of the City. The finance plan relies on the following assumptions for the revenues used to pay debt service, as provided by City staff: • Property Taxes. The revenues needed to pay debt service on the Bonds are expected to come from property tax levies. The initial projections show that for the CIP Portion of the bonds, an annual levy of approximately $2,212,093, is needed to meet the 105% statutory requirement. The City anticipates using revenues from franchise fees to annually cancel the CIP levy. The initial projections show that for the Street Reconstruction Portion of the Bonds, an annual net levy of approximately $605,423, is needed to meet the 105% statutory requirement. The city anticipates using special assessment revenues to reduce the levy on an annual basis. The levies may be adjusted annually based on actual monies in the debt service funds. The initial levies will be made in 2026 for taxes payable in 2027. Given the timing of the initial revenue from the tax levy, capitalized interest will be included in the bond issue to cover the first interest payment due on February 1, 2027, before the first tax collections are received for the CIP and Street Reconstruction Portions. Page 277 of 445 Northland Securities, Inc. Page 5 • Water & Sewer Revenues. Net revenues of the City’s water and sewer utilities will be pledged for payment of the Utility Portion of the Bonds. The City will covenant to adopt water and sewer rates and charges that are sufficient to produce net revenues equal to at least 105% of the debt service requirements on the Utility Portion of the Bonds. In the event there is a deficiency in the amount of net revenues available for payment of debt service, the City may levy taxes to cover the insufficiency, but only on a temporary basis until rates are adjusted Plan Rationale The Finance Plan recommended in this report is based on a variety of factors and information provided by the City related to the financed project and City objectives, Northland’s knowledge of the City and our experience in working with similar cities and projects. The issuance of General Obligation Bonds provides the best means of achieving the City’s objectives and cost-effective financing. The City has successfully issued and managed this type of debt for previous projects. Issuing Process Northland will receive bids from underwriters to purchase the Bonds on Monday, April 20, 2026, at 10:00 A.M. Market conditions and the marketability of the Bonds support issuance through a competitive sale. This process has been chosen as it is intended to produce the lowest combination of interest expense and underwriting expense on the structure, date and time set to receive bids. The calendar of events for the issuing process can be found in Attachment 4. Municipal Advisor: Northland Securities, Inc., Minneapolis, Minnesota Bond Counsel: Dorsey & Whitney LLP, Minneapolis, Minnesota Paying Agent: US Bank Trust Company, National Association, St. Paul, Minnesota Page 278 of 445 Northland Securities, Inc. Page 6 Attachment 1 – Preliminary Debt Service Schedules Total Combined *Based on preliminary, Non-Bank Qualified “Aaa” rates as of February 20, 2026, plus 0.25%. Date Principal Coupon Interest Total P+I Fiscal Total 05/14/2026 ----- 02/01/2027 510,000.00 2.500%924,561.06 1,434,561.06 1,434,561.06 08/01/2027 --641,177.50 641,177.50 - 02/01/2028 2,010,000.00 2.450%641,177.50 2,651,177.50 3,292,355.00 08/01/2028 --616,555.00 616,555.00 - 02/01/2029 2,055,000.00 2.450%616,555.00 2,671,555.00 3,288,110.00 08/01/2029 --591,381.25 591,381.25 - 02/01/2030 2,110,000.00 2.500%591,381.25 2,701,381.25 3,292,762.50 08/01/2030 --565,006.25 565,006.25 - 02/01/2031 2,165,000.00 2.550%565,006.25 2,730,006.25 3,295,012.50 08/01/2031 --537,402.50 537,402.50 - 02/01/2032 2,220,000.00 2.600%537,402.50 2,757,402.50 3,294,805.00 08/01/2032 --508,542.50 508,542.50 - 02/01/2033 2,280,000.00 2.700%508,542.50 2,788,542.50 3,297,085.00 08/01/2033 --477,762.50 477,762.50 - 02/01/2034 2,340,000.00 2.850%477,762.50 2,817,762.50 3,295,525.00 08/01/2034 --444,417.50 444,417.50 - 02/01/2035 2,405,000.00 2.950%444,417.50 2,849,417.50 3,293,835.00 08/01/2035 --408,943.75 408,943.75 - 02/01/2036 2,470,000.00 3.100%408,943.75 2,878,943.75 3,287,887.50 08/01/2036 --370,658.75 370,658.75 - 02/01/2037 1,945,000.00 3.300%370,658.75 2,315,658.75 2,686,317.50 08/01/2037 --338,566.25 338,566.25 - 02/01/2038 1,430,000.00 3.450%338,566.25 1,768,566.25 2,107,132.50 08/01/2038 --313,898.75 313,898.75 - 02/01/2039 1,480,000.00 3.600%313,898.75 1,793,898.75 2,107,797.50 08/01/2039 --287,258.75 287,258.75 - 02/01/2040 1,530,000.00 3.750%287,258.75 1,817,258.75 2,104,517.50 08/01/2040 --258,571.25 258,571.25 - 02/01/2041 1,590,000.00 3.850%258,571.25 1,848,571.25 2,107,142.50 08/01/2041 --227,963.75 227,963.75 - 02/01/2042 1,650,000.00 3.950%227,963.75 1,877,963.75 2,105,927.50 08/01/2042 --195,376.25 195,376.25 - 02/01/2043 1,715,000.00 4.050%195,376.25 1,910,376.25 2,105,752.50 08/01/2043 --160,647.50 160,647.50 - 02/01/2044 1,785,000.00 4.150%160,647.50 1,945,647.50 2,106,295.00 08/01/2044 --123,608.75 123,608.75 - 02/01/2045 1,860,000.00 4.200%123,608.75 1,983,608.75 2,107,217.50 08/01/2045 --84,548.75 84,548.75 - 02/01/2046 1,935,000.00 4.250%84,548.75 2,019,548.75 2,104,097.50 08/01/2046 --43,430.00 43,430.00 - 02/01/2047 2,020,000.00 4.300%43,430.00 2,063,430.00 2,106,860.00 Total $39,505,000.00 -$15,315,996.06 $54,820,996.06 - Yield Statistics Bond Year Dollars $420,212.18 Average Life 10.637 Years Average Coupon 3.6448244% Net Interest Cost (NIC)3.7106328% True Interest Cost (TIC)3.6742508% Bond Yield for Arbitrage Purposes 3.5912500% All Inclusive Cost (AIC)3.7268714% IRS Form 8038 Net Interest Cost 3.6448244% Weighted Average Maturity 10.637 Years Optional Redemption 02/01/2034 @100.000% Page 279 of 445 Northland Securities, Inc. Page 7 CIP Portion Date Principal Coupon Interest Total P+I Fiscal Total 05/14/2026 ----- 02/01/2027 --725,564.54 725,564.54 725,564.54 08/01/2027 --508,177.50 508,177.50 - 02/01/2028 1,090,000.00 2.450%508,177.50 1,598,177.50 2,106,355.00 08/01/2028 --494,825.00 494,825.00 - 02/01/2029 1,115,000.00 2.450%494,825.00 1,609,825.00 2,104,650.00 08/01/2029 --481,166.25 481,166.25 - 02/01/2030 1,145,000.00 2.500%481,166.25 1,626,166.25 2,107,332.50 08/01/2030 --466,853.75 466,853.75 - 02/01/2031 1,175,000.00 2.550%466,853.75 1,641,853.75 2,108,707.50 08/01/2031 --451,872.50 451,872.50 - 02/01/2032 1,205,000.00 2.600%451,872.50 1,656,872.50 2,108,745.00 08/01/2032 --436,207.50 436,207.50 - 02/01/2033 1,235,000.00 2.700%436,207.50 1,671,207.50 2,107,415.00 08/01/2033 --419,535.00 419,535.00 - 02/01/2034 1,270,000.00 2.850%419,535.00 1,689,535.00 2,109,070.00 08/01/2034 --401,437.50 401,437.50 - 02/01/2035 1,305,000.00 2.950%401,437.50 1,706,437.50 2,107,875.00 08/01/2035 --382,188.75 382,188.75 - 02/01/2036 1,340,000.00 3.100%382,188.75 1,722,188.75 2,104,377.50 08/01/2036 --361,418.75 361,418.75 - 02/01/2037 1,385,000.00 3.300%361,418.75 1,746,418.75 2,107,837.50 08/01/2037 --338,566.25 338,566.25 - 02/01/2038 1,430,000.00 3.450%338,566.25 1,768,566.25 2,107,132.50 08/01/2038 --313,898.75 313,898.75 - 02/01/2039 1,480,000.00 3.600%313,898.75 1,793,898.75 2,107,797.50 08/01/2039 --287,258.75 287,258.75 - 02/01/2040 1,530,000.00 3.750%287,258.75 1,817,258.75 2,104,517.50 08/01/2040 --258,571.25 258,571.25 - 02/01/2041 1,590,000.00 3.850%258,571.25 1,848,571.25 2,107,142.50 08/01/2041 --227,963.75 227,963.75 - 02/01/2042 1,650,000.00 3.950%227,963.75 1,877,963.75 2,105,927.50 08/01/2042 --195,376.25 195,376.25 - 02/01/2043 1,715,000.00 4.050%195,376.25 1,910,376.25 2,105,752.50 08/01/2043 --160,647.50 160,647.50 - 02/01/2044 1,785,000.00 4.150%160,647.50 1,945,647.50 2,106,295.00 08/01/2044 --123,608.75 123,608.75 - 02/01/2045 1,860,000.00 4.200%123,608.75 1,983,608.75 2,107,217.50 08/01/2045 --84,548.75 84,548.75 - 02/01/2046 1,935,000.00 4.250%84,548.75 2,019,548.75 2,104,097.50 08/01/2046 --43,430.00 43,430.00 - 02/01/2047 2,020,000.00 4.300%43,430.00 2,063,430.00 2,106,860.00 Total $29,260,000.00 -$13,600,669.54 $42,860,669.54 - Page 280 of 445 Northland Securities, Inc. Page 8 Street Reconstruction Portion Utility Portion Date Principal Coupon Interest Total P+I Fiscal Total 05/14/2026 ----- 02/01/2027 --97,638.58 97,638.58 97,638.58 08/01/2027 --68,385.00 68,385.00 - 02/01/2028 440,000.00 2.450%68,385.00 508,385.00 576,770.00 08/01/2028 --62,995.00 62,995.00 - 02/01/2029 450,000.00 2.450%62,995.00 512,995.00 575,990.00 08/01/2029 --57,482.50 57,482.50 - 02/01/2030 460,000.00 2.500%57,482.50 517,482.50 574,965.00 08/01/2030 --51,732.50 51,732.50 - 02/01/2031 475,000.00 2.550%51,732.50 526,732.50 578,465.00 08/01/2031 --45,676.25 45,676.25 - 02/01/2032 485,000.00 2.600%45,676.25 530,676.25 576,352.50 08/01/2032 --39,371.25 39,371.25 - 02/01/2033 500,000.00 2.700%39,371.25 539,371.25 578,742.50 08/01/2033 --32,621.25 32,621.25 - 02/01/2034 510,000.00 2.850%32,621.25 542,621.25 575,242.50 08/01/2034 --25,353.75 25,353.75 - 02/01/2035 525,000.00 2.950%25,353.75 550,353.75 575,707.50 08/01/2035 --17,610.00 17,610.00 - 02/01/2036 540,000.00 3.100%17,610.00 557,610.00 575,220.00 08/01/2036 --9,240.00 9,240.00 - 02/01/2037 560,000.00 3.300%9,240.00 569,240.00 578,480.00 Total $4,945,000.00 -$918,573.58 $5,863,573.58 - Date Principal Coupon Interest Total P+I Fiscal Total 05/14/2026 ----- 02/01/2027 510,000.00 2.500% 101,357.94 611,357.94 611,357.94 08/01/2027 --64,615.00 64,615.00 - 02/01/2028 480,000.00 2.450%64,615.00 544,615.00 609,230.00 08/01/2028 --58,735.00 58,735.00 - 02/01/2029 490,000.00 2.450%58,735.00 548,735.00 607,470.00 08/01/2029 --52,732.50 52,732.50 - 02/01/2030 505,000.00 2.500%52,732.50 557,732.50 610,465.00 08/01/2030 --46,420.00 46,420.00 - 02/01/2031 515,000.00 2.550%46,420.00 561,420.00 607,840.00 08/01/2031 --39,853.75 39,853.75 - 02/01/2032 530,000.00 2.600%39,853.75 569,853.75 609,707.50 08/01/2032 --32,963.75 32,963.75 - 02/01/2033 545,000.00 2.700%32,963.75 577,963.75 610,927.50 08/01/2033 --25,606.25 25,606.25 - 02/01/2034 560,000.00 2.850%25,606.25 585,606.25 611,212.50 08/01/2034 --17,626.25 17,626.25 - 02/01/2035 575,000.00 2.950%17,626.25 592,626.25 610,252.50 08/01/2035 --9,145.00 9,145.00 - 02/01/2036 590,000.00 3.100%9,145.00 599,145.00 608,290.00 Total $5,300,000.00 -$796,752.94 $6,096,752.94 - Page 281 of 445 Northland Securities, Inc. Page 9 Attachment 2 – Estimated Levy Schedules CIP Portion Street Reconstruction Portion Date Total P+I CIF 105% Levy Less: Franchise Fee Revenue*Net Levy Levy Year Collection Year 02/01/2027 725,564.54 (725,564.54)--- 02/01/2028 2,106,355.00 -2,211,672.75 2,211,672.75 -2026 2027 02/01/2029 2,104,650.00 -2,209,882.50 2,209,882.50 -2027 2028 02/01/2030 2,107,332.50 -2,212,699.13 2,212,699.13 -2028 2029 02/01/2031 2,108,707.50 -2,214,142.88 2,214,142.88 -2029 2030 02/01/2032 2,108,745.00 -2,214,182.25 2,214,182.25 -2030 2031 02/01/2033 2,107,415.00 -2,212,785.75 2,212,785.75 -2031 2032 02/01/2034 2,109,070.00 -2,214,523.50 2,214,523.50 -2032 2033 02/01/2035 2,107,875.00 -2,213,268.75 2,213,268.75 -2033 2034 02/01/2036 2,104,377.50 -2,209,596.38 2,209,596.38 -2034 2035 02/01/2037 2,107,837.50 -2,213,229.38 2,213,229.38 -2035 2036 02/01/2038 2,107,132.50 -2,212,489.13 2,212,489.13 -2036 2037 02/01/2039 2,107,797.50 -2,213,187.38 2,213,187.38 -2037 2038 02/01/2040 2,104,517.50 -2,209,743.38 2,209,743.38 -2038 2039 02/01/2041 2,107,142.50 -2,212,499.63 2,212,499.63 -2039 2040 02/01/2042 2,105,927.50 -2,211,223.88 2,211,223.88 -2040 2041 02/01/2043 2,105,752.50 -2,211,040.13 2,211,040.13 -2041 2042 02/01/2044 2,106,295.00 -2,211,609.75 2,211,609.75 -2042 2043 02/01/2045 2,107,217.50 -2,212,578.38 2,212,578.38 -2043 2044 02/01/2046 2,104,097.50 -2,209,302.38 2,209,302.38 -2044 2045 02/01/2047 2,106,860.00 -2,212,203.00 2,212,203.00 -2045 2046 Total $42,860,669.54 (725,564.54) $44,241,860.25 $44,241,860.25 - *The City anticipates using revenues from franchise fees to eliminate the levy. Date Total P+I CIF 105% Levy Less: Special Assessment Revenues*Net Levy Levy Year Collection Year 02/01/2027 97,638.58 (97,638.58)--- 02/01/2028 576,770.00 -605,608.50 75,938.69 529,669.81 2026 2027 02/01/2029 575,990.00 -604,789.50 70,408.52 534,380.98 2027 2028 02/01/2030 574,965.00 -603,713.25 67,980.64 535,732.61 2028 2029 02/01/2031 578,465.00 -607,388.25 65,552.76 541,835.49 2029 2030 02/01/2032 576,352.50 -605,170.13 63,124.88 542,045.25 2030 2031 02/01/2033 578,742.50 -607,679.63 60,697.00 546,982.63 2031 2032 02/01/2034 575,242.50 -604,004.63 58,269.12 545,735.51 2032 2033 02/01/2035 575,707.50 -604,492.88 55,841.24 548,651.64 2033 2034 02/01/2036 575,220.00 -603,981.00 53,413.36 550,567.64 2034 2035 02/01/2037 578,480.00 -607,404.00 50,985.48 556,418.52 2035 2036 Total $5,863,573.58 (97,638.58)$6,054,231.75 $622,211.69 $5,432,020.06 *Special assessments are not pledged as security to the Bonds. The City anticipates reducing the levy with special assessment collections. Special assessment revenue is based on assessments totaling $485,576, spread in equal principal payments over 10 years, assessed at a rate of 5.00% (2% over the TIC). Page 282 of 445 Northland Securities, Inc. Page 10 Attachment 3 – Related Considerations Not Bank Qualified The par amount of the Bonds is greater than $10,000,000; therefore, the Bonds will not be designated as “bank qualified” obligations pursuant to Federal Tax Law. Arbitrage Compliance Project/Construction Fund. All tax-exempt bond issues are subject to federal rebate requirements which require all arbitrage earned to be rebated to the U.S. Treasury. The rebate exemption the City expects to qualify for is the “24-month exception.” Debt Service Fund. The City must maintain a bona fide debt service fund for the Bonds or be subject to yield restriction in the debt service fund. A bona fide debt service fund involves an equal matching of revenues to debt service expense with a balance forward permitted equal to the greater of the investment earnings in the fund during that year or 1/12 of the debt service of that year. The City should become familiar with the various Arbitrage Compliance requirements for this bond issue. The Resolution for the Bonds prepared by Bond Counsel explains the requirements in greater detail. Continuing Disclosure Type: Full Dissemination Agent: Northland Securities, Inc. The requirements for continuing disclosure are governed by SEC Rule 15c2-12. The primary requirements of Rule 15c2-12 actually fall on underwriters. The Rule sets forth due diligence needed prior to the underwriter’s purchase of municipal securities. Part of this requirement is obtaining commitment from the issuer to provide continuing disclosure. The document describing the continuing disclosure commitments (the “Undertaking”) is contained in the Official Statement that will be prepared to offer the Bonds to investors. The City has more than $10,000,000 of outstanding debt and is required to undertake “full” continuing disclosure. Full disclosure requires annual posting of the audit and a separate continuing disclosure report, as well as the reporting of certain “material events.” Material events set forth in the Rule, including, but not limited to, bond rating changes, call notices, and issuance of “financial obligations” (such as USDA loans, Public Finance Authority loans and lease agreements) must be reported within ten days of occurrence. The report contains annual financial information and operating data that “mirrors” material information presented in the Official Statement. The specific contents of the annual report will be described in the Undertaking that appears in the appendix of the Official Statement. Northland currently serves as dissemination agent for the City, assisting with the annual reporting. The information for the Bonds will be incorporated into our reporting. Premiums In the current market environment, it is likely that bids received from underwriters will include premiums. A premium bid occurs when the purchaser pays the City an amount in excess of the par amount of a maturity in exchange for a higher coupon (interest rate). The use of premiums reflects the bidder’s view on future market conditions, tax considerations for investors and other Page 283 of 445 Northland Securities, Inc. Page 11 factors. Ultimately, the true interest cost (“TIC”) calculation will determine the lowest bid, regardless of premium. A premium bid produces additional funds that can be used in several ways: • The premium means that the City needs less bond proceeds and can reduce the size of the issue by the amount of the premium. • The premium can be deposited in the Construction Fund and used to pay additional project costs, rather than used to reduce the size of the issue. • The premium can be deposited in the Debt Service Fund and used to pay principal and interest. Northland will work with City staff prior to the sale day to determine use of premium (if any). Rating A rating will be requested from Moody’s Ratings (Moody’s). The City’s general obligation debt is currently rated “Aaa” by Moody’s. The rating process will include a conference call with the rating analyst. Northland will assist City staff in preparing for and conducting the rating call. Page 284 of 445 Northland Securities, Inc. Page 12 Attachment 4 – Calendar of Events The following checklist of items denotes each milestone activity as well as the members of the finance team who will have the responsibility to complete it. Please note this proposed timetable assumes regularly scheduled City Council meetings (1st & 3rd Mondays at 6 p.m., moved to Tuesday if Monday is a holiday). Council Workshops are held the 4th Monday at 6 p.m. Date Action Responsible Party February 11, 2026 General Information Certificate sent to City for updates Northland February 12, 2026 City provides project costs to be included in Finance Plan no later than noon City Staff February 23, 2026 Finance Plan and Set Sale Resolution sent to City for meeting packet for March 2, 2026 Council Meeting Northland, Bond Counsel February 25, 2026 General Information Certificate returned to Northland City Staff March 2, 2026 Presentation of Finance Plan at Work Session – 6:15 p.m. City Council Review, Northland March 11, 2026 Preliminary Official Statement sent to City for sign off, sent to Rating Agency to initiate rating processes, and sent to Dorsey & Whitney for review Northland Week of March 16, 2026 Meeting to prepare for rating call City Staff, Northland March 16, 2026 City adopts Set Sale Resolution (on consent) – 6:00 p.m. City Council Action, Northland, Dorsey & Whitney January 2026 February 2026 Sun Mon Tue Wed Thu Fri Sat Sun Mon Tue Wed Thu Fri Sat 1 2 3 1 2 3 4 5 6 7 4 5 6 7 8 9 10 8 9 10 11 12 13 14 11 12 13 14 15 16 17 15 16 17 18 19 20 21 18 19 20 21 22 23 24 22 23 24 25 26 27 28 25 26 27 28 29 30 31 March 2026 April 2026 Sun Mon Tue Wed Thu Fri Sat Sun Mon Tue Wed Thu Fri Sat 1 2 3 4 5 6 7 1 2 3 4 8 9 10 11 12 13 14 5 6 7 8 9 10 11 15 16 17 18 19 20 21 12 13 14 15 16 17 18 22 23 24 25 26 27 28 19 20 21 22 23 24 25 29 30 31 26 27 28 29 30 Holiday Page 285 of 445 Northland Securities, Inc. Page 13 Date Action Responsible Party Week of March 23 or March 30, 2026 Rating call with Moody’s City Staff, Northland, Rating Agency March 25, 2026 City comments and sign off on Preliminary Official Statement due to Northland City confirms final project costs to be financed and use of premium City Staff April 8, 2026 Rating Received no later than this date City Staff, Northland, Rating Agency April 9, 2026 Distribution of Preliminary Official Statement Northland April 13, 2026 Authorizing Resolution sent to City Dorsey & Whitney, Northland April 20, 2026 Bond Sale – 10:00 a.m. Bond Purchase Agreement Signed - 6:00 p.m. Authorizing Resolution Adopted City Council Action, Northland, Dorsey & Whitney April 27, 2026 Closing Documents Distributed Dorsey & Whitney May 14, 2026 Closing on the Bonds (Proceeds Available) Northland, City Staff, Dorsey & Whitney Page 286 of 445 Northland Securities, Inc. Page 14 Attachment 5 - Risk Factors Property Taxes: Property tax levies shown in this Finance Plan are based on projected debt service and other revenues. Final levies will be set based on the results of sale. Levies should be reviewed annually and adjusted as needed. The debt service levy must be included in the preliminary levy for annual Truth in Taxation hearings. Future Legislative changes in the property tax system, including the imposition of levy limits and changes in calculation of property values, would affect plans for payment of debt service. Delinquent payment of property taxes would reduce revenues available to pay debt service. Water and Sewer Revenues: The City pledges the net revenues of the water and sewer utilities to the payment of principal and interest on the Utility Portion of the Bonds. The failure to adjust rates and charges as needed and the loss of significant customers will affect available net revenues. If the net revenues are insufficient, the City is required to levy property taxes or use other revenues to cover the deficiency. Property taxes can only be used on a temporary basis and may not be an ongoing source of revenue to pay debt service. General: In addition to the risks described above, there are certain general risks associated with the issuance of bonds. These risks include, but are not limited to: • Failure to comply with covenants in bond resolution. • Failure to comply with Undertaking for continuing disclosure. • Failure to comply with IRS regulations, including regulations related to use of the proceeds and arbitrage/rebate. The IRS regulations govern the ability of the City to issue its bonds as tax-exempt securities and failure to comply with the IRS regulations may lead to loss of tax- exemption. Page 287 of 445 March 16, 2026 Item No. RESOLUTION AMENDING THE 2025 BUDGETS Proposed Action Staff recommends adoption of the following motion: Move to approve the Resolution Amending the 2025 General, Enterprise and Capital Fund Budgets. Overview Since much of the fiscal activity has already occurred, it is appropriate to amend the budget to more accurately reflect actual results. The proposed budget amendments are presented in two sections: Exhibit A for the General Fund and Exhibit B for the Capital and Enterprise Funds. These amendments ensure continued compliance with the City's financial policies and provide more accurate representation of operating revenues and expenditures. Detailed explanations for the adjustments are included as part of the exhibits to the resolution. The Adopted Budget January 1, 2025 fund balance was based on estimates from the prior year. The Final Amended Budget reflects the actual fund balance on January 1, 2025. Supporting Information 12/15/2025 Final Adopte d YTD 3/16/2026 Ame nde d Budge t Ame nde d Ame ndme nt Budge t Revenues 44,006,517$45,232,053$80,300 45,312,353$ Expenditures 43,493,424 43,584,990 80,300 43,665,290 Excess (Deficiency)513,093 1,647,063 -1,647,063 Other Financing Sources (Uses)170,000 (1,825,500)-(1,825,500) Net Change in Fund Balance 683,093 (178,437)-(178,437) Fund Balance, January 1 22,430,446 23,186,629 -23,186,629 Fund Balance, December 31 23,113,539$23,008,192$-23,008,192$ Ge ne ral Fund Page 288 of 445 • Resolution o Exhibit A: General Fund Budget Amendment detail o Exhibit B: Capital and Enterprise Fund Budgets Amendment detail Financial Impact: $ Budgeted: Y☐ N☐ Source: Related Documents: (CIP, ERP, etc.): Envision Lakeville Community Values: Good Value for Public Services Report Completed by: Julie Stahl, Finance Director 0 00 (GF) Various 2025 Budget Page 289 of 445 CITY OF LAKEVILLE RESOLUTION NO. ________ Resolution Amending the 2025 General, Enterprise and Capital Fund Budgets BE IT RESOLVED by the City Council of the City of Lakeville, Minnesota as follows: 1. The 2025 budget for the General Fund is hereby amended for the fiscal year ending December 31, 2025 as per Exhibit A, as attached hereto. 2. The 2025 budgets for the Enterprise and Capital Funds are hereby amended for the fiscal year ending December 31, 2025 as per Exhibit B, as attached hereto. ADOPTED by the Lakeville City Council this 16th day of March, 2026. ________________________________ Luke M. Hellier, Mayor ________________________________ Ann Orlofsky, City Clerk Page 290 of 445 03/12/2026 BUDGET AMENDMENT REPORT FOR CITY OF LAKEVILLE EXHIBIT A CHANGE TO POST BUDGET Fund/Dept Category DATE REF #DESCRIPTION INCRS/(DECRS) 1000.1220 Exp - Commodities 12/31/25 3261 RECLASS AMMUNITION TO SEPARATE ACCT (47,250) 1000.1220 Exp - Commodities 12/31/25 3261 RECLASS AMMUNITION TO SEPARATE ACCT 47,250 BA #3261 Subtotal 0 1000.1700 Rev - Park Bldg Rental 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 24,800 1000.1700 Exp - Personnel 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 24,800 1000.1806 Rev - Park Bldg Rental 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 10,000 1000.1800 Exp - Personnel 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 10,000 1000.1813 Rev - Pottery Classes 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 9,000 1000.1813 Rev - Pottery Sales 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 2,500 1000.1812 Exp - Personnel 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 11,500 1000.1813 Rev - Donations 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 7,500 1000.1813 Exp - Capital Outlay 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 7,500 1000.1826 Rev - Misc Classes 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 2,000 1000.1826 Exp - Personnel 12/31/25 3795 RECREATION REVENUES ADJUSTMENTS 2,000 BA #3795 Subtotal 0 Page 291 of 445 03/12/2026 BUDGET AMENDMENT REPORT FOR CITY OF LAKEVILLE EXHIBIT B 6586.6586 Rev - T/I from Capital 12/31/25 3665 EXCESS 2024A BOND PROCEEDS TO P22-0 524,000 6595.6595 Exp -T/O to Capital 12/31/25 3665 EXCESS 2024A BOND PROCEEDS TO P22-0 524,000 BA #3665 Subtotal 0 4125.4125 Rev - T/I from LIQ 12/31/25 3785 REDUCE EF TO F4125 TRANSFERS (31,759) 4125.4125 Rev - T/I from UTIL 12/31/25 3785 REDUCE EF TO F4125 TRANSFERS (33,307) 4125.4125 Rev - T/I from UTIL 12/31/25 3785 REDUCE EF TO F4125 TRANSFERS (33,307) 7600.7601 Exp -T/O to Capital 12/31/25 3785 REDUCE EF TO F4125 TRANSFERS (33,307) 7700.7701 Exp -T/O to Capital 12/31/25 3785 REDUCE EF TO F4125 TRANSFERS (33,307) 7800.7800 Exp -T/O to Capital 12/31/25 3785 REDUCE EF TO F4125 TRANSFERS (31,759) BA #3785 Subtotal 0 4200.4201 Exp -T/O to Capital 12/31/25 3790 CP22-10 REMOVE UNNEEDED TRANSFER 1,470,725 4700.4704 Rev - T/I from Capital 12/31/25 3790 CP22-10 REMOVE UNNEEDED TRANSFER 1,470,725 BA #3790 Subtotal 0 4200.4201 Exp -T/O to Capital 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-(1,200,000) 4200.4201 Exp -T/O to Capital 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-(350,000) 4700.4704 Exp -T/O to Capital 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-42,247 4710.4711 Exp -T/O to Capital 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-904,949 4720.4721 Rev - T/I from Capital 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-(295,051) 4720.4721 Exp - Other Charges 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-264,375 4720.4721 Exp - Other Charges 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-368,000 4720.4722 Rev - T/I from Capital 12/31/25 3792 PARK BOND XFERS & ADJ TO ACTUAL 24-(307,753) BA #3792 Subtotal 0 4161.4164 Rev - T/I from Capital 12/31/25 3794 P22-18 ADJUST BUDGET TO ACTUAL (293,977) 4161.4164 Exp - Other Charges 12/31/25 3794 P22-18 ADJUST BUDGET TO ACTUAL 306,313 4161.4164 Exp - Capital 12/31/25 3794 P22-18 ADJUST BUDGET TO ACTUAL (600,290) 4200.4201 Exp -T/O to Capital 12/31/25 3794 P22-18 ADJUST BUDGET TO ACTUAL (293,977) BA #3794 Subtotal 0 7600.7600 Rev - Donations 12/31/25 3803 F7600/F7700 ADJUST BUDGET EST TO AC 4,490,000 7600.7600 Rev - Water Sales 12/31/25 3803 F7600/F7700 ADJUST BUDGET EST TO AC 1,360,657 7600.7612 Exp - Other Charges 12/31/25 3803 F7600/F7700 ADJUST BUDGET EST TO AC 935,000 7600.7612 Exp - Capital 12/31/25 3803 F7600/F7700 ADJUST BUDGET EST TO AC 127,000 7600.7681 Exp - Commodities 12/31/25 3803 F7600/F7700 ADJUST BUDGET EST TO AC (210,000) 7700.7700 Rev - Donations 12/31/25 3803 F7600/F7700 ADJUST BUDGET EST TO AC 3,750,000 7700.7700 Rev - Sewer Use 12/31/25 3803 F7600/F7700 ADJUST BUDGET EST TO AC 1,506,346 BA #3803 Subtotal 10,255,003 6597.6597 Rev - Orig Resolution N/A REVENUE NOT FULLY REFLECTED 579,317 Page 292 of 445 Date: 3/16/2026 North Ryan Second Addition Development Contract Proposed Action Staff recommends adoption of the following motion: Move to approve the Development Contract for North Ryan Second Addition Overview The City Council approved the final plat and resolution for North Ryan Second Addition on January 20, 2026. The approved plat includes a one lot subdivision and the development of a recycling facility. The property is located south of CSAH 70, north of 217th Street and west of Jacquard Avenue and totals 11.97 acres. A stipulation of approval requires the developer to sign a development contract and all documents pursuant to the approved development contract. The development contract is required to address site improvements and securities to assure the City the work is completed as planned. Dakota County Board of Commissioners approved the Development Contract at their March 3, 2026, meeting. Supporting Information 1. Development Contract 2. Final Plat Financial Impact: NA Budgeted: No Source: Envision Lakeville Community Values: Diversified Economic Development Report Completed by: Heather Botten, Senior Planner Page 293 of 445 Page 294 of 445 Page 295 of 445 Page 296 of 445 Page 297 of 445 Page 298 of 445 Page 299 of 445 Page 300 of 445 Page 301 of 445 Page 302 of 445 Page 303 of 445 Page 304 of 445 Page 305 of 445 Page 306 of 445 Page 307 of 445 Page 308 of 445 Page 309 of 445 Page 310 of 445 Page 311 of 445 Page 312 of 445 Page 313 of 445 Page 314 of 445 Page 315 of 445 Page 316 of 445 Page 317 of 445 Page 318 of 445 Page 319 of 445 N89°55'01"E 903.62 S0°33'32"W 583.23N89°26'28"W 899.98N0°12'01"E 573.12LOT 1 BLOCK 1 LEGEND OFFICIAL PLAT NORTH RYAN SECOND ADDITION Page 320 of 445 Date: 3/16/2026 Contract for Lawn Maintenance at City Facilities and Miscellaneous Sites Proposed Action Staff recommends adoption of the following motion:Move to approve a contract with Lakeville Lawn Care and Snow Removal for the city building and facilities lawn maintenance services in the amount of $96,072. Overview City staff solicited proposals from lawn maintenance contractors to provide lawn care services at City buildings and facility sites. The City does not have the internal capacity to perform this work with existing staff. Four proposals were received with the lowest proposal submitted by Lakeville Lawn Care and Snow Removal. Staff recommends approval of a contract with Lakeville Lawn Care and Snow Removal in the amount of $96,072. Supporting Information 1. Contract 2. Bid Tabulation Financial Impact: $96,072 Budgeted: Yes Source: Department operating budgets Envision Lakeville Community Values: Good Value of Public Services Report Completed by: Tom Breeggemann Facilities Supervisor Page 321 of 445 225017v1 CONTRACT FOR SERVICES BUILDING AND FACITILITIES LANDSCAPE MAINTENANCE 2026 AGREEMENT made this 16th day of March 2026, by and between the CITY OF LAKEVILLE, a Minnesota municipal corporation (“City”) and LAKEVILLE LAWN CARE & SNOW REMOVAL LLC. (“Contractor”). IN CONSIDERATION OF THE MUTUAL COVENANTS THE PARTIES AGREE AS FOLLOWS: 1. CONTRACT DOCUMENTS The following documents shall be referred to as the “Contract Documents,” all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement B. 2026 Building and Facility Lawncare RFP C. Parcels and Properties (Exhibit A) D. Building and Facilities Maintenance Standards (Exhibit B) E. Contractors Proposal (Exhibit C) 2. CONTRACTOR’S RESPONSIBILITIES. A. Contractor shall be responsible for providing lawn maintenance services for parcels or properties listed in Exhibit A per the City of Lakeville’s Building and Facilities Landscape Maintenance Standards, attached hereto as Exhibit B. (“Work”). 3. INDEMNIFICATION. To the fullest extent permitted by law, Contractor agrees to defend, indemnify and hold harmless the City, and its employees, officials, and agents from and against all claims, actions, damages, losses and expenses, including reasonable attorney fees, arising out of Contractor’s negligence or its performance or failure to perform its obligations under this Contract. Contractor’s indemnification obligation shall apply to subcontractor(s), or anyone directly or indirectly employed or hired by Contractor, or anyone for whose acts Contractor may be liable. Contractor agrees this indemnity obligation shall survive the completion or termination of this Contract. 4. TERM. The term of this contract shall be March 31st 2026 – December 31st, 2026. 5. RIGHTS AND REMEDIES. A. The duties and obligations imposed by the Contract Documents, and the rights and remedies available there under shall be in addition to, and not a limitation of, any duties, obligations, rights and remedies otherwise imposed or available by law. B. No action, or failure to act, by the City or the Contractor shall constitute a waiver of any right or duty afforded any of them under the Contract, nor shall any such action or failure to act constitute an approval of, or acquiescence in, any breach there under except as may be specifically agreed in writing. 6. GOVERNING LAW. The Contract shall be governed by the laws of the State of Minnesota. 7. CONDITION/INSPECTION/REMEDY. Page 322 of 445 225017v1 A. All goods and other materials furnished under this Contract shall be new and in current manufacture unless otherwise specified, and all goods and work shall be of good quality, free from faults and defects and in conformance with the Contract Documents. All services not conforming to these requirements shall be considered defective. B. Services shall be subject to inspection by the City. C. Defective work shall be removed and replaced, or satisfactorily repaired. 8. CHANGES TO WORK. Without invalidating the Contract, the City may, at any time, or from time to time, order additions, deletions or revisions in the Work; these will be authorized by an amendment to the Contract. Upon approval of an amendment, Contractor shall proceed with the Work involved. Changes in the Contract Price shall be based upon the prices identified in the Proposal Form provided as Exhibit C or negotiated between the parties based on similar work provided in the Proposal Form. 9. UNAUTHORIZED WORK. Additional work performed without authorization of a Change Order will not entitle Contractor to an increase in the Contract Price or an extension of the Contract Time. 10. OBLIGATIONS OF THE CITY. The City shall pay the Contractor for performance of the Contract as per the Proposal Form attached hereto as Exhibit C from March 31st 2026 - December 31, 2026. Payments shall be made periodically after a service has been completed and within thirty (30) days of receipt of an invoice. 11. WORKER’S SAFETY. The Contractor shall follow all applicable safety standards for landscape maintenance; including but not limited to hearing, mower operation and chemical application. 12. INSURANCE. Prior to the start of the project, Contractor shall furnish to the City a certificate of insurance showing proof of the required insurance required under this Paragraph. Contractor shall take out and maintain or cause to be taken out and maintained until six (6) months after the City has accepted the public improvements, such insurance as shall protect Contractor and the City for work covered by the Contract including workers’ compensation claims and property damage, bodily and personal injury which may arise from operations under this Contract, whether such operations are by Contractor, or anyone directly or indirectly employed by either of them. The minimum amounts of insurance shall be as follows: Commercial General Liability (or in combination with an umbrella policy) $2,000,000 Each Occurrence $2,000,000 Products/Completed Operations Aggregate $2,000,000 Annual Aggregate The following coverages shall be included: Premises and Operations Bodily Injury and Property Damage Personal and Advertising Injury Blanket Contractual Liability Products and Completed Operations Liability Automobile Liability $2,000,000 Combined Single Limit – Bodily Injury & Property Damage Including Owned, Hired & Non-Owned Automobiles Workers Compensation Page 323 of 445 225017v1 Workers’ Compensation insurance in accordance with the statutory requirements of the State of Minnesota, including Employer’s Liability with minimum limits are as follows: $500,000 – Bodily Injury by Disease per employee $500,000 – Bodily Injury by Disease aggregate $500,000 – Bodily Injury by Accident The Contractor’s insurance must be “Primary and Non-Contributory”. All insurance policies (or riders) required by this Contract shall be (i) taken out by and maintained with responsible insurance companies organized under the laws of one of the states of the United States and qualified to do business in the State of Minnesota, (ii) shall name the City, its employees and agents as additional insureds (CGL and umbrella only) by endorsement which shall be filed with the City. A copy of the endorsement must be submitted with the certificate of insurance. Contractor’s policies and Certificate of Insurance shall contain a provision that coverage afforded under the policies shall not be cancelled without at least thirty (30) days’ advanced written notice to the City, or ten (10) days’ notice for non-payment of premium. An Umbrella or Excess Liability insurance policy may be used to supplement Contractor’s policy limits on a follow-form basis to satisfy the full policy limits required by this Contract. 13. OWNERSHIP. All reports, plans, models, software, diagrams, analyses, and information generated in connection with performance of this Agreement shall be the property of the City. The City may use the information for its purposes. 14. COMPLIANCE WITH LAWS AND REGULATIONS. In providing services hereunder, Contractor shall abide by all statutes, ordinances, rules and regulations pertaining to the provisions of services to be provided. 15. STANDARD OF CARE. Contractor shall exercise the same degree of care, skill, and diligence in the performance of the services as is ordinarily possessed and exercised by a contractor under similar circumstances. No other warranty, expressed or implied, is included in this Agreement. City shall not be responsible for discovering deficiencies in the accuracy of Contractor’s services. 16. INDEPENDENT CONTRACTOR. The City hereby retains Contractor as an independent contractor upon the terms and conditions set forth in this Agreement. Contractor is not an employee of the City and is free to contract with other entities as provided herein. Contractor shall be responsible for selecting the means and methods of performing the work. Contractor shall furnish any and all supplies, equipment, and incidentals necessary for Contractor’s performance under this Agreement. City and Contractor agree that Contractor shall not at any time or in any manner represent that Contractor or any of Contractor's agents or employees are in any manner agents or employees of the City. Contractor shall be exclusively responsible under this Agreement for Contractor’s own FICA payments, workers compensation payments, unemployment compensation payments, withholding amounts, and/or self-employment taxes if any such payments, amounts, or taxes are required to be paid by law or regulation. 17. SUBCONTRACTORS. Contractor shall not enter into subcontracts for services provided under this Agreement without the express written consent of the City. Contractor shall comply with Minnesota Statutes § 471.425. Contractor must pay subcontractor for all undisputed services provided by subcontractor within ten (10) days of Contractor’s receipt of payment from City. Contractor must pay interest of one and five-tenths percent (1.5%) per month or any part of a month to subcontractor on any undisputed amount not paid on time to subcontractor. The minimum monthly interest penalty payment for an unpaid balance of One Hundred and no/100 Dollars ($100.00) or more is Ten and no/100 Dollars ($10.00). Page 324 of 445 225017v1 18. ASSIGNMENT. Neither party shall assign this Agreement, or any interest arising herein, without the written consent of the other party. 19. WAIVER. Any waiver by either party of a breach of any provisions of this Agreement shall not affect, in any respect, the validity of the remainder of this Agreement. 20. ENTIRE AGREEMENT. The entire agreement of the parties is contained herein. This Agreement supersedes all oral agreements and negotiations between the parties relating to the subject matter hereof, as well as any previous agreements presently in effect between the parties relating to the subject matter hereof. Any alterations, amendments, deletions, or waivers of the provisions of this Agreement shall be valid only when expressed in writing and duly signed by the parties, unless otherwise provided herein. 21. TERMINATION. This Agreement may be terminated by the City for any reason or for convenience upon written notice to the Contractor. In the event of termination, provided Contractor is not in default of the Contract, the City shall pay the Contractor for completed Work. Page 325 of 445 Page 326 of 445 225017v1 Exhibit A 2026 BUILDING AND FACILITIES LANDSCAPE MAINTENANCE CITY PROPERTY DESCRIPTIONS / LOCATIONS Building Locations: 1. Water Treatment Facility – 18400 Ipava Avenue / Well #10, 185th and Ipava Avenue 2. Heritage Center – 20110 Holyoke Avenue (Includes entire berm N of Heritage Center, S Heritage Drive boulevard between Holyoke Avenue and Holister Lane and S Holister Lane boulevard between intersections of Heritage Drive / Holister Lane going E to town-home property line). 3. Fire Station #1 – 20190 Holyoke Avenue 4. Fire Station #2 – 16720 Dodd Boulevard (Includes the round-a-bout located at Dodd Blvd. and Flagstaff Avenue and trail/sidewalk boulevards adjacent to the round-a-bout. 5. Fire Station #3 – 10775 175th Street (Includes 175th Street and Kenrick Avenue boulevards that surround storm water pond S of Fire Station #3 and sodded area around storm water pond). 6. Fire Station #4 – 9465 185th Street 7. Lakeville Liquors Galaxie – 16000 Galaxie Avenue (Includes berm on S side of liquor store that goes E-W from Valley Lake Park to church property site). Berm to be mowed weekly. 8. Lakeville Liquors Keokuk – 20880 Keokuk Avenue 9. City Hall – 20195 Holyoke Avenue (Includes the round-a-bout located at Holyoke Avenue and 202nd Street, the trail/sidewalk boulevards adjacent to the round-a-bout, the Electronic Reader board and City owned property in the southwest corner of this intersection. 10. Police Station – 9237 183rd Street 11. Heritage Library – 20085 Heritage Drive 12. FiRST Center- 7777 214th St W Page 327 of 445 225017v1 Facility Locations: A) Lift Stations / Grinders: 1. 10220 199th Street (Lift Station #4) 2. 19669 Jersey Avenue (Lift Station #5) 3. 18636 Lafayette Way (Lift Station #23) 4. 19100 Orchard Trail (Lift Station #6) – Does not include raingarden B) Wells: 5. Well #6 – Dakota Heights Tower – 17990 Jacquard Path 6. Well #7 – 20585 Kenrick Avenue 7. Well #8 – 18490 Italy Avenue 8. Well #9 – 10348 185th Street 9. Well #13 – Ipava Avenue / 175th Street 10. Well #15 – Ipava Avenue / 192nd Street 11. Well #16 – 190th Street / Ipava Avenue (New site in 2018 – spring start) 12. Wells #21 & #22 – SE corner Dodd Blvd and Highview Avenue 13. Booster Station #1- Northwest corner of Keokuk Ave and 215th Street 14. Well 23 south of 190th St between Iden Ave and Impala Ave C) Towers: 15. Old Valley Park Tower – 16929 Gerdine Path 16. Fairfield Tower – 11075 210th Street 17. Airlake Water Tower – Old Public Works / 7777 214th Street 18. Holyoke Water Tower – Holyoke Avenue / 190th Street 19. 179th St. Water Tower-179th St and Grandby LN Page 328 of 445 225017v1 Exhibit B 2026 BUILDING AND FACILITIES LANDSCAPE MAINTENANCE STANDARDS Section 1 – Spring Cleanup 1.1 Inspection of Area The Contractor shall inspect the areas and acquaint themselves with all locations, physical conditions and scope of work involved. 1.2 Scheduling Begin as soon as ground conditions and weather permits. Spring cleanup must be completed at all sites by May 15 of the current year. 1.3 Quality Indicators All landscape beds are to be vacuumed/swept/raked to clean up any leaves, litter or sand. All turf areas including boulevards are to be swept/vacuumed. Remove and properly dispose of all cleanup- related debris. Section 2 – Lawn Mowing 2.1 Inspection of Area The Contractor shall inspect the areas and acquaint themselves with all physical conditions involved. 2.2 Scheduling Cutting shall occur between the hours of 7:00 AM – 7:00 PM, Monday through Friday, and 8:00 AM – 5:00 PM, Saturday and Sunday. 2.3 Cutting Intervals All turf areas shall be mowed at a maximum of seven (7) day intervals. 2.4 Height of Cut All grass shall be kept cut to a minimum height of 2" and a maximum of 3". Mowers shall be sharp and adjusted to the specified cutting height at all times. Skips in mowing, streaking of lawns and dragged over grass without cutting will not be accepted. The Facilities Supervisor may change minimum and maximum grass heights. The City reserves the right to change the height of the cut with proper notification to the contractor. 2.5 Policing of Grounds Prior to mowing turf areas, all trash and debris including cans, rocks, bottles and papers will be removed and properly disposed of. 2.6 Cleaning of Walks and Pavements Clippings will not be discharged onto sidewalks or pavements. All walks and pavements will be swept or blown after mowing to remove and properly dispose of all grass clippings and debris. 2.7 Grass Clippings Page 329 of 445 225017v1 Grass clippings may remain on the turf, provided they are evenly disbursed. Any detectable clumping must be promptly bagged and properly disposed of. Section 3 – Edging, Weeding, Trimming and Pruning of Shrubs 3.1 Inspection of Area The Contractor shall inspect the area and acquaint themselves with all locations, physical conditions and scope of the work involved. 3.2 Edging and Weeding Edging is defined as clipping of vegetation growing adjacent to, horizontally over or through walks, sprinkler heads, driveways, curbs, parking lots, trees, shrub beds, utility poles, sign posts or any other place where required to present a neat, well-maintained appearance. Edging will occur a minimum of every other grass cutting. Edging the cultivated areas around trees, shrubs, mulch beds, walks and pavements will be required once per month. The grass shall be edged to a line parallel to, and not more than, one inch from the edge of the walks and pavement or curbing. 3.3 Weed Control Contractor will provide a minimum of three applications of herbicide treatments. The herbicide program shall consist of an application of pre-emergent weed control herbicide in May, an approved broadleaf weed control application in May – June, and a second broadleaf weed control application in August – September. Contractor may adjust application timing to be consistent with the herbicide label, weather conditions and plant growth. Reapplication at no additional cost will be required for unsatisfactory results. The designated City representative shall be notified a minimum of 24 hours prior to application of sites to be treated and product planned to be used. Contractor shall post sites with the appropriate signage indicating sites have been treated. 3.4 Trimming and Pruning Shrubs and ornamental trees less than 25’ in height shall be pruned a minimum of one time per year by a Certified Arborist or experienced personnel. All pruning shall be done in accordance with the ANSI A300 pruning standards. All pruning cuts shall be made with sharp tools. All debris shall be removed and disposed of properly. 1. Timing of Work: a. Oaks and elms are not to be pruned between April and October. If damaged branches must be removed during this time, wounds are to be immediately sealed with a latex based paint or shellac. b. Avoid pruning honeylocust, crabapples, hawthorns, cotoneaster during the growing season (April to October) to prevent fungal and bacterial infections. c. Evergreens are not to be pruned in the fall. d. Flowering shrubs should be pruned according to species, with spring flowering shrubs pruned after they have finished blooming, and summer blooming shrubs in the late winter or early spring. 2. Cane-growth habitat shrubs (examples include: Viburnum species like nannyberry/arrowwood, Spirea, Honeysuckle, dogwood, ninebark, etc.): Renewal pruning – every year remove up to one-third of the oldest, thickest stems, pruning them down to ground level. Cut back any remaining stems that look overgrown. Page 330 of 445 225017v1 Rejuvenation pruning – for overgrown shrubs, cut all stems or trunks, pruning them down to ground level in early spring. This type of pruning shall be done in early spring March/April before growth begins. 3. Tree-form shrubs and trees (examples include: Pagoda dogwood, Japanese treelilac, Nannyberry tree-form ): Natural pruning – prune branches to develop structure and improve plant health. Select central leader and prune out codominant branches using reduction cuts within a size range appropriate from the species and size plant. Prune out dead, damaged, diseased, crossing and/or crowded branches using proper pruning cuts. This type of pruning shall be done between November and March. 4. Evergreen or deciduous hedges or evergreen shrubs (yews and arborvitae): Shearing or pick-pruning – once hedges or evergreen shrubs reach the desired height and width, prune back every time it grows 6 to 8 inches. 5. All shrubs and trees shall be pruned to maintain specified clearance near trails/sidewalks, buildings, light poles, signs and over mowed/maintain grass unless inappropriate for the size, species and location of the plant. a. Trails/sidewalks – 10 feet of vertical clearance for trees at least 5 inches in diameter. 2- 3 feet of horizontal clearance for small trees and shrubs. b. Buildings and light poles – 3-4 feet of clearance for trees, 1-2 feet of clearance for shrubs. c. Signs – 2-3 feet of clearance d. Mowed/maintained grass - 8 feet of vertical clearance for trees at least 5 inches in diameter. Section 4 – Fertilization 4.1 Inspection of Area The Contractor shall inspect the areas to acquaint themselves with all physical conditions and the scope of work involved. 4.2 Fertilizing Fertilizer shall be applied twice during the growing season. Once in early spring, after the spring cleanup and prior to May 20. The fertilizer shall be a minimum of 25% slow release. A grade analysis of 20-0-20, 24-0-12, 30-0-15 or pre-approved equal shall be applied at a rate of 1.0 pound of nitrogen per 1,000 square feet. Fall application shall be applied between August 15 and September 30, and shall be a grade analysis of 20-0-20, 24-0-12 or pre-approved alternate with a minimum of 25% slow release, applied at a rate of 1.0-pound nitrogen per 1,000 square feet. Page 331 of 445 225017v1 Section 5 – Maintenance of Mulch/Rock Beds 5.1 Inspection of Area The Contractor shall inspect the areas to acquaint themselves with all physical conditions and the scope of work involved. Mulch/Rock beds regardless of there weed barrier condition will be maintained weed free. 5.2 A pre-emergent weed control shall be applied in early Spring to all maintained mulch/rock bed areas. The application shall consist of both a grass type and broadleaf type pre-emergent herbicide. Select pre-emergent least likely to damage the managed perennials, shrubs and trees on site. Avoid herbicide applications directly on or near managed perennials, shrubs and trees, especially newly planted and establishing vegetation. Owner can provide species lists for each site upon Contractor request. Contractor shall follow application with either manual weed removal or chemical weed control for any undesired vegetation. 5.3 Mulch/Rock beds when applied weed control is ineffective, must be handpicked to maintain weed free appearance. 5.4 All mulch/ rock beds and tree mulch rings shall be maintained weed, grass and debris free. Mulch beds shall be maintained at a 4-6” depth, with mulching material provided by the City. Mulch shall be kept 3-4” away from the base on tree trees so the root flare is exposed. Mulch beds shall be cultivated or “turned over” to scarify top “crust” when other maintenance is done on site. Section 6 – Litter Pickup and Sidewalk and Parking Lot Maintenance 6.1 Inspection of Area The Contractor shall inspect areas to acquaint themselves with all physical conditions and the scope of the work involved. 6.2 Litter Pickup In conjunction with the weekly turf maintenance program, all areas within the contract area including sidewalks, parking lots, shrub beds and turf areas shall be policed for litter and debris. 6.3 Sidewalk and Parking Lot Maintenance In conjunction with the weekly turf maintenance program, sidewalks and parking lots within the contract area shall be checked. Any gravel, stones, sand, dirt, broken glass or other debris shall be swept and properly disposed of. Weeds in cracks, sidewalks and parking lots shall be sprayed with Round-up (or approved equal) and then removed after product takes effect. Page 332 of 445 225017v1 Section 7 – Fall Cleanup 7.1 Inspection of Area The Contractor shall inspect areas shown on the map to acquaint themselves with all physical conditions and the scope of the work involved. 7.2 Scheduling To be completed between October 1 and November 1, weather permitting. All sites to be completed prior to first significant snowfall (sustained snow cover). 7.3 Quality Indicators All landscape beds and turf areas to be swept/blown/vacuumed clear of all leaves, litter, clippings and debris. Removal and proper disposal of clippings and waste is included. 7.4 Landscape Beds and Round- Abouts All landscape beds and roundabouts will have perennials, shrubs, grasses, and similar plantings trimmed as needed. Plants will be cut back to an appropriate length to ensure their health and prevent damage during the winter months. Section 8 – Irrigation System Operation, Maintenance and Repairs 1.1 The Contractor will be responsible for the cost of repairs for any damage to underground irrigation system (i.e. sprinkler heads) caused by the contractor’s mowers or weed whips. Repairs will be made promptly, and in consultation with the City of Lakeville Irrigation contractor. All repairs must meet the original design standards and use original manufacturer replacements. Heads in zones must have matched precipitation rates. 1.2 The Contractor should notify the city whenever a issue with the irrigation system may be present. (i.e. malfunctioning zone valves, broken sprinkler heads, suspected leaks in the system.) Section 9- Code Violation 9.1 Inspection and Verification The City will notify the contractor of properties in violation. Contractor shall confirm access to the property and assess lawn size, obstacles, and safety concerns prior to starting work. 9.2 Mowing Services Cut grass and weeds to comply with City ordinance requirements. Edge around driveways, sidewalks, and curbs as needed to present a neat appearance. Remove and properly dispose of grass clippings and debris; do not leave clippings on public sidewalks or streets. 9.3 Frequency Services are provided only when a property is cited for ordinance violation. Contractor will coordinate scheduling with the City’s Code Enforcement division. 9.4 Access and Safety Page 333 of 445 225017v1 Contractor shall take care to avoid damage to property, landscaping, irrigation systems, or structures. Contractor must follow all safety protocols and use appropriate equipment for each site. 9.5 Reporting Contractor shall provide a brief report after each property is serviced, including date, hours worked, and any additional observations (e.g., access issues or hazards). 9.6 Pricing Contractor will provide services at a rate of $___ per hour, including labor, equipment, and disposal of debris. Any additional charges (e.g., excessive brush, shrubs, or obstacles requiring special attention) must be pre-approved by the City. Page 334 of 445 Exhibit C Page 335 of 445 Page 336 of 445 Page 337 of 445 Page 338 of 445 Page 339 of 445 Contractor Name Building Sites Total Price Facility Sites Total Price Total Price Code Violation/ HR Proposal Form Filled Correctly Past Experience Notes Gonzo Bros Landscaping $63,630.00 $48,365.00 $111,995.00 $90.00 Yes Yes Lakeville Lawn Care and Snow Removal $67,095.00 $28,977.00 $96,072.00 $125.00 Yes Yes Jeff Reisinger Lawnservice Inc $91,565.00 $39,105.00 $130,670.00 $95.00 Yes yes Von Bank Lawn Care Inc $77,850.00 $34,000.00 $111,850.00 $100.00 Yes yes City of Lakeville — 2026 Lawn Care Maintenance Bid Tabulation Page 340 of 445 Date: 3/16/2026 Authorization to Participate in Six Remnant Defendant Opioid Settlement Proposed Action Staff recommends adoption of the following motion: Move to authorize staff to sign any appropriate documents to enter into the Six Remnant Defendant Opioid Settlement. Overview The City of Lakeville, like many other cities, has entered into several settlement agreements related to the opioid crisis. Manufacturers of opioids have agreed to settlement terms with various attorneys general that dictate the terms of the agreements and have resulted in monetary damages being paid to cities. The City of Lakeville has used the funds in accordance with the terms and conditions spelled out in the agreements. Staff was recently notified of the City's eligibility in a new settlement titled the Six Remant Defendant agreement. While the dollar amount has yet to be determined, the uses of the funds will be similar to previous agreements. Supporting Information 1. Six Remnant Defendants Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Safety Throughout the Community Report Completed by: Justin Miller, City Administrator Page 341 of 445 Page 342 of 445 Page 343 of 445 Page 344 of 445 Page 345 of 445 Page 346 of 445 Page 347 of 445 Date: 3/16/2026 Dodd Commons Preliminary Plat Proposed Action Staff recommends adoption of the following motion: Move to approve: 1) the preliminary plat of Dodd Commons, 2) a conditional use permit for a building in excess of 35 feet in height in the C-3, General Commercial District, 3) vacation of public right of way and roadway, drainage, and utility easements, and 4) adopt findings of fact. Overview The City of Lakeville has prepared plans for a preliminary plat for Dodd Commons, which proposes one lot for the construction of a new fire station and three outlots on 23.36 acres located north of 179th Street (CSAH 9), south of Dodd Boulevard, and east of Granby Lane. Also requested is approval of a conditional use permit for a building in excess of 35 feet within the C-3, General Commercial District and the vacation of road right of way and roadway, drainage, and utility easements. The Planning Commission held a public hearing on these items at its March 5, 2026 meeting. There was one public comment asking about how emergency vehicles would safely access 179th Street given the volume and speed of traffic on that roadway and a response was provided by City Staff. The Planning Commission voted unanimously to approve the preliminary plat, conditional use permit, and right of way/easement vacations, and subject to one stipulation and approval of the findings of fact. Supporting Information 1. Preliminary Plat Resolution 2. CUP Form and findings of fact 3. Vacation Resolution 4. March 5, 2026 Planning Commission draft meeting minutes 5. February 23, 2026 Planning & Engineering Reports 6. Exhibits A-J 7. Exhibits K-M 8. Exhibits N-O Financial Impact: $0 Budgeted: No Source: Envision Lakeville Community Values: Safety Throughout the Community Report Completed by: Kris Jenson, Planning Manager Page 348 of 445 CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 26-____ RESOLUTION APPROVING THE PRELIMINARY PLAT OF DODD COMMONS WHEREAS, the City of Lakeville has requested preliminary plat approval of one lot and three outlots to be known as Dodd Commons, legally described in Exhibit A; and WHEREAS, the Planning Commission held a public hearing at its March 53, 2026 meeting, preceded by notice as required by the Subdivision Ordinance; and WHEREAS, the Planning Commission recommended approval of the preliminary plat; and WHEREAS, the preliminary plat meets Subdivision Ordinance requirements and is acceptable to the City; NOW, THEREFORE, BE IT RESOLVED by the Lakeville City Council: The Dodd Commons preliminary plat is hereby approved subject to the following conditions: 1. Implementation of the recommendations listed in the February 23, 2026 engineering report. ADOPTED by the Lakeville City Council this 16th day of March 2026. CITY OF LAKEVILLE BY: _______________________ Luke M. Hellier, Mayor ATTEST: BY: ________________________ Ann Orlofsky, City Clerk Page 349 of 445 EXHIBIT A That part of the Northeast Quarter of the Southeast Quarter of Section 9, Township 114 North, Range 20 West, Dakota County, Minnesota, lying and being south of Dodd Boulevard as originally constructed according to Dakota County Road Right of Way Map No. 67. Excepting therefrom that part of the Northeast Quarter of the Southeast Quarter of said Section 9 described as follows: Beginning at the Northeast corner of the Northeast Quarter of the Southeast Quarter of said Section 9, said point being in the center of Dodd Boulevard as originally constructed; thence Southerly on the east line of said Northeast Quarter of the Southeast Quarter a distance of 1304.36 feet to the north line of the south 12.00 feet of said Northeast Quarter of the Southeast Quarter; thence westerly on the north line of said south 12.00 feet of the Northeast Quarter of the Southeast Quarter a distance of 554.00 feet; thence Northerly, parallel with the East line of said Northeast Quarter of the Southeast Quarter a distance of 910.63 feet to the original centerline of Dodd Boulevard according to Dakota County Road Right of Way Map No. 67; thence Northeasterly on the original centerline of said Dodd Boulevard according to said Map No. 67, a distance of 674.82 feet to the point of beginning. Excepting that part conveyed in Document Numbers 1624609 and1624610 lying North of Dodd Road. Further excepting the south 12 feet of the east 554.00 feet of the NE 1/4 of the SE 1/4 of Section 9, Township 114 North, Range 20 West, Dakota County, Minnesota. The said 554.00 feet being measured in a line parallel with the south line of said NE 1/4 of the SE 1/4 and conveyed in Document Number 1221220. AND Outlot G, Summers Creek, Dakota County, Minnesota. AND That part of the Southeast Quarter of the Southeast Quarter of Section 9, Township 114, Range 20, lying northerly of the southerly line of DAKOTA COUNTY RIGHT OF WAY MAP NO. 490, on file and of record in the office of the County Recorder, all in Dakota County, Minnesota. Page 350 of 445 1 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA CONDITIONAL USE PERMIT NO. 26-___ 1. Permit. Subject to the terms and conditions set forth herein, the City of Lakeville approves a conditional use permit to allow construction of a building in excess of 35 feet in height in the C-3, General Commercial District. 2. Property. The permit is for the following described property located south of Dodd Boulevard and east of Granby Lane in the City of Lakeville, Dakota County, Minnesota and will be platted as: Lot 1, Block 1, Dodd Commons 3. Conditions. This conditional use permit is issued subject to the following conditions: a. Implementation of the recommendations listed in the February 23, 2026, engineering report. 4. Revocation. The City may revoke the conditional use permit for cause upon determination that the conditional use permit is not in conformance with the conditions of the permit or is in continued violation of the city code or other applicable regulations. 5. Expiration. This conditional use permit shall expire unless the applicant commences construction of the authorized use within one year of the date of this conditional use permit unless an extension is approved by the Zoning Administrator. Dated: March 16, 2026 Page 351 of 445 2 BY: ________________________ Luke M. Hellier, Mayor BY:________________________ Ann Orlofsky, City Clerk SEAL STATE OF MINNESOTA ) ( COUNTY OF DAKOTA ) The foregoing instrument was acknowledged before me this 16th day of March 2026 by Luke M. Hellier, Mayor and by Ann Orlofsky, City Clerk of the City of Lakeville, a Minnesota municipal corporation, on behalf of the corporation. __________________________ Notary Public DRAFTED BY: City of Lakeville 20195 Holyoke Avenue Lakeville, MN 55044 Page 352 of 445 1 CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA CITY OF LAKEVILLE CONDITIONAL USE PERMIT FINDINGS OF FACT AND DECISION On March 5, 2026 the Lakeville Planning Commission met at its regularly scheduled meeting to consider the application of the City of Lakeville for a conditional use permit for a building in excess of 35 feet in height within the C-3, General Commercial District. The Planning Commission conducted a public hearing on the proposed conditional use permits preceded by published and mailed notice. The applicant was present and the Planning Commission heard testimony from all interested persons wishing to speak. The City Council hereby adopts the following: FINDINGS OF FACT 1. The property is located in Planning District No. 5 of the 2040 Comprehensive Land Use Plan, which guides the property for commercial and public and quasi-public land use. 2. The property is zoned C-3, General Commercial District. 3. The legal description of the property at the time of final plat will be: Lot 1, Block 1, Dodd Commons 4. Section 11-4-3E of the City of Lakeville Zoning Ordinance provides that a conditional use permit may not be issued unless certain criteria are satisfied. The criteria and our findings regarding them are: a. The proposed action has been considered in relation to the specific policies and provisions of and has been found to be consistent with the official City Comprehensive Plan. Finding: The fire station use of the property is consistent with the 2040 Comprehensive Land Use Plan and District 5 recommendations of the Comprehensive Plan. b. The proposed use is or will be compatible with present and future land uses of the area. Page 353 of 445 2 Finding: The fire station and adjacent commercial-zoned parcels are compatible with existing land uses in the area given compliance with the stipulations listed in the February 23, 2026 planning and engineering reports. c. The proposed use conforms with all performance standards contained in the Zoning Ordinance. Finding: Provided compliance with the additional setbacks indicated on the site plan, the additional building height of the fire station will conform to all performance standards contained in the Zoning Ordinance. d. The proposed use can be accommodated with existing public services and will not overburden the City’s service capacity. Finding: The subject property is within the existing MUSA and is served with city sanitary sewer and water. The fire station will not have a negative impact on the City’s service capacity. e. Traffic generation by the proposed use is within capabilities of streets serving the property. Finding: The fire station use on a single parcel will not overburden the streets serving the property and the additional building height will not increase the traffic generated by the proposed use. 5. The planning report dated February 23, 2026 prepared by Kris Jenson, Planning Manager is incorporated herein. DECISION The City Council hereby approves the conditional use permit in the form attached thereto. DATED: March 16, 2026 CITY OF LAKEVILLE BY:______________________ Luke M. Hellier, Mayor By:________________________ Ann Orlofsky, City Clerk Page 354 of 445 (Reserved for Dakota County Recording Information) CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 26- _______ RESOLUTION VACATING A PUBLIC STREET AND ROADWAY, DRAINAGE, AND UTILITY EASEMENTS WHEREAS, the City Council has conducted a public hearing, preceded by two (2) weeks published notice, to consider the following described public street, drainage and utility easement vacation, and WHEREAS, the City Council has determined that it is in the public interest to approve the public street and roadway, drainage and utility easements vacation. NOW, THEREFORE, BE IT RESOLVED by the Lakeville City Council: 1. The public street, roadway, drainage, and utility easements described in Exhibit A are hereby vacated. 2. The City Clerk is directed to file a certified copy of this resolution with the Dakota County Recorder. ADOPTED by the Lakeville City Council this 16th day of March 2026. Page 355 of 445 CITY OF LAKEVILLE ________________________ Luke M. Hellier, Mayor ATTEST: ________________________ Ann Orlofsky, City Clerk STATE OF MINNESOTA ) ( CITY OF LAKEVILLE ) I hereby certify that the foregoing Resolution No. 26-_____ is a true and correct copy of the resolution presented to and adopted by the City Council of the City of Lakeville at a duly authorized meeting thereof held on the 16th day of March 2026, as shown by the minutes of said meeting in my possession. ________________________ Ann Orlofsky, City Clerk (SEAL) Page 356 of 445 EXHIBIT A Legal descriptions of the easement areas highlighted on this exhibit will be prepared and attached prior to the recording of this resolution. Page 357 of 445 Planning Commission Meeting Minutes, March 5, 2026 Page 3 5. Outlots A and C shall be deeded to the City for stormwater management purposes with the final plat. 6. Park dedication requirements shall be satisfied at the time of final plat approval based on the fee schedule then in effect. 7. The preliminary plat shall be valid for one year from the date of City Council approval unless extended as provided for by the Subdivision Ordinance and Zoning Ordinance. 8. Landscaping shall be installed in accordance with the approved landscape plan, subject to review and approval of the City Forester. 9. The Developer shall provide a security in an amount determined by the City Forester with the final plat to guarantee installation of the landscaping and prior to a final landscape inspection by the City Forester, an as-built landscape plan must be submitted to the city. 10. Any signs installed upon the property shall comply with Chapter 23 of the Zoning Ordinance and shall require a sign permit approved by the Zoning Administrator prior to placement. 11. Applicant shall enter into a Development Contract and related agreements with the City subject to review by the City Attorney and approval of the City council prior to approval of a final plat. Ayes: Traffas, Kaluza, Zimmer, Einck, Swaney, Swenson, Tinsley Nays: 0 5b. Dodd Commons Chair Zimmer opened the public hearing to consider the application of the City of Lakeville for a preliminary plat, conditional use permit for a building in excess of 35 feet in height in the C-3, General Commercial District, and the vacation of existing public roadway, drainage, and utility easements. Assistant City Administrator Allyn Kuennen introduced the project and presented a background and overview of the proposed project. Mr. Kuennen introduced Fire Chief Mike Meyer and District Chief Brian Jacobson. Ms. Jenson presented the staff report. The Dodd Commons plat includes the construction of a new fire station to replace and combine Fire Station 2 and Fire Station 4. The proposed site is 23.36 acres and is located north of 179th Street (CSAH 9), south of Dodd Boulevard, and east of Granby Lane. The property is zoned C-3, General Commercial District and P/OS, Public and Open Space. Lot 1, Block 1 is for the fire station, Outlot A is for the stormwater pond, Outlot B is the water tower site and the remainder of the site is Outlot C which will be available for future development. Page 358 of 445 Planning Commission Meeting Minutes, March 5, 2026 Page 4 Community Development Department staff recommend approval of the Dodd Commons preliminary plat, conditional use permit, and vacation of public roadway, drainage, and utility easements. Chair Zimmer opened the hearing to the public for comment. Kathleen Fitzpatrick, 17810 Graphite Lane, asked about fire truck access to 179th Street, as traffic on 179th Street is dangerous and problematic. Motion was made by Einck, seconded by Swaney to close the public hearing at 6:43 p.m. Voice vote was taken on the motion. Ayes – unanimous Mr. Nelson stated that the City is working with Dakota County at the intersection of Granby Lane and 179th Street on what the vehicle pre-emption should look like with this fire station being constructed. The specifics of the system have not yet been determined, but City staff are looking at other examples, such as in Eagan, where they have a similar situation and layout by a county road. Regarding the intersection of Cedar Avenue and Glacier Way, Mr. Nelson stated they are discussing alternatives for getting onto Cedar Avenue with Dakota County, who has jurisdiction over the road. Mr. Kuennen stated the Opticon system is the technical term for the system that the fire station will be using. He explained how the system will connect activity at the fire station to trigger the signal at 179th Street and Cedar Avenue to change to all red lights to provide a gap in traffic for the engines to turn onto 179th Street. Mr. Nelson added that within the next few months the proposed system should begin to take shape. Chair Zimmer asked for comments from the Planning Commission. • Commissioner Traffas asked if the traffic system is not in place because it is currently at the preliminary plat stage. Ms. Jenson stated the traffic system to allow the fire trucks onto the roads doesn’t need to be in place until the fire station is fully built. • Commissioner Swaney asked if the architect for the Lakeville fire station is the same architect the fire stations in Burnsville and Apple Valley used. Mr. Kuennen stated C & H is the same architect. Commissioner Swaney asked how this fire station compares to those. Fire Chief Mike Meyer stated Lakeville’s fire station is similar to Burnsville, however there are other pieces brought in from other stations that were toured. • Commissioner Swenson stated he appreciated seeing where the generator boxes are located for cases of natural disasters. He also stated his appreciation for the truck turning abilities and the overall safety culture. He asked for clarification of what the training towers would be used for. Chief Meyer stated the training towers will be used for fire hose movement and water discharge, and that there will be no burning in the building. Commissioner Swenson stated he appreciated the concern expressed regarding the traffic in this area. He stated the Planning Commission is not able to act on these concerns, the county needs to be involved, however the concerns have been heard by city staff. Page 359 of 445 Planning Commission Meeting Minutes, March 5, 2026 Page 5 • Commissioner Kaluza expressed support for the city staff and the work put into this project planning for the future. Motion was made by Tinsley, seconded by Swenson to recommend to City Council approval of the Dodd Commons preliminary plat, conditional use permit, and vacation of public roadway, drainage, and utility easements and the findings of fact, subject to the following stipulation: 1. Implementation of the recommendations listed in the February 23, 2026 engineering report. Ayes: Kaluza, Zimmer, Einck, Swaney, Swenson, Tinsley, Traffas, Nays: 0 There being no further business, the meeting was adjourned at 6:58 p.m. Respectfully submitted, Dawn Erickson, Community Development Recorder Page 360 of 445 1 City of Lakeville Community Development Memorandum To: Planning Commission From: Kris Jenson, Planning Manager Date: February 23, 2026 Subject: Packet Material for the March 5, 2026 Planning Commission Meeting Agenda Item: 1. Preliminary plat of one lot to be known as Dodd Commons; 2. Conditional use permit for a building in excess of 35 feet in height in the C-3, General Commercial District. 3. Vacation of public roadway, drainage, and utility easements. BACKGROUND The City of Lakeville is constructing a new fire station to replace and combine Fire Station 2 and Fire Station 4. In order to do so, the site requires a preliminary plat, conditional use permit for a building in excess of 35 feet in height in the C-3, General Commercial District, and the vacation of existing public roadway, drainage, and utility easements. The proposed site is 23.36 acres and is located north of 179th Street (CSAH 9), south of Dodd Bulevard, and east of Granby Lane. The preliminary plat and development plans have been submitted to the Engineering Division and Parks and Recreation Department for review. EXHIBITS A. Location Map B. Zoning Map C. Certificate of Survey D. Right of Way and Easement Vacations E. Preliminary Plat F. Final Plat G. Site Plan Page 361 of 445 2 H. Grading Plan I. Utility Plan J. Photometric Plan K. Tree Inventory & Replacement Plan (3 pages) L. Landscape Plan M. Floor Plans (2 pages) N. Exterior Elevations (2 pages) O. Plat Commission Letter dated February 13, 2026 PLANNING ANALYSIS PRELIMINARY PLAT Comprehensive Plan. The property is located in Planning District No. 5 of the 2040 Comprehensive Land Use Plan and is within the current Metropolitan Urban Service Area (MUSA). City municipal services, including sanitary sewer service, are available to serve the property. The subject property is guided C, Commercial and P/QP, Public & Quasi-Public in the 2040 Comprehensive Land Use Plan. The proposed Dodd Commons preliminary plat meets the recommended goals and objectives outlined in Planning District No. 5 of the 2040 Comprehensive Plan. Zoning and Surrounding Uses. The subject property is zoned C-3, General Commercial District and P/OS, Public and Open Space. The proposed preliminary plat is surrounded by the following land uses: Direction Existing Use Land Use Plan Zoning North Dodd Blvd, Springs of Lakeville townhomes Corridor Mixed Use Planned Unit Development South Central Maintenance Facility Public/Quasi-Public Public & Open Space East Commercial development Commercial, Public/Quasi-Public C-3, Gen. Comm., Public & Open Space West Granby Lane, detached townhomes Medium Density Residential RM-1, Med. Dens. Residential District Lots and Blocks. The proposed lot exceeds the minimum lot area and lot width requirements of the C-3 District. Page 362 of 445 3 Minimum Proposed Lot Area 20,000 Square Feet 163,424 square feet Lot Width Requirements 100 feet 355 feet Premature Subdivision Criteria. The preliminary plat is not premature under the terms of the Subdivision Ordinance. All utilities and public streets are in place to serve the subject property. Capital Improvement Program (CIP). All proposed improvements necessary for the development of Dodd Commons are included in the 2026-2030 Capital Improvement Plan. Streets. Dodd Commons is adjacent to or includes construction of the following streets: 179th Street (CSAH 9) is a minor arterial roadway as identified in the City’s Comprehensive Transportation Plan. The street was constructed in 2023 as a Dakota County project. The City is dedicating the full 150-foot width of right of way across the southern plat boundary, which is an area of 4.31 acres. Access to 179th Street is not permitted from the Dodd Commons plat. Cedar Avenue (CSAH 23) is a principal arterial roadway in the City’s Comprehensive Transportation Plan. The City is dedicating 0.47 acres of right of way along the east plat boundary. Dodd Boulevard is located along the north plat boundary and is a major collector roadway. This segment of the street was reconstructed in 2023 as a two-lane roadway with a trail along the north side of the street. The Dodd Commons plat will dedicate 1.17 acres for the south half of Dodd Boulevard right of way. Granby Lane is a two-lane local street that was constructed in 2023 as part of the 179th Street construction project. There are trails constructed along both sides of the street and an access to the fire station parcel is proposed to Granby Lane. The Dakota County Plat Commission met at its February 11, 2026 meeting to review the Dodd Commons preliminary and final plat and recommended approval. Outlots. There are three outlots in the Dodd Commons preliminary plat, all of which will be retained by the City. Outlot A is 1.40 acres and will contain a stormwater pond. Outlot B is 1.69 acres and is the site of the water tower. Page 363 of 445 4 Outlot C is 9.67 acres and will be available for future development. Grading, Drainage, Erosion Control and Utilities. City sanitary sewer and water is currently available to the site, which is within the current MUSA. Grading, drainage, erosion control, utility, plans were submitted with the preliminary plat plans and are reviewed in the engineering report prepared by Grace Ellis, Graduate Engineer and Mac Cafferty, Environmental Resources Manager, dated February 23, 2026. A copy of the engineering report is attached for reference. Park Dedication. Park dedication will be collected when Outlot C is platted into lots and blocks. Wetlands. A wetland delineation was completed for the site and no wetlands were found to be within the plat boundary. Tree Preservation. The tree preservation plan identifies 1,508 inches of significant trees within the limit of disturbance on the site, all of which are proposed to be removed. The Zoning Ordinance permits up to 70% of that total to be removed (1,055.6 inches). See the February 23, 2026 Engineering report for additional information. Right of Way and Easement Vacation. There is previously-dedicated right of way for Granby Lane as well as several easements for roadway, drainage, and utility purposes on the parent parcels. Exhibit D highlights what is proposed to be vacated within the plat boundary. The areas being vacated will either be replaced with dedicated right of way or easements, as needed. CONDITIONAL USE PERMIT: CONSTRUCTION OF A PRINCIPAL BUILDING IN EXCESS OF 35 FEET IN HEIGHT. Principal buildings within the C-3 District are limited to a height of three stories or 35 feet, whichever is less. The fire station has one and two story sections, ranging in height from just under 19 feet in height to about 42 feet at the training tower. Screening of the rooftop mechanical equipment also brings the height to about 42 feet in some areas. Section 11-17-7.E of the Zoning Ordinance states that building heights in excess of the standards established within the individual zoning districts may be allowed through a CUP provided that the intensity of use, traffic impacts, public utilities, setbacks, airport zoning regulations, and the general performance standards of Section 11-4-7 for all CUPs are considered. Intensity of the use, traffic impacts, public utilities, and performance standards are addressed below. Section 11-17-7.E also requires that for each additional 10 feet above the maximum building height allowed within the C-3 District, the front and side Page 364 of 445 5 yard setbacks are increased by five feet. The table below reflects the required 30 foot setback of the C-3 District plus the additional five feet required for the front and side yard setbacks due to the additional building height. The locations of the proposed fire station within the lot meets or exceeds the minimum setbacks required by the Zoning Ordinance. Front (North) Rear (South) Side (West) Side (East) Required 35 feet. 30 feet. 35 feet. 35 feet Proposed 100+ feet. 30 feet. 75+ feet. 75+ feet The CUP performance standards to allow additional building height are listed below: A. The use and the site in question shall be served by a street of sufficient capacity to accommodate the type and volume of traffic which would be generated and adequate right of way shall be provided. The site has access to and from Dodd Boulevard, a major collector street as well as Street A and Granby Lane, both of which are local streets. These streets are of sufficient capacity to serve the Dodd Commons plat and Fire Station Number 2. B. The site design for access and parking shall minimize internal as well as external traffic conflicts and shall be in compliance with chapter 19 of this title. The site will have access from Dodd Boulevard and Street A, both of which will provide access to the two parking areas. Fire truck access will be via Street A and Granby Lane. C. If applicable, a pedestrian circulation system shall be clearly defined and appropriate provisions made to protect such areas from encroachment by parked or moving vehicles. A trail currently exists along the east side of Granby Lane and one will be constructed along the south side of Dodd Boulevard, from Granby Lane to the east plat boundary. A sidewalk will be added along the east side of Street A for a distance of about 150 feet, before crossing the street and continuing towards the front entrance. The parking lot access from Street A was shifted south so that the sidewalk in that area is in compliance with accessibility requirements for maximum grade. D. Adequate off-street parking and off-street loading shall be provided in compliance with chapters 19 and 20 of this title. The primary parking lot of 42 spaces is on the north side of the building, with a smaller lot of 10 spaces on the south side of the building. Additionally, 17 spaces are proposed along the east side of the vehicle bays, for a total of 69 parking spaces on site. The Zoning Ordinance doesn’t specify parking requirements for fire stations, so the parking requirements are based on the various uses within the building, as indicated in the table below. Page 365 of 445 6 Use Area/Size Parking Req. Minimum Spaces Required Office 4,835 SF 1/250 SF 19 spaces Classroom 94 seats 1/3 seats 31 spaces Dorms 10 rooms 1/unit + 1 for every 10 units 11 spaces 61 spaces The table above does not account for all areas within the building, including a fitness area, firefighter workroom/dispatch, kitchen, dining and dayroom, and firefighter training tower. Staff determined that these areas are all intended to be utilized by firefighters on duty, for which parking is already accounted for via the dorm room calculation. The initial duty crews are expected to have seven crewmembers. All parking spaces measure at least nine feet wide by 20 feet deep with drive aisles of 24 feet in width, which meets Zoning Ordinance requirements. E. Loading areas and drive-up facilities shall be positioned so as to minimize internal site access problems and maneuvering conflicts, to avoid visual or noise impacts on any "adjacent" residential use or district, and provided in compliance with chapter 20 of this title. This standard does not apply to the Dodd Commons development. F. Whenever a nonresidential use "is adjacent to" a residential use or district, a buffer area with screening and landscaping shall be provided in compliance with chapter 21 of this title. This standard does not apply to the Dodd Commons plat. G. General site screening and landscaping shall be provided in compliance with chapter 21 of this title. The landscape plan includes 98 ornamental, deciduous, and evergreen trees proposed to be planted on Lot 1 and Outlot A. Trees are proposed at the perimeter of Lot 1 in every area except for the access drives. Over 350 shrubs are proposed to be planted as foundation plantings along the north portion of the building, around the trash enclosure, as well as in the space between the parking lots and the adjacent street. The remainder of the site that is sodded will include inground irrigation. H. All exterior lighting shall be so directed so as not to cast glare toward or onto the public right of way or neighboring residential uses or districts, and shall be in compliance with section 11-16-17 of this title. A photometric plan has been submitted that demonstrates that light levels on site meet the Zoning Ordinance requirements of not exceeding one foot candle at a property line Page 366 of 445 7 adjacent to public right of way. All building lighting is a downcast style and parking lot lighting is proposed to be 30 feet in height, in compliance with Zoning Ordinance requirements. I. Potential exterior noise generated by the use shall be identified and mitigation measures as may be necessary shall be imposed to ensure compliance with section 11-16-25 of this title. All rooftop mechanical equipment is proposed to be screened in compliance with Zoning Ordinance requirements. J. The site drainage system shall be subject to the review and approval of the city engineer. See the February 23, 2026 Engineering report for more information. K. The architectural appearance and functional design of the building and site shall not be so dissimilar to the existing or potential buildings and area so as to cause a blighting influence. All sides of the principal and accessory structures are to have essentially the same or coordinated, harmonious exterior finish materials and treatment. The exterior materials are primarily brick, cast stone, glass (all Grade A), and composite wall panels (stone or wood look, Grade C). The overall building is approximately 68% Grade A materials, in compliance with Zoning Ordinance requirements. The building proposes various shades of gray and brown with red accents, as shown in the L. Provisions shall be made for daily litter control, an interior location for recycling, and trash handling and storage or an outdoor, enclosed receptacle area shall be provided in compliance with section 11-18-11 of this title. A trash enclosure structure is proposed for the southeast side of the site. The structure must have exterior materials that are consistent with the principal structure, have a maintenance-free gate, and be a height of at least six feet tall. M. All signs and informational or visual communication devices shall be in compliance with chapter 23 of this title. At this time, no freestanding signs are proposed on site. Building elevation plans show several wall signs, for which a sign permit must be issued prior to installation. N. The use and site shall be in compliance with any federal, state or county law or regulation that is applicable and any related permits shall be obtained and documented to the city. This standard does not apply to the Dodd Commons development. O. Any applicable business licenses mandated by this code are approved and obtained. This standard does not apply to the Dodd Commons development. P. The hours of operation may be restricted when there is judged to be an incompatibility with a residential use or district. Not applicable. Q. The use complies with all applicable performance standards of the zoning district in which it is located and where applicable. Provided the site is Page 367 of 445 8 developed in compliance with the stipulations of this report, the use will be in compliance with all applicable performance standards. Findings of Fact in consideration of the conditional use permit is attached. RECOMMENDATION Community Development Department staff recommends approval of the preliminary plat, conditional use permit, and vacation of public roadway, drainage, and utility easements for the Dodd Commons plat, subject to the following stipulations: 1. Implementation of the recommendations listed in the February 23, 2026 engineering report. Page 368 of 445 City of Lakeville Public Works – Engineering Division Memorandum To: Kris Jenson, Planning Manager From: Grace Ellis, Graduate Engineer McKenzie L. Cafferty, Environmental Resources Manager Joe Masiarchin, Parks and Recreation Director Copy: Zach Johnson, City Engineer Tina Goodroad, Community Development Director Julie Stahl, Finance Director Dave Mathews, Building Official Date: February 23, 2026 Subject: Dodd Commons • Preliminary Plat • Preliminary Utility Plan • Preliminary Grading and Erosion Control Plan • Preliminary Tree Preservation and Landscaping Plan BACKGROUND The City of Lakeville submitted a preliminary plat to be known as Dodd Commons for property located north of and adjacent to 179th Street (CSAH 9), west of and adjacent to Cedar Avenue (CSAH 23), south of and adjacent to Dodd Boulevard, and east of and adjacent to Granby Lane. The parent parcels consist of two metes and bounds parcels (PID Nos. 22-73370-00-070 and 22- 00900-79-011) and Outlot G, Summers Creek. The parcel that will be created after the split from Central Maintenance Facility is zoned Public & Open Space (P/OS). The remaining parcels are zoned C-3, General Commercial District. The preliminary plat consists of one (1) lot and three (3) outlots on approximately 23.36 acres. Lot 1 is proposed for a future fire station site. The City is dedicating 4.31 acres for 179th Street right-of-way (CSAH 9) and 0.47 acres for Cedar Avenue (CSAH 23) right-of-way. The outlots created with the preliminary plat shall have the following use: Page 369 of 445 DODD COMMONS – PRELIMINARY PLAT FEBRUARY 23, 2026 PAGE 2 OF 7 Outlot A: Stormwater management; to be retained by the City (1.40 acres) Outlot B: Existing water tower site; to be retained by the City (1.69 acres) Outlot C: Future development area; to be retained by the City (9.67 acres) The development will be completed by: Developer: City of Lakeville Engineer/Surveyor: Larson Engineering/Bolton & Menk SITE CONDITIONS The Dodd Commons site consists of undeveloped land. The site consists primarily of undeveloped land characterized by varying topography that generally drains from north to south. The majority of the site was a farmstead, while the southerly portion contains an existing municipal water tower. All structures, accessory buildings, driveways, foundations, septic system components, wells and related improvements have been removed in accordance with an approved abatement and demolition project (City Project No. 25-18). Demolition was substantially completed in November 2025. EASEMENTS & EASEMENT VACATIONS The parent parcels contain the following existing easements that will be vacated and reestablished with the final plat. • Drainage and Utility easements; in favor of the City of Lakeville (Summers Creek plat). • Roadway, Drainage and Utility easement; in favor of the City of Lakeville (Doc. No. 1663539). • Roadway, Drainage and Utility easement; in favor of the City of Lakeville (Doc. No. 1663540). STREET AND SUBDIVISION LAYOUT 179th Street (CSAH 9) Dodd Commons is located north of and adjacent to 179th Street (CSAH 9), a Dakota County highway classified as a minor arterial. The 2022 Dakota County Plat Needs Map (rev. 10-27-22) identifies a half right-of-way need of 75 feet. The City is dedicating 6.40 acres for right-of-way over the area currently encumbered by an easement. The Dakota County Plat Commission recommend approval of the preliminary plat on February 12, 2026. 179th Street is a four-lane divided urban highway that was constructed by the County in 2023 (City Project 23-04) in partnership with the City. There is no planned access to 179th Street and there are no construction improvements proposed with the plat. Page 370 of 445 DODD COMMONS – PRELIMINARY PLAT FEBRUARY 23, 2026 PAGE 3 OF 7 Cedar Avenue (CSAH 23) Dodd Commons is located west of and adjacent to Cedar Avenue (CSAH 23), a Dakota County highway classified as a principal arterial. The 2022 Dakota County Plat Needs Map (rev. 10-27- 22) Identifies a half right-of-way need of 100 feet. The City is dedicating 0.47 acres for right-of- way over the area currently encumbered by an easement. The Dakota County Plat Commission recommend approval of the preliminary plat on February 12, 2026. Cedar Avenue is a four-lane divided urban highway. There is no planned access to Cedar Avenue and there is no construction improvements proposed with the plat. The plat east of and adjacent to the Dodd Commons (Double E Crossings), includes temporary right-in/right-out access to CSAH 23. This access will be removed upon the occurrence of any of the following: • When access is provided to the site from a connection to 179th Street (CSAH 9). • If development of the adjacent parcel to the west occurs without connection to the 179th Street alignment. • At the direction of the Dakota County Board of Commissioners when traffic or safety conditions warrant. Connection to the access will be addressed when Outlot C develops into lots and blocks. Local Roads (Dodd Boulevard and Granby Lane) Dodd Commons is located south of and adjacent to Dodd Boulevard, a City roadway classified as a major collector. Dodd Boulevard is a two-lane divided urban highway that was constructed by the County in 2023 (City Project 23-04) in partnership with the City. There are two planned accesses to Dodd Boulevard, but no other construction improvements proposed with the plat. Dodd Commons is located east of and adjacent to Granby Lane, a City roadway classified as a minor collector. Granby Lane is a two-lane undivided urban road that was constructed by the County in 2023 (City Project 23-04) in partnership with the City. There is one planned access to Granby Lane, but no other construction improvements proposed with the plat. Any proposed modifications to curb, pavement, boulevard, sidewalk, or other improvements within the public right-of-way shall be reviewed and approved with final construction plans. Street A Development of Dodd Commons includes the construction of Street A. Street A is designed as 32-foot-wide urban roadway with a sidewalk along one side, within 60-foot right-of-way. The street is designed to provide safe and logical access to all proposed lots. A temporary cul-de- sac will be constructed for future extension with the development of Outlot C. Page 371 of 445 DODD COMMONS – PRELIMINARY PLAT FEBRUARY 23, 2026 PAGE 4 OF 7 SITE PLAN Lot 1 includes the construction of Fire Station No. 2. The parking area is adequately sized to allow circulation in and out of the site and complies with fire access requirements. A driveway connection to Granby Lane and a driveway connection to Street A provide access to the parking area. Outlot B contains an existing water tower. An existing driveway connection to Granby Lane provides access to the water tower. A future connection to Street A is anticipated when Outlot C develops into lots and blocks. CONSTRUCTION ACCESS There will be one gravel access entrance for construction vehicles. Staging areas will be confined to Lot 1 and approved Outlot areas. Construction entrances shall be stabilized with gravel or temporary pavement to minimize sediment tracking onto public roads. Any temporary closures, traffic control, or maintenance of County/City roads shall comply with Dakota County and City of Lakeville standards and permits. PARKS, TRAILS, AND SIDEWALKS The Dodd Commons site does not include any neighborhood parks as identified in the City’s Parks, Trails, and Open Space Plan. Park Dedication for the developable outlots shall be collected at the time Outlot C is platted into lots and blocks. Five-foot-wide concrete sidewalks will be installed along one side of Street A. Sidewalk connections will provide access to all lots, the fire station, and the stormwater management area. A pedestrian trail connection from Dodd Boulevard to the proposed site entrances shall be provided to integrate with existing City and County trail systems. Any bituminous trail improvements shall be constructed by the Developer. All pedestrian crossings, ramps, and trails will meet current ADA accessibility standards. Sidewalks and trails will be maintained by the City once public dedication is accepted. UTILITIES SANITARY SEWER Dodd Commons is located primarily within subdistrict NC-20685 of the North Creek sanitary sewer district. Wastewater will be conveyed through City sanitary sewer to a MCES interceptor sewer (3-LV-610) monitored by meter M643A. Wastewater treatment is provided by the Empire Wastewater Treatment Facility. Page 372 of 445 DODD COMMONS – PRELIMINARY PLAT FEBRUARY 23, 2026 PAGE 5 OF 7 Development of Dodd Commons includes the construction of public sanitary sewer. 8-inch sanitary sewer will connect from an existing manhole located at the southeast corner of the site adjacent to Cedar Avenue. The Sanitary Sewer Availability Charge has not been collected on the parent parcels and shall be collected at the time Outlot C is platted into lots and blocks. The fee is based on the rate in effect at the time of final plat approval. WATERMAIN Development of Dodd Commons includes the construction of public watermain. 8-inch watermain will extend within the subdivision from an existing stub located within G, south of Dodd Boulevard. UNDERGROUNDING Any existing overhead utility lines comply with the requirements of the City’s Public Ways and Property Ordinance. DRAINAGE AND GRADING Dodd Commons is located within subdistrict FO-049.2 of the Farmington Outlet stormwater district. Development of Dodd Commons includes the construction of a stormwater management basin located in Outlot A. The basin will provide water quality treatment and rate control of stormwater runoff generated from the site. Stormwater runoff will be conveyed to the basin via the proposed storm sewer system prior to discharge. The stormwater management design is consistent with the City’s stormwater management ordinance and applicable watershed requirements. The final grading plan shall identify all fill lots in which building footings will be placed on fill material. The grading specifications shall also indicate that all embankments meet FHA/HUD 79G specifications. The Developer shall certify to the City that all lots with footings placed on fill material are appropriately constructed. Building permits will not be issued until a soils report and an as-built certified grading plan are submitted and approved by City staff. Dodd Commons contains more than one acre of site disturbance. A National Pollution Discharge Elimination System General Stormwater Permit for construction activity is required by the Minnesota Pollution Control Agency for areas exceeding one acre being disturbed by grading. A copy of the Notice of Stormwater Permit Coverage must be submitted to the City upon receipt from the MPCA. Page 373 of 445 DODD COMMONS – PRELIMINARY PLAT FEBRUARY 23, 2026 PAGE 6 OF 7 STORM SEWER Development of Dodd Commons includes the construction of public storm sewer systems. Storm sewer will be constructed within the subdivision to collect and convey stormwater runoff generated from within the public right-of-way and lots to the public stormwater management basin located within Outlot A. Draintile construction is required in areas of non-granular soils within Dodd Commons for the street subgrade and lots. Any additional draintile construction, including perimeter draintile required for building footings, deemed necessary during construction by the City shall be the developer’s responsibility to install and finance. The Storm Sewer Charge has not been collected on the parent parcels and shall be paid by Outlot C when it is platted into lots and blocks. The fee is based on the rate in effect at the time of final plat approval. FEMA FLOODPLAIN ANALYSIS Dodd Commons is shown on the Flood Insurance Rate Map (Map No. 27037C0203E; Eff. Date 12/2/2011) as Zone X by the Federal Emergency Management Agency (FEMA). Based on this designation, there are no areas in the plat located within a Special Flood Hazard Area (SFHA), as determined by FEMA. WETLANDS A wetland delineation was completed for the site. No wetlands were found to be in the project boundaries. TREE PRESERVATION The Tree Preservation Plan submitted with the Dodd Commons preliminary plat identifies 1,508 inches of significant trees located with the project boundaries. As a Mixed Use, Commercial, Industrial, or Special District, the tree removal threshold is 70%. Due to grading and site development requirements, the plan proposes to remove all trees onsite. Prior to final plat consideration, the Tree Protection Schedule and the Existing Tree Replacement Requirements table calculations provided on sheet L1.2 must be updated and resubmitted. Trees in the Tree Protection Schedule will need to be categorized as Common, Conifer, Hardwood Deciduous, or Invasive prior to calculating the number of removed inches and replacement requirements. No trees are identified for protection within the project site. Page 374 of 445 DODD COMMONS – PRELIMINARY PLAT FEBRUARY 23, 2026 PAGE 7 OF 7 LANDSCAPING The landscape plan may need to be updated following the calculations of the Tree Preservation Plan. The species selections and layout are appropriate. EROSION CONTROL A Site-Specific Stormwater Pollution Prevention Plan (SWPPP) must be submitted and approved) prior to any land disturbance. The SWPPP must clearly outline all erosion and sediment control Best Management Practices (BMPs) and document any modifications during construction. Additional erosion and sediment control measures may be required during construction as deemed necessary by City staff. All measures must be installed, maintained, and removed once the site is stabilized. RECOMMENDATION Engineering recommends approval of the preliminary plat, grading and erosion control plan, tree preservation, landscape, and utility plan for Dodd Commons, subject to the requirements and stipulations within this report. Page 375 of 445 City of Lakeville Site Location Map Dodd Commons PrePlat, CUP, & Easement Vacation 181ST ST CEDAR AVE (CSAH 23)Subject Property 179TH ST (CSAH 9) ± GREENWICH WAY HAMBURG AVE 175TH ST GLACIER WA Y DODD BLV D 173RD ST 182ND ST Central Maintenance Facility Page 376 of 445 City of Lakeville Dodd Commons Pre Plat & CUP EXHIBIT B SUBJECT PROPERTY Page 377 of 445 S 73°23'51 " W 9 2 5. 8 2 N 89°55'11" E 764.1760.00417.5631.58 732.59N 00°53'24" W112.43WEST LINE OF THE NE 1/4 OF THE SE 1/4 SEC. 9, TWP 114, RNG 20 SOUTH LINE OF THE NE 1/4 OF THE SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE NE 1/4 OF THE SE 1/4 SEC. 9, TWP 114, RNG 20 PARCEL 2 PARCEL 1 110 10 75 100 EAST LINE OF THE NE 1/4 OF THE SE 1/4 OFSEC. 9, TWP 114, RNG 20 OWNER: DAVID A. FISHER &CAROL L. FISHER, MARRIEDPID's: 22-00900-79-011 OWNER: DAKOTA ELECTRIC ASSNPID: 22-00900-79-014 OWNER: CITY OF LAKEVILLEPID: 22-00900-81-010 OWNER: CITY OF LAKEVILLEPID: 22-21225-00-010 OWNER: LAKEVILLE DIALYSISREAL ESTATE, LLC. PID: 22-21227-01-010 OWNER: CONTINENTAL 476 FUND, LLC.PID: 22-71397-01-010 OWNER: WOODBURY LAND, LLC. PID: 22-19550-01-020 SW CORNER OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9, T114, R20 SE CORNER OF THE NE 1/4 OF THE SE 1/4 OFSEC. 9, TWP 114, RNG 20 WEST FIELD EDGE SOUTH FIELD EDGE EAST FIELD EDGE NORTH FIELD EDGE FIELD EDGE FIELD EDGE 1010 1030 30 30 BUILDINGSETBACK BUILDING SETBACK BUILDING SETBACK BUILDING SETBACK EXCEPTION S 01°02'26" E1304.34 (DEED 1304.36)POINT OF BEGINNING OFEXCEPTION - NE CORNER OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9,TWP 114, RNG 20, DAKOTA COUNTY ALUMINUM MONUMENT EXCEPTION EXCEPTION N 01°02'26" W 910.46(DEED 910.63)CENTERLIN E P E R D A K O T A COUNTY HI G H W A Y RIGHT-OF- W A Y M A P 4 9 0 CENTERLI NE OF D O D D BOULEV AR D AS ORI GI N ALLY CONSTR UCTE D PER D AK OT A COUNTY HI G H W AY RIGHT-OF- WAY M AP 67 50 50 135 OWNER: DAVID A. FISHER & CAROL L. FISHER, MARRIEDPID's: 22-73370-00-070PERMANENT EASEMENT FORPUBLIC ROADWAY PURPOSES IN FAVOR OF THE C ITY OFLAKEVILLE PER DOC . 166539 PERMANENT EASEMENT FOR PUBLIC ROADWAY PURPOSESIN FAVOR OF THE CITY OFLAKEVILLE PER DOC. 166540 PERMANENT 20' EASEMENT FORPUBLIC WATER MAIN PURPOSES INFAVOR OF THE CITY OF LAKEVILLEPER DOC. 2396879 HIGHWAY RI G H T O F W A Y PER DAKOT A C O U N T Y M A P 490, DOC. 3 5 0 5 8 0 3 10' DRAINAGE AND UTILITY EASEMENTPER PLAT OF SUMMERS CREEK DRAINAGE AND UTILITY EASEMENT PER DOC. 3509250 PERMANENT HIGHWAY EASEMENT PER DOC. 3509251 HIGHWAY RIGHT OF WAYPER DAKOTA COUNTY MAP490, DOC. 3505803 CULTIVATED FIELD 60 120 110 135 50 60 51.91POINT OF B E GI N NI N G O F E X C E P TI O N - N E CORNER O F T H E N E 1 / 4 O F T H E S E 1 / 4 O F SEC. 9, TW P 1 1 4, R N G 2 0, D A K O T A COUNTY AL U MI N U M M O N U M E N T674.36(674.82)SET NAIL & DISC SET NAIL & DISC DAKOTA C O U N T Y 1.5" R/W C A P 1/2" IP - LS 17765769.76N 01°02'26" W 833.67PERMANEN T 2 0' E A S E M E N T F O R PUBLIC WA T E R M AI N P U R P O S E S I N FAVOR OF T H E CI T Y O F L A K E VI L L E PER DOC. 2 3 9 6 8 8 1 1/2" IP OPEN 1/2" IP - LS 2672X 1/2" IP - LS 2 6 7 2 4 NORTHERL Y RI G H T - O F - W A Y LI N E O F DAKOTA CO U N T Y RI G H T - O F - W A Y M A P 6 7 EXCEPTION PER DOC. NO. 1624609 EXCEPTION PER DOC. N O. 1 6 2 4 6 1 0 SEE SURVE Y O R S N O T E 7 N 16°36'08" W 477.56TEMPORARY EASEMENT FOR UTILITYPURPOSES IN FAVOR OF THE CITY OFLAKEVILLE PER DOC. 2423000 S 73°23'52 " W 6 9 3. 0 0 S 16°36'08" E 10.00 S 73°23'48 " W 2 1 8. 9 0 L=117.24R=1491.29Δ=4°30'16"12 12 21 18 14 18 A 22 19 13 EXCEPTION SOUTH 12' >>>>>>>>>>>>>>>>>>>>>>>>>> P STRM (INV)ELEV=1019.40 CG M PHH H STRM (INV)ELEV=1026.40 P HM EC FH F P VPP M C CC M M P P M MVV llllllllE E E E E E E llllllllllllllll lllll l l l lllllllllllllllllllllXOUOU OU OU OU OU BITUMINO U S BITUM INOUS CONCRETE LANDSCAPINGCONCRETE STAIRSDECK BUILDING BUILDING BUILDINGBUILDINGCONCRETECONCRETE CONCRETE BITUMINOUSBITUMINOUSBITUMINOUS DECK PROPANE TANKBITUM INOUS GRAVEL DODD BOU L E V A R D BITUMINO U S BITUM INOUSGRANBY LANE F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F lllll l l l l l l l l l l l l lllll EEEEEEEEEEE E E E E EEEEEOEOEEEEEEEEEEWOODS WOODS WOODS WOODS WOODS WOODS WOODS WOODS WOODS WOODS BITUMINO U S T R AI L BITUMINO U S T R AI L BITUMINO U S T R AI L BITUM INOUS TRA ILBITUM INOUS TRA IL BITUM INOUS TRA ILBITUM INOUS TRA IL lllllllllllllllllllllllllllllllllllllFFFF F F F F F F F G G W S MH SSWRR=1028.08 E (10INCH CLAY) N (10inch CLAY) S (10INCH CLAY) 1014.63 1000.86 INV: INV:1010.06INV:INV:INV: INV:>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >> >> >> >> >> >> >> >>CEDAR AVENUElllll(PUBLIC WAY)(PUBLIC W A Y ) (PUBL IC WAY ) GRAPHITE L A N E (PUBLIC W A Y ) FESTELEV=1019.52 FEST ELEV=1026.41 CBR=1032.65 N (12INCH RCP)1030.40INV:INV:INV:INV:INV:INV: CBR=1013.48 E (15INCH RCP) NW (15inch RCP)1008.16 1008.16 INV:INV:INV:INV:INV: INV: CBR=1021.25 E (15INCH RCP)1017.37INV:INV:INV:INV:INV:INV: CBR=1013.39 W (15INCH RCP) N (15inch RCP)1009.26 1009.17 INV:INV:INV:INV:INV: INV: CBR=1021.21 S (15INCH RCP) W (15inch RCP) NE (18INCH RCP) 1017.26 1017.17 INV: INV:1017.25INV:INV:INV: INV: CBR=1029.65 NW (18INCH RCP) E (15inch RCP) N (15INCH RCP) 1026.10 1026.00 INV: INV:1026.10INV:INV:INV: INV: CBR=1029.87 W (15INCH RCP) E (15inch RCP) N (6INCH PVC) SE (6inch PVC) 1026.42 1026.32 INV: INV:1027.42 INV:1027.47INV:INV: INV: CBR=1030.72 W (15INCH RCP) E (15inch RCP) NW (6INCH PVC) 1026.90 1026.80 INV: INV:1027.20INV:INV:INV: INV: CBR=1033.28 W (15INCH RCP)1029.56INV:INV:INV:INV:INV:INV: CBR=1035.17 E (18INCH RCP)1031.42INV:INV:INV:INV:INV:INV: CBR=1031.71 S (12INCH RCP)1028.59INV:INV:INV:INV:INV:INV: CBR=1029.99 N (15INCH RCP) S (6inch PVC)1027.27 1026.49 INV:INV:INV:INV:INV: INV: S 89°55'49" W 554.11 12224 NICOLLET AVENUEBURNSVILLE, MN 55337 (952) 890-0509 R SCALE IN FEET 0 50 100 H:\LAKV\25X139279000\CAD\C3D\139279V_ALTA_02.dwg 8/22/2025 11:23 AM ©Bolton & Menk, Inc. 2025, All Rights Reserved JOB NUMBER:FIELD BOOK:DRAWN BY: FOR: ALTA/NSPS LAND TITLE SURVEY17622 DODD BOULEVARD LAKEVILLE, MN 55044 THAT PART OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9, T114N, R20W, AND OUTLOT G, SUMMERS CREEK, DAKOTA COUNTY, MINNESOTA CITY OF LAKEVILLE, MN DAKOTA COUNTY 25X139279000 MMB S09-T114N-R20W-41,42 R BUSH CATCH BASIN CURB STOP CATCH BASIN CLEAN OUT FLARED END / APRON HANDHOLE FIRE HYDRANT MAILBOX MANHOLE-ELECTRIC MANHOLE-GAS MANHOLE-SANITARY SEWER MANHOLE-STORM SEWER MANHOLE-COMMUNICATION MANHOLE-UTILITY PEDESTAL-ELECTRIC PEDESTAL-COMMUNICATION VALVE POST INDICATOR LIGHT POLE POLE-UTILITY TREE-DECIDUOUS SIGN TRAFFIC WATER SPIGOT TREE STUMP TRANSFORMER-ELECTRIC TREE-DEAD VALVE WELL TREE-CONIFEROUS GUY WIRE ANCHOR MANHOLE-WATER CULVERT END E WS G E S D U W C C VENT METER AIR CONDITIONERAC UTILITY MARKER-COMMUNICATION VALVE VAULT YARD HYDRANTY P PAVEMENT MARKING U BOLLARDB CLVT SIGN NON TRAFFIC MONUMENT FOUND - TYPE AS NOTED BENCH MARK IRON PIPE MONUMENT SET - LS 57991 CAST IRON MONUMENT FOUND STONE MONUMENT FOUND CONTROL POINT ELECTRIC UNDERGROUND GAS UNDERGROUND COMMUNICATION UNDERGROUND FIBER UNDERGROUND OVERHEAD UTILITY WATER SYSTEM STORM SEWER SANITARY SEWER TILE LINE INTERMEDIATE CONTOUR INDEX CONTOUR SIXTEENTH LINE QUARTER LINE SECTION LINE>>>>>> OVERHEAD COMMUNICATION OVERHEAD ELECTRIC >> >> C C E E F F G G OU OC OE l l EASEMENT ADJACENT BUILDING SETBACK FENCE CENTERLINE RIGHT OF WAY X X X X EDGE OF BUSHES WETLAND EDGE CURB & GUTTER EDGE OF TREES C E F G V UTILITY VAULT UTILITY MARKER-FIBER UTILITY MARKER-GAS UTILITY MARKER-ELECTRIC UTILITY MARKER VAULT RETAINING WALL H V V CO M POST OVERFLOW CONTROL STRUCTURE TREE-PALM LEGEND SHEET 2 OF 2 SHEETS IRRIGATION VALVE BOX UNLESS OTHERWISE NOTED EXHIBIT C Page 378 of 445 S 73°23'51 " W 9 2 5. 8 2 N 89°55'11" E 764.1760.00417.5631.58 732.59N 00°53'24" W112.43WEST LINE OF THE NE 1/4 OF THE SE 1/4 SEC. 9, TWP 114, RNG 20 SOUTH LINE OF THE NE 1/4 OF THE SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE NE 1/4 OF THE SE 1/4 SEC. 9, TWP 114, RNG 20 PARCEL 2 PARCEL 1 110 10 75 100 EAST LINE OF THE NE 1/4 OF THE SE 1/4 OFSEC. 9, TWP 114, RNG 20 OWNER: DAVID A. FISHER &CAROL L. FISHER, MARRIEDPID's: 22-00900-79-011 OWNER: DAKOTA ELECTRIC ASSNPID: 22-00900-79-014 OWNER: CITY OF LAKEVILLEPID: 22-00900-81-010 OWNER: CITY OF LAKEVILLEPID: 22-21225-00-010 OWNER: LAKEVILLE DIALYSISREAL ESTATE, LLC. PID: 22-21227-01-010 OWNER: CONTINENTAL 476 FUND, LLC.PID: 22-71397-01-010 OWNER: WOODBURY LAND, LLC. PID: 22-19550-01-020 SW CORNER OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9, T114, R20 SE CORNER OF THE NE 1/4 OF THE SE 1/4 OFSEC. 9, TWP 114, RNG 20 WEST FIELD EDGE SOUTH FIELD EDGE EAST FIELD EDGE NORTH FIELD EDGE FIELD EDGE FIELD EDGE 1010 1030 30 30 BUILDINGSETBACK BUILDING SETBACK BUILDING SETBACK BUILDING SETBACK EXCEPTION S 01°02'26" E1304.34 (DEED 1304.36)POINT OF BEGINNING OFEXCEPTION - NE CORNER OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9,TWP 114, RNG 20, DAKOTA COUNTY ALUMINUM MONUMENT EXCEPTION EXCEPTION N 01°02'26" W 910.46(DEED 910.63)CENTERLIN E P E R D A K O T A COUNTY HI G H W A Y RIGHT-OF- W A Y M A P 4 9 0 CENTERLI NE OF D O D D BOULEV AR D AS ORI GI N ALLY CONSTR UCTE D PER D AK OT A COUNTY HI G H W AY RIGHT-OF- WAY M AP 67 50 50 135 OWNER: DAVID A. FISHER & CAROL L. FISHER, MARRIEDPID's: 22-73370-00-070PERMANENT EASEMENT FORPUBLIC ROADWAY PURPOSES IN FAVOR OF THE C ITY OFLAKEVILLE PER DOC . 166539 PERMANENT EASEMENT FOR PUBLIC ROADWAY PURPOSESIN FAVOR OF THE CITY OFLAKEVILLE PER DOC. 166540 PERMANENT 20' EASEMENT FORPUBLIC WATER MAIN PURPOSES INFAVOR OF THE CITY OF LAKEVILLEPER DOC. 2396879 HIGHWAY RI G H T O F W A Y PER DAKOT A C O U N T Y M A P 490, DOC. 3 5 0 5 8 0 3 10' DRAINAGE AND UTILITY EASEMENTPER PLAT OF SUMMERS CREEK DRAINAGE AND UTILITY EASEMENT PER DOC. 3509250 PERMANENT HIGHWAY EASEMENT PER DOC. 3509251 HIGHWAY RIGHT OF WAYPER DAKOTA COUNTY MAP490, DOC. 3505803 CULTIVATED FIELD 60 120 110 135 50 60 51.91POINT OF B E GI N NI N G O F E X C E P TI O N - N E CORNER O F T H E N E 1 / 4 O F T H E S E 1 / 4 O F SEC. 9, TW P 1 1 4, R N G 2 0, D A K O T A COUNTY AL U MI N U M M O N U M E N T674.36(674.82)SET NAIL & DISC SET NAIL & DISC DAKOTA C O U N T Y 1.5" R/W C A P 1/2" IP - LS 17765769.76N 01°02'26" W 833.67PERMANEN T 2 0' E A S E M E N T F O R PUBLIC WA T E R M AI N P U R P O S E S I N FAVOR OF T H E CI T Y O F L A K E VI L L E PER DOC. 2 3 9 6 8 8 1 1/2" IP OPEN 1/2" IP - LS 2672X 1/2" IP - LS 2 6 7 2 4 NORTHERL Y RI G H T - O F - W A Y LI N E O F DAKOTA CO U N T Y RI G H T - O F - W A Y M A P 6 7 EXCEPTION PER DOC. NO. 1624609 EXCEPTION PER DOC. N O. 1 6 2 4 6 1 0 SEE SURVE Y O R S N O T E 7 N 16°36'08" W 477.56TEMPORARY EASEMENT FOR UTILITYPURPOSES IN FAVOR OF THE CITY OFLAKEVILLE PER DOC. 2423000 S 73°23'52 " W 6 9 3. 0 0 S 16°36'08" E 10.00 S 73°23'48 " W 2 1 8. 9 0 L=117.24R=1491.29Δ=4°30'16"12 12 21 18 14 18 A 22 19 13 EXCEPTION SOUTH 12' >>>>>>>>>>>>>>>>>>>>>>>>>> P STRM (INV)ELEV=1019.40 CG M PHH H STRM (INV)ELEV=1026.40 P HM EC FH F P VPP M C CC M M P P M MVV llllllllE E E E E E E llllllllllllllll lllll l l l lllllllllllllllllllllXOUOU OU OU OU OU BITUMINO U S BITUM INOUS CONCRETE LANDSCAPINGCONCRETE STAIRSDECK BUILDING BUILDING BUILDINGBUILDINGCONCRETECONCRETE CONCRETE BITUMINOUSBITUMINOUSBITUMINOUS DECK PROPANE TANKBITUM INOUS GRAVEL DODD BOU L E V A R D BITUMINO U S BITUM INOUSGRANBY LANE F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F F lllll l l l l l l l l l l l l lllll EEEEEEEEEEE E E E E EEEEEOEOEEEEEEEEEEWOODS WOODS WOODS WOODS WOODS WOODS WOODS WOODS WOODS WOODS BITUMINO U S T R AI L BITUMINO U S T R AI L BITUMINO U S T R AI L BITUM INOUS TRA ILBITUM INOUS TRA IL BITUM INOUS TRA ILBITUM INOUS TRA IL lllllllllllllllllllllllllllllllllllllFFFF F F F F F F F G G W S MH SSWRR=1028.08 E (10INCH CLAY) N (10inch CLAY) S (10INCH CLAY) 1014.63 1000.86 INV: INV:1010.06INV:INV:INV: INV:>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>> >> >> >> >> >> >> >> >>CEDAR AVENUElllll(PUBLIC WAY)(PUBLIC W A Y ) (PUBL IC WAY ) GRAPHITE L A N E (PUBLIC W A Y ) FESTELEV=1019.52 FEST ELEV=1026.41 CBR=1032.65 N (12INCH RCP)1030.40INV:INV:INV:INV:INV:INV: CBR=1013.48 E (15INCH RCP) NW (15inch RCP)1008.16 1008.16 INV:INV:INV:INV:INV: INV: CBR=1021.25 E (15INCH RCP)1017.37INV:INV:INV:INV:INV:INV: CBR=1013.39 W (15INCH RCP) N (15inch RCP)1009.26 1009.17 INV:INV:INV:INV:INV: INV: CBR=1021.21 S (15INCH RCP) W (15inch RCP) NE (18INCH RCP) 1017.26 1017.17 INV: INV:1017.25INV:INV:INV: INV: CBR=1029.65 NW (18INCH RCP) E (15inch RCP) N (15INCH RCP) 1026.10 1026.00 INV: INV:1026.10INV:INV:INV: INV: CBR=1029.87 W (15INCH RCP) E (15inch RCP) N (6INCH PVC) SE (6inch PVC) 1026.42 1026.32 INV: INV:1027.42 INV:1027.47INV:INV: INV: CBR=1030.72 W (15INCH RCP) E (15inch RCP) NW (6INCH PVC) 1026.90 1026.80 INV: INV:1027.20INV:INV:INV: INV: CBR=1033.28 W (15INCH RCP)1029.56INV:INV:INV:INV:INV:INV: CBR=1035.17 E (18INCH RCP)1031.42INV:INV:INV:INV:INV:INV: CBR=1031.71 S (12INCH RCP)1028.59INV:INV:INV:INV:INV:INV: CBR=1029.99 N (15INCH RCP) S (6inch PVC)1027.27 1026.49 INV:INV:INV:INV:INV: INV: S 89°55'49" W 554.11 12224 NICOLLET AVENUEBURNSVILLE, MN 55337 (952) 890-0509 R SCALE IN FEET 0 50 100 H:\LAKV\25X139279000\CAD\C3D\139279V_ALTA_02.dwg 8/22/2025 11:23 AM ©Bolton & Menk, Inc. 2025, All Rights Reserved JOB NUMBER:FIELD BOOK:DRAWN BY: FOR: ALTA/NSPS LAND TITLE SURVEY17622 DODD BOULEVARD LAKEVILLE, MN 55044 THAT PART OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9, T114N, R20W, AND OUTLOT G, SUMMERS CREEK, DAKOTA COUNTY, MINNESOTA CITY OF LAKEVILLE, MN DAKOTA COUNTY 25X139279000 MMB S09-T114N-R20W-41,42 R BUSH CATCH BASIN CURB STOP CATCH BASIN CLEAN OUT FLARED END / APRON HANDHOLE FIRE HYDRANT MAILBOX MANHOLE-ELECTRIC MANHOLE-GAS MANHOLE-SANITARY SEWER MANHOLE-STORM SEWER MANHOLE-COMMUNICATION MANHOLE-UTILITY PEDESTAL-ELECTRIC PEDESTAL-COMMUNICATION VALVE POST INDICATOR LIGHT POLE POLE-UTILITY TREE-DECIDUOUS SIGN TRAFFIC WATER SPIGOT TREE STUMP TRANSFORMER-ELECTRIC TREE-DEAD VALVE WELL TREE-CONIFEROUS GUY WIRE ANCHOR MANHOLE-WATER CULVERT END E WS G E S D U W C C VENT METER AIR CONDITIONERAC UTILITY MARKER-COMMUNICATION VALVE VAULT YARD HYDRANTY P PAVEMENT MARKING U BOLLARDB CLVT SIGN NON TRAFFIC MONUMENT FOUND - TYPE AS NOTED BENCH MARK IRON PIPE MONUMENT SET - LS 57991 CAST IRON MONUMENT FOUND STONE MONUMENT FOUND CONTROL POINT ELECTRIC UNDERGROUND GAS UNDERGROUND COMMUNICATION UNDERGROUND FIBER UNDERGROUND OVERHEAD UTILITY WATER SYSTEM STORM SEWER SANITARY SEWER TILE LINE INTERMEDIATE CONTOUR INDEX CONTOUR SIXTEENTH LINE QUARTER LINE SECTION LINE>>>>>> OVERHEAD COMMUNICATION OVERHEAD ELECTRIC >> >> C C E E F F G G OU OC OE l l EASEMENT ADJACENT BUILDING SETBACK FENCE CENTERLINE RIGHT OF WAY X X X X EDGE OF BUSHES WETLAND EDGE CURB & GUTTER EDGE OF TREES C E F G V UTILITY VAULT UTILITY MARKER-FIBER UTILITY MARKER-GAS UTILITY MARKER-ELECTRIC UTILITY MARKER VAULT RETAINING WALL H V V CO M POST OVERFLOW CONTROL STRUCTURE TREE-PALM LEGEND SHEET 2 OF 2 SHEETS IRRIGATION VALVE BOX UNLESS OTHERWISE NOTED EXHIBIT D Page 379 of 445 L=2.04R=1491.29 Δ=0°04'42"S 16°52'06" E 520.43L=117.24 R=1491.29Δ=4°30'16"CH=117.21CB=N 16°31'08" W S 01°02'26" E 1304.34 (1304.36 DEED)WEST LINE OF THE NE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 SOUTH LINE OF THE NE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE NE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE NE 1/4 OF THE SE 1/4OF SEC. 9, TWP 114, RNG 20OWNER: DAKOTA ELECTRIC ASSNPID: 22-00900-79-014 OWNER: CITY OF LAKEVILLEPID: 22-00900-81-010 OWNER: CITY OF LAKEVILLEPID: 22-21225-00-010OWNER: LAKEVILLE DIALYSIS REAL ESTATE, LLCPID: 22-21227-01-010 OWNER: CONTINENTAL 476 FUND, LLCPID: 22-71397-01-010 OWNER: WOODBURY LAND, LLCPID: 22-19550-01-020 SW CORNER OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9, T114, R20 SE CORNER OF THE NE 1/4OF THE SE 1/4 OF SEC. 9,TWP 114, RNG 20MIN . BU ILD INGSETBACK (TYP )POINT OF BEGINNING OFEXCEPTION - NE CORNER OF THENE 1/4 OF THE SE 1/4 OF SEC. 9,TWP 114, RNG 20, DAKOTACOUNTY ALUMINUM MONUMENTCENTERLIN E P E R D A K O T A C O U N T Y RIGHT OF W A Y M A P 4 9 0 CENTERLIN E O F D O D D B O U L E V A R D A S ORIGINALL Y C O N S T R U C T E D P E R D A K O T A COUNTY HI G H W A Y RI G H T- O F - W A Y M A P 6 7 EASEMENT F O R P U B LI C ROADWAY P U R P O S E S I N FAVOR OF T H E CI T Y O F LAKEVILLE P E R D O C. 1 6 6 5 3 9 EASEMENT FOR PUBLIC ROADWAY PURPOSES IN FAVOR OF THE CITYOF LAKEVILLE PER DOC. 166540 20' EASEMENT FOR PUBLIC WATERMAIN PURPOSES IN FAVOR OF THE CITY OF LAKEVILLE PER DOC. 2396879 DRAINAGE & UT IL ITY EASEMENTPER PLAT OF SUMMERS CREEKDRAINAGE & UT IL ITYEASEMENT PER DOC . 3509250 HIGHWAY EASEMENT IN FAVOR OF THE CITY OF LAKEVILLE PER DOC. 3509251 POINT OF B E GI N NI N G O F E X C E P TI O N - N E C O R N E R OF THE NE 1 / 4 O F T H E S E 1 / 4 O F S E C. 9, T W P 1 1 4, RNG 20, D A K O T A C O U N T Y A L U MI N U M M O N U M E N T MAG NAIL & DISC LIC 57991 1/2" IP - LS 17765 20' EASEM E N T F O R P U B LI C W A T E R M AI N P U R P O S E S I N FAVOR OF T H E CI T Y O F L A K E VI L L E P E R D O C. 2 3 9 6 8 8 1 1/2" IP OPEN 1/2" IP - LS 2672X 1/2" IP - LS 2 6 7 2 4 NORTHERL Y RI G H T - O F - W A Y LI N E O F DAKOTA C O U N T Y RI G H T - O F - W A Y M A P 6 7 EXCEPTIONPER DOC. NO. 1624609 EXCEPTION PER DOC. N O. 1 6 2 4 6 1 0 SEE SURVE Y O R S N O T E 7 TEMPORARY EASEMENT FORUTILITY PURPOSES IN FAVOROF THE CITY OF LAKEVILLEPER DOC. 2423000 SOUTH 12'30.0030.00N 73°07'36" E35.901/2" IP - LS 5 7 9 9 1 MAG NA IL& D ISCLIC 57991 1/2" IP - LS 5 7 9 9 1 1/2" IP - LS 579911/2" IP - LS 579911/2" IP - LS 57991 NORTH LINE OF THE SE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE SE 1/4 OFSE 1/4 SEC. 9, TWP 114, RNG 20WEST LINE OF THE SE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 BLOCK 1 LOT 1 OUTLOT A OUTLOT B OUTLOT C 101010 10 10 5510 101010DAKOTA C O. R/W CAP OWNER: CITY OF LAKEVILLEPID: 22-17052-00-010 E X C E P T I O NOWNER: SCP 2006-C23-180-LLCPID: 22-21225-01-010OWNER: BRIGHTSIDE INVESTMENTS RE LLCPID: 22-21226-01-010OWNER: CHILDRENS DENTALPROPERTIES LLCPID: 22-21228-01-010 OWNER: CITY OF LAKEVILLEPID: 22-00900-81-010 OWNER: CITY OF LAKEVILLEPID: 22-73370-00-050 OWNER: SUMMERS CREEK VILLAS SOUTH HOA PID: 22-73371-05-320 OWNER: C ITY OF LAKEV ILLEPID : 22 -73370 -00 -100 OWNER: SU M M E R S C R E E K VI L L A S N HOMEOWN E R S A S S O PID: 22-73 3 7 0 - 1 1 - 0 9 0 OWNER: SU M M E R S C R E E K VI L L A S N HOMEOWN E R S A S S O PID: 22-73 3 7 0 - 1 2 - 1 6 0 150150150179TH STREET WESTGRANBY LANE60 15015050 100 100 502727120120100 100 75 75 100 100 100 100 12575 75 90 90 OWNER: VERIDIAN CREDIT UNIONPID: 22-47605-01-010OWNER: LAKEVILLE 2004 LLCPID: 22-18600-01-010PROPOSED DRAINAGE & UTILITY EASEMENT PROPOSED DRAINAGE & UTILITY EASEMENT MIN . PARK INGSETBACK (TYP ) 30 30 30 30606050 507560606075751/2" IP - LS 5 7 9 9 1 1/2" IP - LS 5 7 9 9 1 C.S.A.H NO. 23(CEDAR AVENUE)674.82STREET A S 73°23'51 " W 9 2 5. 9 0 51.90S 01°02'26" E 910.63781.79S 89°55'12" W 554.00 C.S.A.H. N O. 9 (DODD BO U L E V A R D)S 01°02'26" E 833.69SOUTHERLY RIGHT OF WAYLINE OF DAKOTA COUNTYRIGHT OF WAY MAP NO. 490 496.65 470.30N 73°07'54 " E 60.00 S 16°52'06" E 216.88205.51481.94L=41.55 R=45.00Δ=52°54'29" L=69.26R=75.00Δ=52°54'47" S 89°55'11" W 384.15 S 00°04'49" E 165.54S 79°11'14" W 3 9 4 . 0 9 355.54 L =5 1 5 .8 3 R =3 0 2 5 .0 0 Δ =9 °4 6 '1 3 " L =4 9 0 .2 5 R =2 8 7 5 .0 0 Δ =9 °4 6 '1 3 " S 88°57'26" W 279.12 S 88°57'26" W 264.12 S 79°11'14" W 3 9 6 . 5 3 L =8 7 .3 1 R =1 4 2 3 .1 0 Δ =3 °3 0 '5 5 "S 01°02'26" E13.85S 88°57'34" W 15.00 S 01°02'26" E 270.16S 88°25'04" W 75.00 S 01°02'26" E135.98S 89°55'12" W 554.00 75.01478.99417.56L=115.20R=1491.26Δ=4°25'34"CH=115.17CB=S 16°28'47" E CH=2.04CB=S 18°43'55" E60.0035.16N 89°47'24" E 4.92 234.35N 08°37'37" W 269.51L=18.25R=25.00 Δ=41°49'14" N 73°07'54 " E 2 0 8. 9 5 136.43 218.90 10.00 105 12224 NICOLLET AVENUEBURNSVILLE, MN 55337 (952) 890-0509 R SCALE IN FEET 0 100 200 H:\LAKV\25X139279000\CAD\C3D\139279V_PLTP_01.dwg 1/28/2026 2:47 PM ©Bolton & Menk, Inc. 2026, All Rights Reserved FOR: DRAWN BY:FIELD BOOK:JOB NUMBER: PRELIMINARY PLATLAKEVILLE, MINNESOTA THAT PART OF THE NE 1/4 OF THE SE 1/4 & THE SE 1/4 OF THE SE 1/4 OF SECTION 9, SECTION 9, TOWNSHIP 114 N, RRANGE. 20 W. DAKOTA COUNTY, MN CITY OF LAKEVILLE 25X.139279 N/A MMB S09-T114-R20-41,44 R R VICINITY MAP 175T H S T W CO. RD. 9 DODD BLV D NW 1 / 4 NE 1 / 4 SW 1 / 4 SE 1 / 4 SITE SECTION 9, TOWNSHIP 114 NORTH, RANGE 20 WEST CEDAR AVEDODD COMMONSPRELIMINARY PLAT OF: LEGAL DESCRIPTION The following was provided in Land Title Inc., Old Republic Title Insurance Company Commitment Number: 714506, Commitment Date: May 19, 2025, at 7:00 a.m., Schedule A. That part of the Northeast Quarter of the Southeast Quarter of Section 9, Township 114 North, Range 20 West, Dakota County, Minnesota, lying and being south of Dodd Boulevard (Dakota County Highway No. 9) as originally constructed according to Dakota County Road Right of Way Map No. 67. Excepting therefrom that part of the Northeast Quarter of the Southeast Quarter of said Section 9 described as follows: Beginning at the Northeast corner of the Northeast Quarter of the Southeast Quarter of said Section 9, said point being in the center of Dodd Boulevard (Dakota County Highway No. 9) as originally constructed; thence Southerly on the east line of said Northeast Quarter of the Southeast Quarter a distance of 1304.36 feet to the north line of the south 12.00 feet of said Northeast Quarter of the Southeast Quarter; thence westerly on the north line of said south 12.00 feet of the Northeast Quarter of the Southeast Quarter a distance of 554.00 feet; thence Northerly, parallel with the East line of said Northeast Quarter of the Southeast Quarter a distance of 910.63 feet to the original centerline of Dodd Boulevard (County Highway No. 9 according to Dakota County Road Right of Way Map no. 67); thence Northeasterly on the original centerline of said Dodd Boulevard (County Highway no. 9) according to said Map No. 67, a distance of 674.82 feet to the point of beginning. Excepting that part conveyed in Document Numbers 1624609 and 1624610 lying North of Dodd Road. Further excepting the south 12 feet of the east 554.00 feet of the NE 1/4 of the SE 1/4 of Section 9, Township 114 North, Range 20 West, Dakota County, Minnesota. The said 554.00 feet being measured in a line parallel with the south line of said NE 1/4 of the SE 1/4 and conveyed in Document Number 1221220. AND Outlot G, Summers Creek, Dakota County, Minnesota. AND That part of the Southeast Quarter of the Southeast Quarter of Section 9, Township 114, Range 20, lying northerly of the southerly line of DAKOTA COUNTY RIGHT OF WAY MAP NO. 490, on file and of record in the office of the County Recorder, all in Dakota County, Minnesota. SURVEYORS NOTES 1. Dakota County Coordinate system NAD83(1986adj), NAVD 88 vertical datum. 2. Field survey was completed on November 11th, 2025. 4. Distances are in US Survey feet. 5. Contours are at 1 foot intervals 6. Surveyed property is Abstract. OWNER City of Lakeville 20195 Holyoke Ave. Lakeville, MN 55044 SURVEYOR Bolton and Menk, Inc. 12224 Nicollet Avenue Burnsville, MN 55337 SURVEYOR'S CERTIFICATION I hereby certify that this survey, plan, or report was prepared by me or under my direct supervision and that I am a duly Licensed Land Surveyor under the laws of the State of Minnesota. ________________ Date _____________________________________ Matthew M. Bomstad License Number 57991 LOT AREAS: TOTAL AREA: 1,017,344 SQ. FT. (23.355 AC.) LOT 1, BLOCK 1: 163,424 SQ. FT. (3.752 AC.) OUTLOT A: 60,874 SQ. FT. (1.397 AC.) OUTLOT B: 73,428 SQ. FT. (1.686 AC.) OUTLOT C: 421,029 SQ. FT. (9.665 AC.) RIGHT-OF-WAY: 298,589 SQ. FT. (6.855 AC.) ZONING: Current zoning classification for subject property: Part lying within NE1/4 of SE1/4, Sec. 9, Twp. 114, Rge. 20 - C-3 (General Commercial District) Part lying within SE1/4 of SE1/4, Sec. 9, Twp. 114, Rge. 20 - P/OS (Public and Open Space District) Proposed zoning classification for subject property: - C-3 (General Commercial District) REQUIREMENTS/SETBACKS: C-3 Minimum Area/Distance Requirements: Minimum Lot Area - 1 Acre Minimum Lot width - 100 ft. C-3 Principal Structure Setbacks: Front & Side (Street) - 30 ft. (CUP - 35 ft.) Side & Rear - 20 ft. (CUP - 10 ft.) C-3 Parking Setbacks: Front & Side (Street) - 15 ft. Side & Rear - 5 ft. C-3 Building Height - 65 ft. P-OS Minimum Area/Distance Requirements: Minimum Lot Area - 20,000 sq. ft. Minimum Lot width - 100 ft. P-OS Principal Structure Setbacks: Front & Side (Street) - 30 ft. Side & Rear - 10 ft. P-OS Parking Setbacks: Front & Side (Street) - 15 ft. Side & Rear - 5 ft. P-OS Building Height- None ORIENTATION OF THE BEARING SYSTEM USED FORTHIS SURVEY IS BASED ON THE SOUTH LINE OF THENORTHEAST QUARTER OF THE SOUTHEASTQUARTER OF SECTION 9, TOWNSHIP 114, RANGE 20, WHICH IS ASSUMED TO BEAR NORTH 89DEGREES 55 MINUTES 11 SECONDS EAST. BEARING NOTE MNDOT GEODETIC MONUMENT 6602 V ELEVATION = 1081.225 (NAVD88) BENCHMARK SHEET 1 OF 2 SHEETS 01/28/2026 EXHIBIT E Page 380 of 445 S 79°11'14" W 3 9 6 . 5 3 S 88°57'26" W 264.12 L =8 7 .3 1 R =1 4 2 3 .1 0 Δ =3 °3 0 '5 5 " L =4 9 0 .2 5 R =2 8 7 5 .0 0 Δ =9 °4 6 '1 3 "S 01°02'26" E 270.16S 88°57'34" W 15.00 S 01°02'26" E13.85S 88°25'04" W 75.00 S 88°57'26" W 279.12 S 79°11'14" W 3 9 4 . 0 9 L =5 1 5 .8 3 R =3 0 2 5 .0 0 Δ =9 °4 6 '1 3 "S 01°02'26" E135.98S 89°55'12" W 554.00 478.99 75.01 N 89°55'11" E 384.15 S 00°04'49" E 165.54355.54 38.55234.3535.16 N 08°37'37" W 269.51N 89°47'24" E 4.92 N 00°53'12" W 540.45N 16°36'08" W 477.5660.00417.56496.65 385.09 540.81 S 16°52'06" E 520.43470.30481.94N 73°07'54 " E 60.00 S 16°52'06" E 216.88205.51N 73°07'54 " E 2 0 8. 9 5 L=18.25 R=25.00Δ=41°49'14" L=41.55R=45.00Δ=52°54'29" L=69.26 R=75.00Δ=52°54'47" L=117.24R=1491.29Δ=4°30'16"CH=117.21CB=N 16°31'08" W L=2.04R=1491.29 Δ=0°04'42"CH=2.04CB=N 18°43'55" W S 01°02'26" E 1304.34 (1304.36 DEED)WEST LINE OF THE NE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 SOUTH LINE OF THE NE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE NE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE NE 1/4 OF THE SE 1/4OF SEC. 9, TWP 114, RNG 20SW CORNER OF THE NE 1/4 OF THE SE 1/4 OF SEC. 9, T114, R20 SE CORNER OF THE NE 1/4OF THE SE 1/4 OF SEC. 9,TWP 114, RNG 20POINT OF BEGINNING OFEXCEPTION - NE CORNER OF THENE 1/4 OF THE SE 1/4 OF SEC. 9,TWP 114, RNG 20, DAKOTACOUNTY ALUMINUM MONUMENTCENTERLIN E P E R D A K O T A C O U N T Y RIGHT OF W A Y M A P 4 9 0 CENTERLIN E O F D O D D B O U L E V A R D A S ORIGINALL Y C O N S T R U C T E D P E R D A K O T A COUNTY HI G H W A Y RI G H T- O F - W A Y M A P 6 7 EASEMENT F O R P U B LI C ROADWAY P U R P O S E S I N FAVOR OF T H E CI T Y O F LAKEVILLE P E R D O C. 1 6 6 5 3 9 EASEMENT FOR PUBLIC ROADWAYPURPOSES IN FAVOR OF THE CITYOF LAKEVILLE PER DOC. 166540 20' EASEMENT FOR PUBLIC WATER MAIN PURPOSES IN FAVOR OF THECITY OF LAKEVILLE PER DOC. 2396879 DRAINAGE & UT IL ITY EASEMENTPER PLAT OF SUMMERS CREEKDRAINAGE & UT IL ITYEASEMENT PER DOC . 3509250 HIGHWAY EASEMENT INFAVOR OF THE CITY OFLAKEVILLE PER DOC. 3509251 POINT OF B E GI N NI N G O F E X C E P TI O N - N E C O R N E R OF THE NE 1 / 4 O F T H E S E 1 / 4 O F S E C. 9, T W P 1 1 4, RNG 20, DA K O T A C O U N T Y A L U MI N U M M O N U M E N T MAG NAIL & DISC LIC 57991 1/2" IP - LS 17765 20' EASEM E N T F O R P U B LI C W A T E R M AI N P U R P O S E S I N FAVOR OF T H E CI T Y O F L A K E VI L L E P E R D O C. 2 3 9 6 8 8 1 1/2" IP OPEN 1/2" IP - LS 2672X 1/2" IP - LS 2 6 7 2 4 NORTHERL Y RI G H T - O F - W A Y LI N E O F DAKOTA CO U N T Y RI G H T - O F - W A Y M A P 6 7 EXCEPTION PER DOC. NO. 1624609 EXCEPTION PER DOC. N O. 1 6 2 4 6 1 0 SEE SURVE Y O R S N O T E 7 TEMPORARY EASEMENT FORUTILITY PURPOSES IN FAVOROF THE CITY OF LAKEVILLE PER DOC. 2423000 SOUTH 12'30.0030.00N 73°07'36" E35.901/2" IP - LS 5 7 9 9 1 MAG NA IL& D ISCLIC 57991 1/2" IP - LS 5 7 9 9 1 1/2" IP - LS 579911/2" IP - LS 579911/2" IP - LS 57991 NORTH LINE OF THE SE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 EAST LINE OF THE SE 1/4 OFSE 1/4 SEC. 9, TWP 114, RNG 20WEST LINE OF THE SE 1/4 OF SE 1/4 SEC. 9, TWP 114, RNG 20 BLOCK 1 LOT 1 OUTLOT A OUTLOT B OUTLOT C 101010 10 10 5510 101010DAKOTA CO. R/W CAP E X C E P T I O N150150150179TH STREET WESTGRANBY LANE60 15015050 100 100 502727120120100 100 75 75 100 100 100 100 12575 75 90 90 DRAINAGE & UTILITY EASEMENT DRAINAGE & UTILITYEASEMENT 30 30 30 30606050 507560606075751/2" IP - LS 5 7 9 9 1 1/2" IP - LS 5 7 9 9 1 C.S.A.H NO. 23(CEDAR AVENUE)674.82STREET A S 73°23'51 " W 9 2 5. 9 0 51.90S 01°02'26" E 910.63781.79S 89°55'12" W 554.00 C.S.A.H. N O. 9 (DODD BO U L E V A R D)S 01°02'26" E 833.69136.43 10.00 218.90 SOUTHERLY RIGHT OF WAY LINE OF DAKOTA COUNTYRIGHT OF WAY MAP NO. 490 L=115.20R=1491.26 Δ=4°25'34"CH=115.17CB=S 16°28'47" E 105 R SCALE IN FEET 0 100 200 R VICINITY MAP 175T H S T W CO. RD. 9 DODD BLV D NW 1 / 4 NE 1 / 4 SW 1 / 4 SE 1 / 4 SITE SECTION 9, TOWNSHIP 114 NORTH, RANGE 20 WEST CEDAR AVEORIENTATION OF THE BEARING SYSTEM USED FORTHIS SURVEY IS BASED ON THE SOUTH LINE OF THE NORTHEAST QUARTER OF THE SOUTHEASTQUARTER OF SECTION 9, TOWNSHIP 114, RANGE20, WHICH IS ASSUMED TO BEAR NORTH 89DEGREES 55 MINUTES 11 SECONDS EAST. BEARING NOTE KNOW ALL PERSONS BY THESE PRESENTS: That the City of Lakeville, a Minnesota municipal corporation under the laws of Minnesota, owner of the following described property situated in the County of Rice and State of Minnesota, to wit: That part of the Northeast Quarter of the Southeast Quarter of Section 9, Township 114 North, Range 20 West, Dakota County, Minnesota, lying and being south of Dodd Boulevard (Dakota County Highway No. 9) as originally constructed according to Dakota County Road Right of Way Map No. 67. Excepting therefrom that part of the Northeast Quarter of the Southeast Quarter of said Section 9 described as follows: Beginning at the Northeast corner of the Northeast Quarter of the Southeast Quarter of said Section 9, said point being in the center of Dodd Boulevard (Dakota County Highway No. 9) as originally constructed; thence Southerly on the east line of said Northeast Quarter of the Southeast Quarter a distance of 1304.36 feet to the north line of the south 12.00 feet of said Northeast Quarter of the Southeast Quarter; thence westerly on the north line of said south 12.00 feet of the Northeast Quarter of the Southeast Quarter a distance of 554.00 feet; thence Northerly, parallel with the East line of said Northeast Quarter of the Southeast Quarter a distance of 910.63 feet to the original centerline of Dodd Boulevard (County Highway No. 9 according to Dakota County Road Right of Way Map no. 67); thence Northeasterly on the original centerline of said Dodd Boulevard (County Highway no. 9) according to said Map No. 67, a distance of 674.82 feet to the point of beginning. Excepting that part conveyed in Document Numbers 1624609 and 1624610 lying North of Dodd Road. Further excepting the south 12 feet of the east 554.00 feet of the NE 1/4 of the SE 1/4 of Section 9, Township 114 North, Range 20 West, Dakota County, Minnesota. The said 554.00 feet being measured in a line parallel with the south line of said NE 1/4 of the SE 1/4 and conveyed in Document Number 1221220. AND Outlot G, Summers Creek, Dakota County, Minnesota. AND That part of the Southeast Quarter of the Southeast Quarter of Section 9, Township 114, Range 20, lying northerly of the southerly line of DAKOTA COUNTY RIGHT OF WAY MAP NO. 490, on file and of record in the office of the County Recorder, all in Dakota County, Minnesota. Has caused the same to be surveyed and platted as DODD COMMONS and does hereby dedicate to the public for public use the public ways and the drainage and utility easements as create by this plat. In witness whereof said City of Lakeville, a Minnesota municipal corporation under the laws of Minnesota, has caused these presents to be signed by its proper officers this ______ day of __________________ , 2026. City of Lakeville By ____________________________________ , its Mayor By ____________________________________ , its Clerk Luke Hellier Ann Orlofsky STATE OF MINNESOTACOUNTY OF _______________ This instrument was acknowledged before me on ________________________ by Luke Hellier, Mayor and Ann Orlofsky, Clerk of the City of Lakeville, a Minnesota municipal corporation under the laws of Minnesota, on behalf of the corporation. ____________________________________ Signature ____________________________________ Printed Name Notary Public, __________________ County My Commission Expires on ________________ I, Matthew M. Bomstad, do hereby certify that this plat was prepared by me or under my direct supervision; that I am a duly Licensed Land Surveyor in the State of Minnesota; that this plat is a correct representation of the boundary survey; that all mathematical data and labels are correctly designated on this plat; that all monuments depicted on this plat have been, or will be correctly set within one year; that all water boundaries and wet lands, as defined in Minnesota Statutes, Section 505.01, Subd. 3, as of the date of this certificate are shown and labeled on this plat; and all public ways are shown and labeled on this plat. Dated this ______ day of __________________ , 2026 ____________________________________ Matthew M. Bomstad, Licensed Land Surveyor Minnesota License No. 57991 STATE OF MINNESOTACOUNTY OF _______________ This instrument was acknowledged before me on ________________________ by Matthew M. Bomstad. ____________________________________ Signature ____________________________________ Printed Name Notary Public, __________________ County My Commission Expires on ________________ CITY COUNCIL, CITY OF LAKEVILLE, MINNESOTA We do hereby certify that on ______ day of __________________ , 2026, the City Council of Lakeville, Minnesota approved this plat by resolution and is in compliance with the provisions of Minnesota Statutes Section 505.03, Subdivision 2. _________________________________ Mayor _________________________________ City Clerk Luke Hellier Ann Orlofsky DAKOTA COUNTY SURVEYOR I hereby certify that in accordance with Minnesota Statutes, Section 505.021, Subd. 11, this plat has been reviewed and approved this ______ day of __________________ , 2026. ____________________________________ Todd B. Tollefson - Dakota County Surveyor BOARD OF COUNTY COMMISSIONERS, COUNTY OF DAKOTA, STATE OF MINNESOTA We do hereby certify that on ______ day of __________________ , 2026 the Board of Commissioners of Dakota County, Minnesota approved this plat of DODD COMMONS and said plat is in compliance with the provisions of Minnesota Statutes Section 505.03, Subd. 2, and pursuant to the Dakota County Contiguous Plat Ordinance. ______________________________________, Chair, County Board ______________________________________, County Treasurer-Auditor DAKOTA COUNTY PROPERTY TAXATION & RECORDS Pursuant to Minnesota Statutes, Section 505.021, Subd. 9, taxes payable in the year 2026 on the land hereinbefore described have been paid. Also, pursuant to Minnesota Statutes, Section 272.12, there are no delinquent taxes and transfer entered this ______ day of __________________ , 2026. ______________________________________ Amy Koethe - Property Taxation & Records Director COUNTY RECORDER, COUNTY OF DAKOTA, STATE OF MINNESOTA I hereby certify that this plat of DODD COMMONS was recorded in the office of the County Recorder for public record on this ______ day of __________________ , 2026, at ______ o'clock _____.M. and was duly filed in Book _________ of Plats, Page _________, as Document Number ____________. ______________________________________ Amy Koethe - County Recorder BOLTON & MENK, INC.THIS PLAT PREPARED BY 1/2 INCH IRON PIPE MONUMENT SETMARKED BY LICENSE NO. 57991DENOTES FOUND MONUMENT (TYPE AS NOTED) LEGEND NOT TO SCALE DODD COMMONS EXHIBIT F Page 381 of 445 1KEY NOTESNEW LIGHT-DUTY BITUMINOUS PAVEMENT, SEE DETAILNEW HEAVY-DUTY BITUMINOUS PAVEMENT, SEE DETAILNEW BITUMINOUS TRAIL, SEE DETAILNEW LIGHT-DUTY CONCRETE PAVEMENT, SEE DETAILNEW HEAVY-DUTY CONCRETE PAVEMENT, SEE DETAIL NEW B612 CONCRETE CURB, SEE DETAILNEW SURMOUNTABLE CURB, SEE DETAILNEW CURB TRANSITIONNEW ACCESSIBLE CURB RAMP, SEE DETAIL_A: TYPE 1_B: TYPE 2NEW CONCRETE STAIRS, SEE DETAILNEW SIGN AND POST, SEE ARCHITECTURALNEW BOLLARD, SEE ARCHITECTURALNEW FLAG POLE, SEE ARCHITECTURALARTIFICIAL TURF, SEE ARCHITECTURALTRASH ENCLOSURE, SEE ARCHITECTURAL23456789101112131415DODD BOULEVARDGRANBY L A N E GRAPHITELANEDODD BOULEVARDGRANBY L A N E OWNER: CITY OF LAKEVILLEPID: 22-00900-81-010OWNER: WOODBURY LAND, LLC.PID: 22-19550-01-020OWNER: S U M M E R S C R E E K VILLAS N H O M E O W N E R S A S S O PID: 22-73 3 7 0 - 1 1 - 0 9 0 OWNER: CI T Y O F L A K E VI L L E PID: 22-73 3 7 0 - 0 0 - 1 0 0PROPOSEDFIRE STATIONFFE = 1023.25(ARCH 100'-0")SEE SHEET C202SEE SHEET C20145.37'9'20'24'24'80' 95.76' 30'81.36'100.02'97'95'WET POND NWLWET POND NWLR45'10' 10'6'20'9'20'9' 20'9'15' PARKI N G S E T B A C K 30' BUILDI N G S E T B A C K 5' PARKING SETBACK32' BUILDING SETBACK30' BUILDING SETBACK15' PARKING SETBACK24'111122233334444433555555466667769B9B9A9A9A9A9A10111111111111111212131415446666© CNH ARCHITECTS, INC.CNH NO.:REVISIONS:DATE:7300 147TH WEST STREET SUITE 504APPLE VALLEY, MN 55124(952) 431-4433CITY SUBMITTAL - NOT FOR CONSTRUCTIONLakeville Fire Station 2240512/23/20263524 Labore RoadWhite Bear Lake, MN 55110651.481.9120 (f) 651.481.9201www.larsonengr.comLarsonEngineering, Inc.Lakeville, MNSite PlanC201NEW LIGHT-BITUMINOUS PAVEMENTSEE DETAILNEW HEAVY-DUTY BITUMINOUS PAVEMENTSEE DETAILMATCH EXISTING PAVEMENT SECTIONNEW LIGHT-DUTY CONCRETE PAVEMENTSEE DETAILNEW HEAVY-DUTY CONCRETE PAVEMENTSEE DETAILNEW ARTIFICIAL TURF SECTION SEE ARCH.NEW STOOPSEE STRUCTURAL AND ARCH.NEW LIGHT POLE, SEE ELECTRICAL.RETAINING WALLSYMBOL LEGENDNOTE: CONCRETE JOINTS ARE SHOWN ONLY FORGENERAL REFERENCE. ACTUAL JOINTS SHALL BECONSTRUCTED PER PROJECT SPECIFICATIONS. SEEARCHITECTURAL DRAWINGS.EASEMENT LINERIGHT-OF-WAY LINEPROPERTY LINEGENERALSETBACK LINENORTH0306015EXHIBIT GPage 382 of 445 PROPOSEDFIRE STATIONFFE = 1023.25(ARCH 100'-0")3.54%0.5%1.9%1.17%1.0%2.06%9.6% 3.22%WET POND100-YR HWL: 1013.6110-YR HWL: 1012.11NWL: 1010.00BOT: 1002.006.0% 5.4%10211019101710131011100910071018101610141012100810061018102610231022102110221022 1024 1023 100410031002101210141013101110111013101410121017102410151020101010251025 1005101010151015101010231022102210231028102910301031103210331034103510221023 102310221021102010191018102310231024102510261027102810291030102210211023102410251026102710281030103110321033102910301031103210331034103610401037 1036 10351038103810221024 1023 1025 1026 10231027 1028 102510221023102210231016.52 TC*1016.06 GL*1024.78 TC*1024.31 GL*1021.13 TC*1020.67 GL*1030.54 TC*1030.06 GL*1030.96 TC*1030.49 GL*1034.67 TC*1034.23 GL*1036.10 TC*1035.67 GL*1017.37 GL*1023.60 GL*1023.25 FFE1022.67 C1021.21 GL*1021.87 C1021.49 GL*1019.84 GL*1020.82 C1023.25 FFE1022.28 GL1022.10 B1023.88 TC1023.38 GL1030.35 GL*1030.19 GL*1034.70 GL*1035.21 GL*1019.58 TC1019.08 RIM1023.25 FFE1021.54 GL1021.51 TC1021.01 GL1018.82 TC1018.32 GL1023.25 FFE1021.59 TC1021.09 RIM1022.05 TC1021.55 GL1022.05 TC1021.55 GL1021.35 TC1020.85 RIM1021.20 GL1023.25 FFE1022.71 GL1022.71 GL1021.78 RIM1021.41 RIM1023.25 FFE1021.94 GL1022.25 TC1021.75 RIM1024.33 TC1023.83 GL1028.49 B1023.46 B1022.77 C1020.98 RIM1024.25 GL1022.34 TC1021.84 GL1023.70 TC1023.20 GL1023.25 FFE1023.25 FFE1023.01 C1023.25 C1022.92 C1022.03 C1021.94 TC/GL1022.01 TC/GL1023.25 FFE1023.25 TC1022.75 GL1023.11 TC1022.61 GL1023.11 TC1022.61 GL1022.29 TC1020.79 RIM1021.54 GL1020.25 GL1019.50 GL1029.73 GL1022.231014.00 EOF1016.50 TC1016.00 RIM1017.80 GL1022.61 TC1022.11 GL1021.48 TC1020.98 GL1024.52 TC1024.02 GL1022.97 TC1022.47 GL1022.69 TC1022.19 GL1021.83 B1022.14 B1022.91 TC1022.41 GL1022.13 TC/GL1023.40 TC1022.90 GL1022.79 TC/GL1023.85 TC1023.35 GL1021.24 TC1020.74 RIM1023.34 TC1022.84 GL1022.98 TC1022.48 GL1023.10 TC1022.60 GL1023.63 TC1023.13 GL1022.97 TC1022.47 GL1022.43 C1022.78 C1023.06 C1023.33 TC1022.83 GL1029.28 TC/GL1029.48 TC/GL1029.13 TC/GL1029.33 TC/GL1030.55 B1030.39 B1035.60 TC/GL1034.20 TC/GL1035.09 TC/GL1033.84 TC/GL1035.41 B1034.90 B1028.30 C1021.50 RIM1029.87 B*1029.97 B*1028.00 B*1030102610271028102910221019102010331022.10 C1023.25 FFE1030.54 C1023.82 GL1030.47 C10291027.60 GL1028.01 B1023.40 TC1022.90 GL1024.30 B1027.77 TC1027.27 GL1034103510271028.01 GL/TC1035.50 C1022.12 TC1021.62 GL1022.21 BS1025.65 TS1025.72 BS1029.64 TS1029.73 B1026102610251023102110201019101710151013101210111008101210131014101510171018102010401039103810371036103510341033103210311030 1029 10281027 1026 1025102510231022102010181017101510141013 1014101510161017101810171019102010291028102710251026 1024102310131014101610171018101910201021102210301032103310341036102210231024102510261026103610331035DODD BOULEVARDGRANBY L A N E GRAPHITELANEDODD BOULEVARDGRANBY L A N E OWNER: CITY OF LAKEVILLEPID: 22-00900-81-010OWNER: WOODBURY LAND, LLC.PID: 22-19550-01-020OWNER: S U M M E R S C R E E K VILLAS N H O M E O W N E R S A S S O PID: 22-73 3 7 0 - 1 1 - 0 9 0 OWNER: CI T Y O F L A K E VI L L E PID: 22-73 3 7 0 - 0 0 - 1 0 0SEE SHEET C302SEE SHEET C3011KEY NOTESSILT FENCE, SEE DETAILINLET PROTECTION, SEE DETAILROCK CONSTRUCTION ENTRANCE, SEE DETAILRIP RAP AT FLARED END SECTION, SEE DETAIL234© CNH ARCHITECTS, INC.CNH NO.:REVISIONS:DATE:7300 147TH WEST STREET SUITE 504APPLE VALLEY, MN 55124(952) 431-4433CITY SUBMITTAL - NOT FOR CONSTRUCTIONLakeville Fire Station 2240512/23/20263524 Labore RoadWhite Bear Lake, MN 55110651.481.9120 (f) 651.481.9201www.larsonengr.comLarsonEngineering, Inc.Lakeville, MNPROPOSED CONTOURS - MAJOR INTERVALGRADE BREAK LINEPROPOSED CONTOURS - MINOR INTERVAL949950950EXISTING CONTOURS2.0%950.00 TC949.50 GLGRADE SLOPESPOT ABBREVIATIONS:TC - TOP OF CURBGL - GUTTER LINEGO - GUTTER OUTB - BITUMINOUSC - CONCRETEEO - EMERGENCY OVERFLOWTW - TOP OF WALLBW - BOTTOM OF WALL (F/G)(*) - EXISTING TO BE VERIFIEDGRADING NOTES1. Tree protection consisting of snow fence or safety fence installed at thedrip line shall be in place prior to beginning any grading or demolition workat the site.2. All elevations with an asterisk (*) shall be field verified. If elevations varysignificantly, notify the Engineer for further instructions.3. Grades shown in paved areas represent finish elevation.4. All disturbed areas to receive 6” of good quality topsoil and seed.5. All construction shall be performed in accordance with state and localstandard specifications for construction.SYMBOL LEGENDSILT FENCERIP-RAP / ROCK CONST. ENTRANCEINLET PROTECTIONSEDIMENT LOGEROSION CONTROL BLANKETGrading & ErosionControl PlanC3011. See SWPPP Sheets C001 and C002 for Erosion Control Notes.EROSION CONTROL NOTESNORTH0306015EXHIBIT HPage 383 of 445 KEY NOTESCATCH BASIN, SEE DETAILCATCH BASIN / STORM MANHOLE, SEE DETAILSTORM SEWER SUMP MANHOLE, SEE DETAILOUTLET CONTROL STRUCTURE, SEE DETAILSANITARY SEWER MANHOLE, SEE DETAILNEW HYDRANT AND VALVE, SEE DETAILFLARED END SECTION, SEE DETAILNEW GATE VALVE AND BOX, SEE DETAIL12345678PROPOSEDFIRE STATIONFFE = 1023.25(ARCH 100'-0")DODD BOULEVARDGRANBY L A N E GRAPHITELANECBR=1021.25E (15INCH RCP)1017.37INV:INV:INV:INV:INV:INV:CBR=1021.21S (15INCH RCP)W (15inch RCP)NE (18INCH RCP)1017.171017.26INV:INV:1017.25INV:INV:INV:INV:DODD BOULEVARDGRANBY L A N E CBR=1013.39INV: W (15INCH RCP) 1009.17INV: N (15inch RCP) 1009.26CBR=1013.48INV: E (15INCH RCP) 1008.16INV: NW (15inch RCP) 1008.16CBR=1029.99INV: N (15INCH RCP) 1026.49INV: S (6inch PVC) 1027.27CBR=1029.65INV: NW (18INCH RCP) 1026.00INV: E (15inch RCP) 1026.10INV: N (15INCH RCP) 1026.10CBR=1029.87INV: W (15INCH RCP) 1026.32INV: E (15inch RCP) 1026.42INV: N (6INCH PVC) 1027.42INV: SE (6inch PVC) 1027.47CBR=1030.72INV: W (15INCH RCP) 1026.80INV: E (15inch RCP) 1026.90INV: NW (6INCH PVC) 1027.20CBR=1033.28INV: W (15INCH RCP) 1029.56FESTELEV=1026.41STRM (INV)ELEV=1026.40OWNER: CITY OF LAKEVILLEPID: 22-00900-81-010OWNER: WOODBURY LAND, LLC.PID: 22-19550-01-020OWNER: S U M M E R S C R E E K VILLAS N H O M E O W N E R S A S S O PID: 22-73 3 7 0 - 1 1 - 0 9 0 OWNER: CI T Y O F L A K E VI L L E PID: 22-73 3 7 0 - 0 0 - 1 0 0 SANMHRIM: 1013.90INV: 1001.00CONNECT TO EXST WMW/ WET TAP AND VALVE189 LF 8" PVC @ 0.5%300 LF 8" P V C @ 1. 0 %SANMHRIM: 1009.00INV: 1001.95155 LF 8" P V C @ 1. 0 %104 LF 6" PVC @ 2.0%SANMHRIM: 1022.00INV: 1004.95SANMHRIM: 1024.90INV: 1006.50COORD. W/ MECHINV: 1013.06COORD. W/ MECHINV: 1015.258" DIP8" DIP 8" DIP 8" DIPOCSRIM: 1013.00TOP WEIR: 1012.2512" ORIFICE: 1010.00INV: 1010.00FESINV: 1005.00FESINV: 1008.5029 LF 18" HDPE @ -17.2%27 LF 24"HDPE @ 5.6%CONNECT TO EXST 8" WMW/ WET TAP AND VALVEFESINV: 1012.00FESINV: 1012.00FESINV: 1012.00FESINV: 1011.25CBMHRIM: 1021.75INV: 1016.85CBMHRIM: 1021.41INV: 1013.80CBMHRIM: 1019.08INV: 1012.60CBMHRIM: 1021.78INV: 1013.5531 LF 15" HDPE @ 5.0%CBMHRIM: 1020.79INV: 1012.36CBMHRIM: 1021.30INV (E): 1015.23INV (N/S/W): 1013.23CBMHRIM: 1020.85INV: 1013.90CBMHRIM: 1021.09INV: 1017.06CBMHRIM: 1021.29INV: 1016.79CBMHRIM: 1026.08INV: 1015.6175 LF 15" HDPE @ 0.7%161 LF 15" PVC SCH 40 @ 0.7%238 LF 18 " HDPE @ 1. 0 %87 LF 30" PVCSCH 40 @ 1.0%36 LF 36" HDPE @ 1.0%32 LF 15" RCP @ 4.9%109 LF 15 " H D P E @ 2. 9 %23 LF 15" HDPE @ 2.9%25 LF 18" HDPE @ 1.0%CBMHRIM: 1016.00INV: 1011.5040 LF 24" HDPE @ 1.5%80 LF 18" R C P @ 1. 5 % 203 LF 15 " R C P @ 1. 5 %NEW VALLEY GUTTERCASTING ON EXISTINGSTRUCTURENEW VALLEY GUTTERCASTING ON EXISTINGSTRUCTURENEW HYDRANTAND GATE VALVENEW HYDRANTAND GATE VALVE8" DIPNEW HYDRANTAND GATE VALVE6" DIP AND 6" G.V.6" DIPCAP WATERMAINCBRIM: 1020.74INV: 1017.27CBMHRIM: 1021.50INV: 1016.14VERTICAL 45° BENDINV: 1010.988" DIP8X6 TEE8X6 REDUCER4" DIP6" DIPCBMHRIM: 1029.49INV:CBMHRIM: 1029.49INV:CBMHRIM: 1016.16INV:64 LF 15" RCP @ 1.0%SEE SHEET C402SEE SHEET C401WET POND NWLWET POND NWL© CNH ARCHITECTS, INC.CNH NO.:REVISIONS:DATE:7300 147TH WEST STREET SUITE 504APPLE VALLEY, MN 55124(952) 431-4433CITY SUBMITTAL - NOT FOR CONSTRUCTIONLakeville Fire Station 2240512/23/20263524 Labore RoadWhite Bear Lake, MN 55110651.481.9120 (f) 651.481.9201www.larsonengr.comLarsonEngineering, Inc.Lakeville, MNTELEPHONE LINEFIBER OPTIC UNDERGROUND LINEELECTRIC UNDERGROUND LINEELECTRIC OVERHEAD LINETELEPHONE UNDERGROUND LINESTORM SEWER PIPESANITARY SEWER PIPENATURAL GAS UNDERGROUND LINEWATERMAIN PIPELIGHT POLESTORM MANHOLEFLARED ENDCURB INLETCATCH BASINWATER SHUTOFFGATE VALVE & BOXHYDRANTSANITARY MANHOLEDRAINTILE PIPEUTILITY NOTES1. It is the responsibility of the contractor to perform or coordinate all necessary utility connectionsand relocations from existing utility locations to the proposed building, as well as to all onsiteamenities. These connections include but are not limited to water, sanitary sewer, cable TV,telephone, gas, electric, site lighting, etc.2. All service connections shall be performed in accordance with state and local standardspecifications for construction. Utility connections (sanitary sewer, watermain, and storm sewer)may require a permit from the City.3. The contractor shall verify the elevations at proposed connections to existing utilities prior to anydemolition or excavation. All elevations with an asterisk (*) shall be field verified. If elevationsvary significantly, notify the Engineer for further instructions.4. The contractor shall notify all appropriate engineering departments and utility companies 72hours prior to construction. All necessary precautions shall be made to avoid damage toexisting utilities.5. Storm sewer requires testing in accordance with Minnesota plumbing code 4714.1107 wherelocated within 10 feet of waterlines or the building.6. HDPE storm sewer piping shall meet ASTM F2306 and fittings shall meet ASTM D3212 jointpressure test. Installation shall meet ASTM C2321.7. All RCP pipe shown on the plans shall be MN/DOT class 3.8. Maintain a minimum of 7 ½' of cover over all water lines and sanitary sewer lines. Where 7 ½' ofcover is not provided, install 2” rigid polystyrene insulation (MN/DOT 3760) with a thermalresistance of at least 5 and a compressive strength of at least 25 psi. Insulation shall be 8' wide,centered over pipe with 6” sand cushion between pipe and insulation. Where depth is less than5', use 4” of insulation.9. Install water lines 18” above sewers. Where the sewer is less than 18" below the water line (orabove), install sewer piping of materials approved for inside building use for 10 feet on each sideof the crossing.10. All watermain piping shall be class 52 ductile iron pipe unless noted otherwise.11. See Project Specifications for bedding requirements.12. Pressure test and disinfect all new watermains in accordance with state and local requirements.13. Sanitary sewer piping shall be PVC, SDR-35 for depths less than 12', PVC SDR-26 for depthsbetween 12' and 26', and class 52 D.I.P. for depths of 26' or more.14. A structure adjustment shall include removing and salvaging the existing casting assembly,removing existing concrete rings to the precast section. Install new rings and salvaged casting toproposed grades, cleaning casting flange by mechanical means to insure a sound surface andinstall an external chimney seal from casting to precast section. Chimney seals shall beInfi-Shield Uni-Band or an approved equal.SYMBOL LEGENDUtility PlanC401NORTH0306015EXHIBIT IPage 384 of 445 DWGFIWP GFIWP GFIWPGFIWPGFIWPGFIWP GFIWP GFIWP GFIWP GFIWP AA4 @ 30' AA4 @ 30' AA4 @ 30'AA4 @ 30' AA3 @ 30' AA3 @ 30' AA3 @ 30'AA3 @ 30' AA3 @ 30' AA3 @ 30' AA3 @ 30' AA3 @ 30' AA3 @ 30' AA3 @ 30' EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333' EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333'EE @ 16.333'FF @ 3' FF @ 3' FF @ 3' FF @ 3' FF @ 3' FF @ 3' FF @ 3' FF @ 3' FF @ 3' 0.00 0.00 0.00 0.00 0.01 0.01 0.02 0.04 0.05 0.06 0.10 0.18 0.30 0.35 0.36 0.36 0.32 0.24 0.19 0.13 0.08 0.05 0.03 0.03 0.03 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.01 0.02 0.03 0.05 0.07 0.09 0.12 0.24 0.39 0.45 0.45 0.43 0.40 0.31 0.22 0.15 0.09 0.06 0.05 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.03 0.03 0.03 0.03 0.02 0.02 0.02 0.02 0.02 0.02 0.01 0.02 0.01 0.00 0.00 0.00 0.00 0.01 0.02 0.04 0.08 0.11 0.13 0.18 0.32 0.50 0.56 0.55 0.54 0.48 0.38 0.27 0.18 0.12 0.09 0.07 0.07 0.07 0.07 0.07 0.07 0.08 0.07 0.08 0.07 0.07 0.07 0.06 0.06 0.05 0.04 0.03 0.03 0.03 0.03 0.03 0.03 0.00 0.00 0.01 0.01 0.01 0.03 0.05 0.10 0.15 0.19 0.25 0.42 0.64 0.69 0.69 0.66 0.59 0.45 0.32 0.22 0.15 0.12 0.11 0.11 0.11 0.12 0.12 0.13 0.13 0.14 0.14 0.14 0.14 0.14 0.13 0.12 0.11 0.10 0.09 0.08 0.08 0.07 0.07 0.07 0.00 0.01 0.01 0.01 0.01 0.04 0.08 0.14 0.20 0.26 0.31 0.51 0.77 0.85 0.87 0.83 0.73 0.58 0.43 0.32 0.23 0.19 0.17 0.18 0.20 0.22 0.23 0.23 0.24 0.24 0.26 0.27 0.28 0.28 0.27 0.25 0.22 0.21 0.19 0.18 0.16 0.15 0.15 0.13 0.00 0.01 0.01 0.02 0.02 0.05 0.11 0.21 0.28 0.38 0.44 0.68 0.96 1.08 1.10 1.02 0.89 0.75 0.59 0.45 0.33 0.28 0.27 0.29 0.33 0.39 0.41 0.39 0.38 0.36 0.41 0.46 0.50 0.51 0.48 0.43 0.40 0.39 0.35 0.33 0.32 0.30 0.27 0.24 0.01 0.01 0.02 0.02 0.03 0.07 0.15 0.30 0.39 0.51 0.64 1.05 1.38 1.40 1.43 1.34 1.21 1.23 0.94 0.98 0.72 0.66 0.68 0.67 0.81 1.05 1.12 0.95 0.81 0.81 0.84 1.00 1.20 1.18 0.95 0.81 0.80 0.76 0.69 0.63 0.58 0.51 0.44 0.38 0.01 0.01 0.02 0.03 0.05 0.09 0.21 0.40 0.52 0.66 0.84 1.17 1.65 1.69 1.76 1.72 1.60 1.65 1.54 1.46 1.23 1.16 1.19 1.21 1.37 1.55 1.57 1.53 1.38 1.39 1.43 1.61 1.70 1.68 1.52 1.33 1.28 1.21 1.11 1.01 0.89 0.76 0.64 0.53 0.01 0.02 0.02 0.05 0.07 0.12 0.28 0.51 0.65 0.79 0.96 1.48 1.78 1.78 1.83 1.82 1.76 1.69 1.61 1.53 1.43 1.34 1.35 1.43 1.57 1.66 1.69 1.67 1.61 1.58 1.65 1.76 1.79 1.77 1.71 1.59 1.54 1.51 1.44 1.32 1.14 0.93 0.75 0.61 0.01 0.02 0.03 0.06 0.10 0.17 0.36 0.63 0.77 0.91 1.04 1.35 1.63 1.71 1.77 1.78 1.77 1.71 1.65 1.56 1.46 1.38 1.39 1.47 1.60 1.70 1.73 1.70 1.66 1.64 1.70 1.79 1.84 1.82 1.77 1.69 1.64 1.61 1.55 1.43 1.25 1.01 0.80 0.63 0.01 0.02 0.04 0.07 0.12 0.19 0.41 0.74 0.90 1.03 1.12 1.31 1.53 1.58 1.61 1.62 1.62 1.59 1.55 1.47 1.38 1.33 1.34 1.40 1.51 1.60 1.63 1.59 1.56 1.56 1.60 1.68 1.73 1.74 1.68 1.60 1.59 1.58 1.52 1.41 1.23 0.98 0.79 0.63 0.02 0.03 0.05 0.08 0.15 0.23 0.47 0.85 1.05 1.18 1.23 1.35 1.48 1.44 1.42 1.40 1.39 1.32 1.25 1.22 1.17 1.17 1.18 1.21 1.27 1.30 1.32 1.32 1.33 1.32 1.35 1.38 1.40 1.40 1.40 1.37 1.37 1.51 1.48 1.39 1.10 0.85 0.71 0.56 0.02 0.03 0.05 0.09 0.18 0.30 0.66 1.10 1.21 1.30 1.31 1.31 1.34 1.26 1.18 1.13 1.10 1.03 0.95 0.91 0.89 0.87 0.88 0.90 0.93 0.94 0.95 0.96 0.95 0.95 0.95 0.95 0.94 0.94 0.93 0.89 0.89 1.03 0.89 1.01 0.71 0.52 0.45 0.36 0.02 0.03 0.06 0.09 0.18 0.33 0.87 1.22 1.28 1.36 1.33 1.24 1.19 1.07 0.95 0.91 0.87 0.78 0.71 0.66 0.62 0.61 0.61 0.62 0.63 0.64 0.64 0.66 0.65 0.63 0.61 0.58 0.55 0.54 0.53 0.51 0.51 0.53 0.53 0.47 0.23 0.29 0.22 0.19 0.02 0.03 0.06 0.10 0.18 0.33 0.85 1.24 1.30 1.36 1.32 1.19 1.07 0.91 0.78 3.50 2.18 46.26 1.12 7.16 7.01 0.98 45.16 0.48 46.84 0.92 7.75 2.31 2.55 45.85 0.41 0.33 0.33 0.32 0.32 0.32 0.33 0.33 0.31 0.29 0.26 0.21 0.16 0.12 0.02 0.03 0.05 0.09 0.17 0.28 0.63 1.11 1.26 1.32 1.28 1.13 0.97 0.78 0.63 0.51 0.44 0.36 0.32 0.21 0.18 0.21 0.18 0.19 0.19 0.18 0.19 0.17 0.17 0.17 0.17 0.17 0.17 0.17 0.16 0.15 0.14 0.12 0.11 0.09 0.02 0.03 0.05 0.08 0.15 0.22 0.51 0.96 1.16 1.21 1.18 1.07 0.89 0.68 0.52 0.39 0.30 0.25 0.20 0.09 0.09 0.09 0.09 0.09 0.09 0.09 0.08 0.09 0.08 0.09 0.09 0.09 0.10 0.09 0.09 0.09 0.08 0.07 0.07 0.06 0.02 0.03 0.05 0.08 0.12 0.19 0.50 0.94 1.09 1.12 1.11 1.02 0.84 0.62 0.44 0.31 0.24 0.19 0.06 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.05 0.04 0.04 0.04 0.02 0.02 0.04 0.07 0.11 0.21 0.51 0.92 1.07 1.08 1.08 1.00 0.80 0.57 0.39 0.26 0.19 0.15 0.03 0.03 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.03 0.03 0.03 0.03 0.03 0.02 0.02 0.02 0.04 0.07 0.11 0.18 0.49 0.92 1.08 1.11 1.09 0.98 0.77 0.03 0.03 0.03 0.03 0.03 0.03 0.03 0.03 0.03 0.03 0.03 0.02 0.02 0.02 0.02 0.02 0.01 0.02 0.04 0.07 0.13 0.20 0.48 0.93 1.13 1.18 1.13 0.98 0.75 0.03 0.03 0.03 0.04 0.03 0.03 0.04 0.03 0.03 0.03 0.03 0.02 0.02 0.02 0.02 0.01 0.01 0.02 0.04 0.07 0.15 0.25 0.59 1.07 1.21 1.26 1.18 0.97 0.73 0.48 0.03 0.04 0.04 0.05 0.05 0.04 0.05 0.04 0.04 0.04 0.03 0.03 0.02 0.02 0.01 0.01 0.01 0.02 0.04 0.07 0.15 0.29 0.79 1.18 1.21 1.26 1.19 0.95 0.69 0.46 0.04 0.05 0.06 0.07 0.07 0.07 0.07 0.07 0.06 0.06 0.05 0.04 0.03 0.02 0.01 0.01 0.01 0.02 0.04 0.07 0.15 0.29 0.80 1.14 1.17 1.23 1.15 0.91 0.66 0.45 0.11 0.11 0.11 0.11 0.11 0.10 0.09 0.07 0.03 0.02 0.02 0.01 0.02 0.04 0.07 0.15 0.25 0.59 1.00 1.09 1.14 1.06 0.87 0.66 0.46 0.17 0.18 0.17 0.18 0.18 0.17 0.17 0.13 0.04 0.02 0.02 0.01 0.02 0.04 0.06 0.13 0.19 0.41 0.76 0.92 1.00 0.96 0.84 0.67 0.50 0.26 0.26 0.26 0.26 0.27 0.27 0.26 0.21 0.07 0.02 0.03 0.01 0.02 0.03 0.06 0.10 0.14 0.35 0.66 0.78 0.84 0.87 0.82 0.70 0.57 0.46 0.40 0.41 0.36 0.38 0.36 0.36 0.36 0.37 0.36 0.36 0.29 0.11 0.04 0.04 0.01 0.02 0.03 0.05 0.09 0.16 0.35 0.60 0.70 0.79 0.84 0.96 0.79 0.76 0.63 0.64 0.74 0.82 0.49 0.44 0.43 0.45 0.46 0.45 0.44 0.37 0.15 0.06 0.05 0.01 0.02 0.04 0.07 0.13 0.22 0.43 0.68 0.85 0.99 1.20 1.50 1.23 1.38 1.16 1.16 1.34 1.42 0.59 0.50 0.48 0.53 0.57 0.58 0.58 0.48 0.19 0.09 0.06 0.02 0.02 0.04 0.09 0.17 0.28 0.47 0.70 0.89 1.07 1.32 1.49 1.51 1.48 1.44 1.51 1.91 2.17 1.94 1.92 1.84 1.39 0.92 0.67 0.55 0.54 0.60 0.68 0.73 0.78 0.64 0.27 0.13 0.09 0.02 0.03 0.05 0.09 0.16 0.28 0.44 0.65 0.82 0.99 1.19 1.36 1.44 1.41 1.46 1.72 2.26 2.65 2.43 2.43 2.26 1.70 1.11 0.76 0.60 0.58 0.68 0.82 0.91 1.02 0.89 0.41 0.19 0.12 0.03 0.04 0.06 0.10 0.17 0.27 0.42 0.58 0.73 0.87 1.02 1.14 1.20 1.27 1.47 1.88 2.67 3.11 2.72 2.78 2.78 2.06 1.31 0.88 0.67 0.63 0.74 0.92 1.09 1.17 1.10 0.71 0.23 0.13 0.04 0.05 0.07 0.11 0.17 0.27 0.40 0.54 0.66 0.75 0.84 0.91 0.98 1.13 1.42 1.92 2.77 3.36 2.99 3.07 2.96 2.18 1.43 0.97 0.73 0.67 0.79 0.97 1.14 1.22 1.14 0.73 0.24 0.13 0.04 0.06 0.08 0.12 0.18 0.26 0.37 0.49 0.56 0.62 0.68 0.72 0.78 0.97 1.31 1.88 2.84 3.37 2.96 3.09 3.12 2.33 1.50 1.03 0.78 0.72 0.82 0.98 1.07 1.17 1.02 0.46 0.21 0.13 0.05 0.07 0.09 0.13 0.19 0.26 0.36 0.43 0.48 0.53 0.56 0.60 0.67 0.84 1.19 1.73 2.58 3.21 2.88 3.02 2.93 2.19 1.47 1.04 0.83 0.77 0.84 0.94 0.99 1.05 0.85 0.33 0.15 0.11 0.06 0.09 0.11 0.15 0.21 0.27 0.34 0.40 0.43 0.46 0.48 0.50 0.56 0.72 1.03 1.53 2.34 2.78 2.48 2.66 2.65 2.06 1.40 1.03 0.84 0.81 0.87 0.92 0.93 0.93 0.77 0.30 0.12 0.10 0.07 0.10 0.14 0.18 0.24 0.29 0.34 0.38 0.40 0.41 0.43 0.45 0.51 0.66 0.90 1.27 1.89 2.35 2.23 2.37 2.18 1.70 1.24 0.97 0.84 0.83 0.89 0.90 0.90 0.89 0.73 0.30 0.12 0.10 0.08 0.12 0.17 0.22 0.26 0.31 0.35 0.37 0.39 0.40 0.41 0.42 0.48 0.61 0.83 1.14 1.56 1.72 1.44 1.51 1.73 1.47 1.13 0.93 0.82 0.82 0.88 0.92 0.93 0.93 0.77 0.30 0.12 0.10 0.09 0.13 0.19 0.25 0.30 0.34 0.36 0.38 0.39 0.39 0.40 0.42 0.48 0.61 0.79 1.01 1.29 0.84 1.16 1.40 1.23 1.01 0.87 0.79 0.78 0.85 0.94 1.00 1.05 0.85 0.34 0.15 0.12 0.09 0.14 0.20 0.28 0.34 0.36 0.38 0.40 0.41 0.41 0.42 0.43 0.49 0.61 0.79 0.96 1.22 0.77 1.13 1.33 1.16 0.94 0.81 0.74 0.74 0.84 0.99 1.07 1.18 1.01 0.46 0.22 0.14 0.09 0.15 0.22 0.30 0.36 0.40 0.43 0.45 0.46 0.47 0.47 0.48 0.52 0.63 0.81 1.05 1.36 1.22 1.48 1.27 0.99 0.79 0.70 0.69 0.81 0.99 1.16 1.24 1.16 0.74 0.25 0.15 0.10 0.16 0.23 0.33 0.40 0.45 0.50 0.52 0.55 0.56 0.55 0.55 0.57 0.67 0.87 1.17 1.69 1.99 1.80 2.01 1.97 1.52 1.05 0.79 0.67 0.66 0.78 0.96 1.13 1.20 1.13 0.75 0.26 0.16 0.10 0.16 0.25 0.34 0.44 0.51 0.57 0.63 0.66 0.68 0.67 0.65 0.65 0.75 0.96 1.35 1.99 2.43 2.26 2.51 2.35 1.80 1.19 0.84 0.67 0.65 0.74 0.89 0.98 1.08 0.96 0.49 0.25 0.16 0.10 0.17 0.26 0.36 0.45 0.56 0.65 0.77 0.85 0.88 0.86 0.79 0.75 0.83 1.07 1.55 2.37 2.87 2.55 2.90 2.86 2.13 1.37 0.95 0.74 0.68 0.74 0.81 0.86 0.91 0.75 0.37 0.22 0.18 0.09 0.17 0.26 0.36 0.46 0.57 0.71 0.87 1.02 1.09 1.03 0.91 0.84 0.90 1.15 1.63 2.41 3.05 2.78 3.15 3.00 2.24 1.52 1.08 0.84 0.76 0.79 0.82 0.81 0.80 0.68 0.37 0.25 0.21 0.08 0.16 0.25 0.36 0.45 0.58 0.76 1.00 1.18 1.28 1.19 1.06 0.93 0.96 1.20 1.66 2.43 2.87 2.62 3.02 2.97 2.34 1.63 1.22 0.99 0.90 0.89 0.87 0.83 0.80 0.69 0.43 0.31 0.26 0.07 0.14 0.24 0.34 0.42 0.53 0.70 0.95 1.18 1.22 1.22 1.05 0.94 1.00 1.22 1.59 2.19 2.67 2.58 2.98 2.75 2.22 1.69 1.37 1.18 1.09 1.04 1.00 0.96 0.90 0.77 0.52 0.39 0.33 0.04 0.07 0.10 0.15 0.23 0.31 0.42 0.65 1.07 0.90 1.06 0.77 0.76 0.85 1.07 1.41 1.91 2.18 2.01 2.35 2.48 2.15 1.75 1.50 1.35 1.26 1.22 1.17 1.09 0.99 0.83 0.60 0.46 0.39 0.02 0.03 0.05 0.06 0.09 0.14 0.20 0.29 0.39 0.46 0.49 0.51 0.56 0.70 0.92 1.21 1.59 1.90 1.83 1.53 1.32 1.27 1.18 1.16 1.20 1.31 1.45 1.50 1.91 2.09 2.13 1.86 1.63 1.48 1.41 1.39 1.37 1.31 1.18 1.02 0.84 0.62 0.48 0.40 0.02 0.02 0.03 0.05 0.08 0.11 0.15 0.20 0.26 0.31 0.37 0.44 0.51 0.63 0.81 1.03 1.32 1.51 1.56 1.41 1.33 1.26 1.19 1.16 1.22 1.34 1.45 1.50 1.68 1.75 1.72 1.57 1.43 1.37 1.37 1.40 1.38 1.30 1.18 1.00 0.80 0.60 0.48 0.40 0.02 0.02 0.03 0.04 0.06 0.08 0.12 0.15 0.20 0.24 0.30 0.38 0.46 0.57 0.71 0.87 1.07 1.24 1.30 1.29 1.26 1.18 1.14 1.14 1.17 1.26 1.37 1.41 1.46 1.47 1.40 1.32 1.27 1.23 1.25 1.29 1.27 1.20 1.08 0.89 0.72 0.58 0.46 0.37 0.01 0.02 0.02 0.03 0.04 0.06 0.08 0.10 0.13 0.17 0.22 0.29 0.36 0.46 0.58 0.69 0.81 1.06 1.18 1.20 1.12 0.98 0.98 0.99 1.00 1.04 1.23 1.31 1.32 1.22 1.07 1.05 1.03 1.01 1.00 1.13 1.22 1.16 0.96 0.71 0.60 0.48 0.37 0.29 0.01 0.01 0.01 0.02 0.03 0.03 0.04 0.06 0.07 0.09 0.12 0.15 0.19 0.25 0.32 0.38 0.45 0.65 0.88 0.87 0.65 0.53 0.54 0.56 0.55 0.56 0.73 0.94 0.93 0.71 0.57 0.56 0.57 0.53 0.51 0.61 0.78 0.74 0.52 0.36 0.30 0.26 0.19 0.15 0.01 0.01 0.01 0.01 0.02 0.02 0.03 0.03 0.04 0.05 0.06 0.07 0.07 0.09 0.14 0.15 0.20 0.26 0.31 0.30 0.26 0.21 0.20 0.23 0.20 0.24 0.30 0.34 0.33 0.29 0.23 0.21 0.23 0.20 0.23 0.28 0.30 0.29 0.24 0.18 0.12 0.10 0.07 0.04 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.02 0.02 0.02 0.03 0.04 0.05 0.07 0.10 0.13 0.15 0.16 0.16 0.16 0.14 0.12 0.12 0.12 0.15 0.16 0.17 0.17 0.17 0.15 0.13 0.12 0.12 0.14 0.15 0.15 0.15 0.13 0.11 0.08 0.06 0.04 0.03 0.00 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.02 0.03 0.03 0.04 0.05 0.06 0.07 0.07 0.07 0.07 0.07 0.07 0.07 0.07 0.08 0.08 0.08 0.08 0.08 0.08 0.08 0.08 0.07 0.07 0.07 0.07 0.07 0.06 0.05 0.04 0.03 0.03 0.02 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.02 0.02 0.03 0.03 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.05 0.05 0.05 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.04 0.03 0.03 0.02 0.02 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.02 0.01 0.01 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.00 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.01 0.01 0.01 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 © CNH ARCHITECTS, INC. CNH NO.: REVISIONS: DATE: 7300 147TH WEST STREET SUITE 504 APPLE VALLEY, MN 55124 (952) 431-4433 123456789 10 11 12 13 14 15 A B C D E F G H J K L M A B C D E F G H J K L M 23456789 10 11 12 13 14 151 N P Q R 16 17 18 16 17 18 N P Q R I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED ARCHITECT UNDER THE LAWS OF THE STATE OFDATE:LIC. NO.:DATE:LIC. NO.:PRINT NAME:SIGNATURE:PRINT NAME:SIGNATURE:DATE:LIC. NO.:PRINT NAME:SIGNATURE:DATE:LIC. NO.:PRINT NAME:SIGNATURE:DATE:LIC. NO.:PRINT NAME:SIGNATURE:1112 North 5th StreetMinneapolis, MN 55411(612) 343-59651624 North Riverfront DriveMankato, MN 56001(507) 625-7869C:\Revit local\2024-Revit\25-013-R24-EDI-DOLEJS - Lakeville Combined Fire Station - Electrical_gregneva.rvt12/29/2025 11:25:27 AMCITY SUBMITTAL - NOT FOR CONSTRUCTION E1.2Lakeville Combined Fire StationLakeville, MN24051 Electrical Site Plan - PhotometricsMINNESOTA 12/29/25EDI-DOLEJS #25-01340290JAY S. HRUBY PE12/29/25 1" = 30'-0"E1.2 1Electrical Site Plan - Photometrics 1. A. B. C. D. E. F. G. H. I. 2. A. B. C. D. E. F. G. H. I. 3. A. B. C. D. E. F. G. H. I. 4. A. B. C. D. E. F. G. H. I. 5. A. B. C. D. E. F. G. H. I. DESCRIPTION OF CONTROLS: SITE LIGHTING STANDARDS AND BUILDING MOUNTED FIXTURES SHALL BE CONTROLLED THROUGHT SEPERATE CONTROL POINTS THROUGH RELAY CONTROLLED BY ASTRONOMICAL TIME-CLOCK. SCHEDULE IS PROGRAMMABLE WITH AN INITIAL SETTING OF 'ON' AT DUSK , 'OFF' AT DAWN. LIGHTING SHALL DIM AFTER PRESET TIME OF 10:00PM TO 50% OUTPUT UNTIL DAWN. LIGHTING SHALL RAISE IN INTENSITY FOR A PRESET DURATION OF TIME WHEN MOTION IS DETECTED. LUMINAIRE SCHEDULE: TYPE AA3: LIGHT SOURCE - LED - TYPE 3 DISTRIBUTION WATTAGE - 93 INITIAL LUMEN OUTPUT - 8404 CRI - 80 COLOR TEMPERATURE - 3000K OPTIONS - HOUSE SIDE SHIELD LLF - 1.0 BUG RATING - B1-U0-G3 MOUNTING - 27' RSS POLE ON 3' BASE TYPE AA4: LIGHT SOURCE - LED - TYPE FT DISTRIBUTION WATTAGE - 93 INITIAL LUMEN OUTPUT - 8309 CRI - 80 COLOR TEMPERATURE - 3000K OPTIONS - HOUSE SIDE SHIELD LLF - 1.0 BUG RATING - B1-U0-G2 MOUNTING - 27' RSS POLE ON 3' BASE TYPE DD: LIGHT SOURCE - LED WATTAGE - 7 INITIAL LUMEN OUTPUT - 700 CRI - 80 COLOR TEMPERATURE - 3000K OPTIONS - VISUAL COMFORT OPTICS LLF - 1.0 BUG RATING - B0-U0-G0 MOUNTING - 10' AFG TYPE EE: LIGHT SOURCE - LED WATTAGE - 32 INITIAL LUMEN OUTPUT - 3015 CRI - 80 COLOR TEMPERATURE - 3000K OPTIONS - NONE LLF - 1.0 BUG RATING - B1-U0-G1 MOUNTING - 16'-4" AFG TYPE FF: LIGHT SOURCE - LED WATTAGE - 13.5 INITIAL LUMEN OUTPUT - 858 CRI - 80 COLOR TEMPERATURE - 3000K OPTIONS - NONE LLF - 1.0 BUG RATING - B0-U1-G0 MOUNTING - GROUND NORTH EXHIBIT J Page 385 of 445 © CNH ARCHITECTS, INC.CNH NO.:24051Project Issue DateFile Path5/31/2007 11:22:00 AM 02.26.2026REVISIONS:DATE:7300 147TH WEST STREET SUITE 504APPLE VALLEY, MN 55124(952) 431-4433123456789101112131415ABCDEFGHJKLMABCDEFGHJKLM234567891011121314151NPQR161718161718NPQRLakeville Fire Station Combined Lakeville, MN DATE:LIC. NO.: PRINT NAME: SIGNATURE: LICENSED PROFESSIONAL LANDSCAPE ARCHITECT DIRECT SUPERVISION AND THAT I AM A DULY OR REPORT WAS PREPARED BY ME OR UNDER MY I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION THE STATE OF MINNESOTA.UNDER THE LAWS OF 800 WASHINGTON AVE N. #103MINNEAPOLIS, MN 55401www.hkgi.com42954 Bryan Harjes, PLATree Removal andPreservation TabulationL1.2CITY SUBMITTAL - NOT FOR CONSTRUCTIONEXHIBIT KPage 386 of 445 10261026102510231021102010191017101510131012101110081012 10131014101510171018102010221023102510271028103010321033103510371040103910381037103610351034 1033103210311030102910281027102610251025102310221020101810171015101410131014101510161017101810171019102010291028102710251026102410231013101410161017101810191020102110221030 103210331034 1036 10371036102210231024102510261026 10361033103510211023102210211023101810191020102110221020U PSTRM (INV)ELEV=1019.40CGPHHHSTRM (INV)ELEV=1026.40PHMECFHFPVPPMCCCMMPPMMVVFFFlEl lW SMH SSWRR=1028.08E (10INCH CLAY)N (10inch CLAY)S (10INCH CLAY)1014.631000.86INV:INV:1010.06INV:INV:INV:INV:FESMH SSWRR=1020.13S (8INCH PVC)N (8inch PVC)996.94996.93INV:INV:INV:INV:INV:INV:HFESTELEV=1019.52FESTELEV=1026.41CBR=1032.65N (12INCH RCP)1030.40INV:INV:INV:INV:INV:INV:CBR=1013.48E (15INCH RCP)NW (15inch RCP)1008.161008.16INV:INV:INV:INV:INV:INV:CBR=1021.25E (15INCH RCP)1017.37INV:INV:INV:INV:INV:INV:CBR=1013.39W (15INCH RCP)N (15inch RCP)1009.261009.17INV:INV:INV:INV:INV:INV:CBR=1021.21S (15INCH RCP)W (15inch RCP)NE (18INCH RCP)1017.261017.17INV:INV:1017.25INV:INV:INV:INV:1026.101026.001026.10CBR=1029.87W (15INCH RCP)E (15inch RCP)N (6INCH PVC)SE (6inch PVC)1026.421026.32INV:INV:1027.42INV:1027.47INV:INV:INV:CBR=1030.72W (15INCH RCP)E (15inch RCP)NW (6INCH PVC)1026.901026.80INV:INV:1027.20INV:INV:INV:INV:CBR=1033.28W (15INCH RCP)1029.56INV:INV:INV:INV:INV:INV:CBR=1035.17E (18INCH RCP)1031.42INV:INV:INV:INV:INV:INV:CBR=1031.71S (12INCH RCP)1028.59INV:INV:INV:INV:INV:INV:CBR=1017.22SE (15INCH RCP)1013.77INV:INV:INV:INV:INV:INV:DMH STRMR=1017.31? (?INCH ?)INV:INV:INV:INV:INV:INV:1027.271026.49102110191017101310111009100710181016101410121008100610181027102610231022102110221027102610241022102410231004100310021012101410131011101110131014101210171024101510201010102510251025100510101015101510101023102210221023 10281029103010311032103310341035102210231023102210211020101910181023102310241025102610271028102910301022© CNH ARCHITECTS, INC.CNH NO.:24051Project Issue DateFile Path5/31/2007 11:22:00 AM 12.30.2025REVISIONS:DATE:7300 147TH WEST STREET SUITE 504APPLE VALLEY, MN 55124(952) 431-4433123456789101112131415ABCDEFGHJKLMABCDEFGHJKLM234567891011121314151NPQR161718161718NPQRLakeville Fire Station Combined Lakeville, MN DATE:LIC. NO.: PRINT NAME: SIGNATURE: LICENSED PROFESSIONAL LANDSCAPE ARCHITECT DIRECT SUPERVISION AND THAT I AM A DULY OR REPORT WAS PREPARED BY ME OR UNDER MY I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION THE STATE OF MINNESOTA.UNDER THE LAWS OF 800 WASHINGTON AVE N. #103MINNEAPOLIS, MN 55401www.hkgi.com42954 Bryan Harjes, PLATree Removal andPreservation Reference PlanL1.3LEGENDEXISTING TREE TO REMAINLIMIT OF DISTURBANCEPROPOSED FIRESTATIONNOTES1. ALL EXISTING TREES WITHIN LIMIT OF DISTURBANCETO BE REMOVEDAREA 1AREA 2Page 387 of 445 © CNH ARCHITECTS, INC.CNH NO.:24051Project Issue DateFile Path5/31/2007 11:22:00 AM 12.30.2025REVISIONS:DATE:7300 147TH WEST STREET SUITE 504APPLE VALLEY, MN 55124(952) 431-4433123456789101112131415ABCDEFGHJKLMABCDEFGHJKLM234567891011121314151NPQR161718161718NPQRLakeville Fire Station Combined Lakeville, MN DATE:LIC. NO.: PRINT NAME: SIGNATURE: LICENSED PROFESSIONAL LANDSCAPE ARCHITECT DIRECT SUPERVISION AND THAT I AM A DULY OR REPORT WAS PREPARED BY ME OR UNDER MY I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION THE STATE OF MINNESOTA.UNDER THE LAWS OF 800 WASHINGTON AVE N. #103MINNEAPOLIS, MN 55401www.hkgi.com42954 Bryan Harjes, PLATree Removal andPreservation PlanL1.4TREE TO BE REMOVEDTREE TO BE REMOVEDAREA 1AREA 2Page 388 of 445 PCGPHHHPHMECFHFFFEEEFDODD BLVDGRANBY LANEOUTDOOR F ITNESS1021101910171013101110091007101810161014101210081006 101810261023102210211022102210241023100410031002101210141013101110111013101410121017102410151020101010251025100510101015101510101023 102210221023 102810291030103110321033103410351022102310231022102110201019101810231023 102410251026102710281029103010221 0 2 1 10231024102510261027102810301031103210331029 103010311032103310341035102210241023102510261023 1027102810251022102310221023103010261027102810291022101 9 1020103310291034103510271 - MSSpring Snow Crabapple4 - QBSwamp White Oak1 - ABAutumn BrillianceApple Serviceberry1 - ABAutumn BrillianceApple Serviceberry1 - ABAutumn BrillianceApple Serviceberry16 - SHPrairie Dropseed26 - SJMagic Carpet Japanese Spirea38 - SHPrairie Dropseed24 - DLBush Honeysuckle1 - ABAutumn BrillianceApple Serviceberry54 - AMIroquois Beauty™ BlackChokeberry4 - PVShenandoah Switch Grass4 - QBSwamp White OakFLAG, SEE ARCH6 - TB2Technito® Arborvitae6 - TYTaunton'sAnglo-Japanese Yew3 - TC2Stonehenge® Anglo-Japanese Yew6 - SJMagic Carpet Japanese Spirea3 - TC2Stonehenge® Anglo-Japanese Yew5 - TYTaunton'sAnglo-Japanese Yew5 - SJMagic Carpet Japanese Spirea2 - TC2Stonehenge® Anglo-Japanese Yew18 - SHPrairie Dropseed2 - TC2Stonehenge®Anglo-JapaneseYew13 - SJMagic Carpet Japanese Spirea8 - HFFirst Editions®FlowerFull® Hydrangea8 - HFFirst Editions® FlowerFull® Hydrangea7 - HFFirst Editions® FlowerFull® Hydrangea6 - SJMagic Carpet Japanese Spirea11 - SJMagic Carpet Japanese Spirea1 - TC2Stonehenge® Anglo-Japanese Yew5 - TYTaunton'sAnglo-Japanese Yew1 - TC2Stonehenge® Anglo-Japanese Yew38 - RHGro-Low Fragrant Sumac8 - PVShenandoahSwitch Grass6 - PVShenandoah Switch Grass11 - HMJapanese Forest Grass8 - SJMagic Carpet Japanese Spirea11 - SJMagic Carpet Japanese Spirea1 - ABAutumn BrillianceApple Serviceberry107 - RHGro-Low Fragrant Sumac4 - ASSienna Glen® Maple13 - TB2Technito® Arborvitae12 - QECrimson Spire™ Oak3 - BNRiver Birch3 - BNRiver Birch4 - COCommon Hackberry1 - ASSienna Glen® Maple1 - ASSienna Glen® Maple1 - ABAutumn BrillianceApple Serviceberry5 - ABAutumn Brilliance Apple Serviceberry4 - COCommon Hackberry4 - BNRiver Birch4 - BNRiver Birch2 - ASSienna Glen® Maple4 - BNRiver Birch7 - AAArmstrong Red Maple2 - COCommon Hackberry2 - PB6Black Hills Spruce2 - MSSpring Snow Crabapple10 - SHPrairie Dropseed20 - HMJapanese Forest Grass8 - PVShenandoah Switch Grass34 - HMJapanese Forest GrassSYMBOL CODEQTYBOTANICAL / COMMON NAMESIZE CONTAINERDECIDUOUS ORNAMENTAL TREESAB 11Amelanchier x grandiflora 'Autumn Brilliance' / Autumn Brilliance Serviceberry2" Cal. B&BMS3Malus x 'Spring Snow' / Spring Snow Crabapple2" Cal. B&B14SUBTOTAL:DECIDUOUS TREESAA 7Acer rubrum 'Armstrong' / Armstrong Red Maple2.5" Cal. B&BAS 8Acer x freemanii `Sienna` / Sienna Glen® Maple2.5" Cal. B&BBN 18Betula nigra / River Birch6` Ht. B&BCO 10Celtis occidentalis / Common Hackberry2.5" Cal. B&BQB8Quercus bicolor / Swamp White Oak2.5" Cal. B&BQE12Quercus x 'Crimschmidt' / Crimson Spire™ Oak2.5" Cal. B&B63SUBTOTAL:EVERGREEN TREESPB62Picea glauca densata / Black Hills Spruce6` Ht. B&BTB219Thuja occidentalis 'Bail John' / Technito® Arborvitae6` Ht.Cont.21SUBTOTAL:DECIDUOUS SHRUBSAM54Aronia melanocarpa 'Morton' / Iroquois Beauty™ Black Chokeberry#5 Cont.DL 24Diervilla lonicera / Bush Honeysuckle#5 Cont.HF 23Hydrangea arborescens 'BAlful' / First Editions® FlowerFull® Hydrangea#5 Cont.RH 145Rhus aromatica 'Gro-Low' / Gro-Low Fragrant Sumac#5 Cont.SJ 86Spiraea japonica 'Walbuma' / Magic Carpet Japanese Spirea#5 Cont.332SUBTOTAL:EVERGREEN SHRUBSTC212Taxus x media 'SMNTHDC' / Stonehenge® Anglo-Japanese Yew#5 Cont.TY 16Taxus x media 'Tauntonii' / Taunton's Anglo-Japanese Yew#5 Cont.28SUBTOTAL:GRASSESHM65Hakonechloa macra / Japanese Forest Grass#1 Cont.PLANT SCHEDULEL101L1.0Planting Plan© CNH ARCHITECTS, INC.CNH NO.:24051Project Issue DateFile Path5/31/2007 11:22:00 AM 02.26.2026REVISIONS:DATE:7300 147TH WEST STREET SUITE 504APPLE VALLEY, MN 55124(952) 431-4433123456789101112131415ABCDEFGHJKLMABCDEFGHJKLM234567891011121314151NPQR161718161718NPQRLakeville Fire Station Combined Lakeville, MN DATE:LIC. NO.: PRINT NAME: SIGNATURE: LICENSED PROFESSIONAL LANDSCAPE ARCHITECT DIRECT SUPERVISION AND THAT I AM A DULY OR REPORT WAS PREPARED BY ME OR UNDER MY I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION THE STATE OF MINNESOTA.UNDER THE LAWS OF 800 WASHINGTON AVE N. #103MINNEAPOLIS, MN 55401www.hkgi.com42954 Bryan Harjes, PLA0030'60'LEGENDPLANTING BED- ROCK MULCH WITH FABRIC AND DRIP IRRIGATIONSOD WITH IRRIGATIONARTIFICIAL TURF, SEE ARCHITECTURECONTRACTOR TO RESTORE ALL DISTURBED AREAS, SEE CIVILPLANS FOR BASIN REQUIREMENTS AND PROJECT WORK LIMITSCITY SUBMITTAL - NOT FOR CONSTRUCTIONSEE CIVIL FOR BASIN DETAILSLANDSCAPE EDGING (BETWEEN PLANTING BED AND TURF)EXHIBIT LPage 389 of 445 SCBAWasherREF.REF.FillStationToolChestCylinderCartDWFitnessQuartermaster StorageMechanical RoomStorageStair AIT RoomVestibuleLobbyClassroomStorage -Tables & ChairsStorage -Training EquipmentBreakout RoomJanitorRestroomsApparatus BaysApparatus BaysJanitorEquipment RacksStorage -EMSTornado Shelter / Locker RoomMech / ElecRestroom / ShowerRestroomsStair BElevatorFirepoleVestibuleTraining CaptainFire MarshalFire InspectorAdmin Asst.Conference RoomKitchenette / Collab AreaFuture WorkspaceBattalion OfficeCaptain OfficeFirefighter Workroom / DispatchBattalion ChiefFire ChiefEast Training TowerSCBAElectricalWest Training TowerTurnout Gear BFire InspectorTurnout Gear AElectrical Future OfficeWork RoomJanitor / Truck WashGear WashDecon RestroomDecon ShowersAsst. Chief31' - 0 1/2"25' - 8 5/8"46' - 3 1/2"29' - 4"87' - 0 3/8"32' - 8 1/8"69' - 7 1/2"7' - 0 1/2"42' - 0"10' - 0"91' - 7 5/8"48' - 8"47' - 8 1/2"13' - 3"38' - 3 5/8"49' - 1 1/2"50' - 11 1/2"22' - 4 1/2"50' - 4 1/2"59' - 7 5/8"87' - 0 3/8"24' - 3 5/8"78' - 0"18' - 8"91' - 7 5/8"19' - 4"3' - 8 1/2"CS04E1CS04N1CS04A1CS04J1RiserRoom WDWDSCBACompressorKitchenDiningDayroomLaundryStair BStair APantryMech ChaseElevatorFirepoleHotsyTraining MezzanineTraining StorageMechanicalEast Training TowerWest Training TowerTraining HallwayLocker HallwayRestroomDormLocker HallwayDormRestroomLocker HallwayDormRestroomRestroomDormLocker HallwayDormRestroomWellnessLocker HallwayDormRestroomDormRestroomLocker HallwayDormRestroomDormRestroomLocker HallwayDormRestroomLocker HallwayLocker HallwayLocker HallwayPatio22' - 4 5/8"78' - 7"87' - 0 3/8"32' - 8 1/8"71' - 4"8' - 8 1/2"49' - 3"25' - 7 1/8"25' - 10"87' - 3 7/8"24' - 3 5/8"78' - 0"31' - 4 3/8"18' - 8"91' - 7 5/8"23' - 0 1/2"CS04E1CS04N1CS04A1CS04J1Training BalconyEast Training Tower24' - 3 5/8"20' - 11 5/8"West Training Tower21' - 7 5/8"3' - 8 1/2"10' - 3 1/2"22' - 4 5/8" Prefinished composite wall panel; CW-1Aluminum storefront glazing systemPrefinished metal cap flashingBrick masonry unit; BK-1ACM fasciaACM faciaPrefinished metal cap flashingPrefinished composite wall panel; CW-1Aluminum storefront glazing systemACM canopyAluminum storefront glazing systemPrefinished composite wall panel on ; CW-1Aluminum storefront glazing systemCast stone pilasterACM fasciaPrefinished metal cap flashingAluminum storefront glazing systemBrick masonry unit; BK-1Four-fold doorsCast stone archCast stone pilasterACM fasciaPrefinished metal cap flashingAluminum storefront glazing systemBrick masonry unit; BK-1Four-fold doorsCast stone archACM faciaPrefinished composite wall panel; CW-1Halo-lit signagePrefinished composite wall panel; CW-2ACM accent bandingAluminum curtain wall glazing system2' - 11 1/4"14' - 8"19' - 7"9' - 4"28' - 6 1/4"Brick masonry unit; BK-1Brick soldier coursing; BK-2Prefinished metal cap flashingBrick soldier coursing; BK-2Brick masonry unit; BK-1ACM accent bandExtruded aluminum horizontal blade equipment screenRooftop mechanical unitBrick soldier coursing; BK-2Prefinished composite wall panel; CW-2Brick soldier coursing; BK-2Brick soldier coursing; BK-2Brick soldier coursing; BK-2Rooftop mechanical unitExtruded aluminum horizontal blade equipment screenRooftop mechanical unitExtruded aluminum horizontal blade equipment screenACM fasciaAluminum storefront glazing systemPrefinished metal cap flashingPrefinished composite wall panel; CW-1Aluminum storefront glazing systemPrefinished metal cap flashingBrick masonry unit; BK-1ACM canopyPrefinished composite wall panel; CW-2Halo-lit signagePrefhinished composite wall panel; CW-1Prefinished metal cap flashingBrick masonry unit; BK-1Aluminum storefront glazing systemPrefinished composite wall panel; CW-12' - 11 1/4"9' - 0 3/4"25' - 2 1/4"Aluminum storefront glazing system18' - 11"Brick soldier coursing; BK-2Brick masonry unit; BK-1Rooftop mechanical unitExtruded aluminum horizontal blade equipment screenBrick soldier coursing; BK-218' - 11"ACM canopyAluminum storefront glazing systemACM fasciaPrefinished composite wall panel; CW-1Brick masonry unit; BK-1Overhead sectional doorBrick masonry unit; BK-1ACM fasciaPrefinished composite wall panel; CW-1ACM fasciaPrefinished metal cap flashingBrick masonry unit; BK-1Four-fold doorsCast stone pilasterAluminum storefront glazing systemACM fasciaPrefinished metal cap flashingBrick masonry uinit; BK-1Four-fold doorsCast stone pilasterAluminum storefront glazing systemGalvanized steel railing and balcony structure; paint with HPCBrick masonry unit; BK-1Stainless steel checkerplate sillCast stone capCast stone archCast stone arch18' - 11"18' - 3 1/4"Prefinished metal cap flashingAluminum storefront glazing systemPrefinished composite wall panel; CW-2Aluminum storefront glazing systemRooftop mechanical unitExtruded aluminum horizontal blade equipment screen42' - 7 7/8"Brick soldier coursing; BK-2Brick soldier coursing; BK-2Rooftop mechanical unitExtruded aluminum horizontal blade quipment screeBrick soldier coursing; BK-2Extruded aluminum horizontal blade equipment screenBrick soldier coursing; BK-225' - 2 1/4"Prefinished metal cap flashingHalo-lit signagePrefinished composite wall system; CW-1Cast stone pilasterBrick masonry unit; BK-1ACM fasciaACM canopyPrefinished composite wall system; CW-2ACM fasciaCast stone pilasterPrefinished composite wall panel; CW-1Brick masonry unit; BK-1ACM fasciaGalvanized steel railing and balcony structure; paint with HPCAluminum storefront glazing systemBrick masonry unit; BK-1Prefinished metal cap flashingAluminum storefront glazing systemAluminum storefront glazing systemAluminum storefront glazing system18' - 3 1/4"19' - 7"Prefinished metal cap flashingPrefinished metal cap flashingPrefinished metal cap flashingCast stone capGalvanized steel ships ladder; paint with HPCPrefinished composite wall panel; CW-2Brick masonry unit; BK-1Brick soldier coursing; BK-2Brick soldier coursing; BK-231' - 2 1/4"Rooftop mechanical unitExtruded aluminum horizontal blade equipment screenBrick soldier coursing; BK-2Rooftop mechanical unitExtruded aluminum horizontal blade equipment screenBrick soldier coursing; BK-2Brick soldier coursing; BK-218' - 11"18' - 11"7' - 1"16' - 7 7/8"Exterior Material CalculationsWest Elevation:Grade ABrick (Utility)40.3 %Cast Stone20.4 %Composite Wall Panel(Stone-look)18.4 %Glass15.8 %Grade CComposite Wall Panel(Wood-look) 5.1 %East Elevation:Grade ABrick (Utility)47.2 %Cast Stone22.2 %Composite Wall Panel(Stone-look)15.4 %Glass15.2 %North Elevation:Grade ABrick (Utility)40.2 %Composite Wall Panel(Stone-look)38.9 %Glass16.4 %Grade CComposite Wall Panel(Wood-look) 4.5 %South Elevation:Grade ABrick (Utility)42.5 %Cast Stone 6.7 %Composite Wall Panel(Stone-look)34.8 %Glass 5.9 %Grade CComposite Wall Panel(Wood-look)10.0 % Dakota County Surveyor’s Office Western Service Center  14955 Galaxie Avenue  Apple Valley, MN 55124 952.891-7087  Fax 952.891-7127  www.co.dakota.mn.us February 13, 2026 City of Lakeville 20195 Holyoke Ave. Lakeville, MN 55044 Re: DODD COMMONS The Dakota County Plat Commission met on February 11, 2026, to consider the preliminary plat of the above referenced plat. The plat is adjacent to CSAH 9 (179TH St. W.) and CSAH 23 (Cedar Ave.) and is therefore subject to the Dakota County Contiguous Plat Ordinance. The site includes city property for a proposed fire station and an existing water tower site. The right-of- way needs along CSAH 9 (179th Street West) are 75 feet of half right of way, which has been met. There are no planned access locations along 179th Street to this site. Restricted access should be shown along all of CSAH 9 (179th Street West) and CSAH 23. A quit claim deed to Dakota County for restricted access is required with the recording of the plat mylars. The city mentioned that there are no current plans for Outlot C at this time; however, with a future development review, they plan to discuss an internal road system through Outlot C to the existing site to the east. As noted, the existing plat to the east (DOUBLE E CROSSINGS) was platted in 2005 with stipulations that included a temporary right turns only access along CSAH 23. This access will be closed at some point in the future but allowed to remain at this time. The following includes the meeting notes from the 2005 Double E CROSSINGS plat review with the city and Plat Commission regarding the temporary access along CSAH 23: The temporary access on CSAH 23 (Cedar Avenue) will be removed upon the occurrence of any of the following events: •Access is provided to the site (Double E Crossing) from the connection to 179th St. (future CSAH 9) •If the development of the adjacent parcel to the west of Double E Crossing occurs without connections to the 179th Street alignment. •At the direction of the Dakota County Board of Commissioners, when traffic conditions and/or safety issues warrant. The City of Lakeville has incorporated the agreed upon language into the Lakeville Planning Report regarding closure of the temporary access to CSAH 23 and will be included into the Development Contract. The Dakota County Transportation Department will work with the city to finalize the temporary access regarding the necessary turn lanes. The Plat Commission has approved the preliminary and final plat, provided that the described conditions are met, and will recommend approval to the County Board of Commissioners on March 24, 2026. Traffic volumes on CSAH 9 and CSAH 23 are 15,500 and 22,700 ADT, respectively, and are anticipated to be 16,800 and 42,000 ADT by the year 2040 EXHIBIT OPage 394 of 445 No work shall commence in the County right of way until a permit is obtained from the County Transportation Department and no permit will be issued until the plat has been filed with the County Recorder’s Office. The Plat Commission does not review or approve the actual engineering design of proposed accesses or other improvements to be made in the right of way. Nothing herein is intended to restrict or limit Dakota County’s rights with regards to Dakota County rights of way or property. The Plat Commission highly recommends early contact with the Transportation Department to discuss the permitting process which reviews the design and may require construction of highway improvements, including, but not limited to, turn lanes, drainage features, limitations on intersecting street widths, medians, etc. Please contact TJ Bentley regarding permitting questions at (952) 891-7115 or Todd Tollefson regarding Plat Commission or Plat Ordinance questions at (952) 891-7070. Sincerely, Todd B. Tollefson Secretary, Plat Commission c: Page 395 of 445 Date: 3/16/2026 Prime 35 Industrial Preliminary Plat Proposed Action Staff recommends adoption of the following motion: Move to approve: 1) a resolution approving the Prime 35 Industrial preliminary plat. Overview Representatives from Crosby Development Partners have submitted a preliminary plat to be known as Prime 35 Industrial. The proposed plat includes an eight-lot subdivision with four outlots on approximately 145 acres. The site is located south of 215th Street (CSAH 70) and west of Jacquard Avenue. The eight lots are intended for industrial development, including warehouse, distribution, and manufacturing uses. At full build-out, the development is expected to add more than one million square feet of industrial space. Two of the proposed outlots would be dedicated to the City to preserve wetlands, while the remaining two outlots would be retained by the developer. The property is currently zoned I-1, Light Industrial District, and is guided Warehouse/Light Industrial in the City’s 2040 Comprehensive Plan. The proposed preliminary plat is consistent with the goals and objectives outlined in both the zoning code and the Comprehensive Plan. Because of the overall size of the development, an environmental review of proposed development scenarios and the associated infrastructure was done as required by the State of Minnesota. The Alternative Urban Areawide Review (AUAR) was completed and approved July 2025. The square footage of the buildings proposed with the preliminary plat is less than what was studied in the AUAR scenarios. The layout of the lots are substantially similar to the AUAR and the roads studied and planned for in the comprehensive plan and AUAR are consistent. The Prime 35 Industrial development includes the construction of Javelin Avenue in the northeast corner of the property and 217th Street, which will run east–west through the site. Grading, drainage, and erosion control plans were submitted with the preliminary plat application. City Engineering and Environmental Resources staff have reviewed the civil plan set. No site improvements may occur on the property until a Grading Permit has been approved by the City’s Engineering Division. The Planning Commission held a public hearing at the March 5, 2026 meeting, the applicant was present and there was no public comment. The Planning Commission unanimously recommended approval of the preliminary plat applications subject to the stipulations listed in the attached resolution. Page 396 of 445 Supporting Information 1. PrePlat Resolution and Draft PC Minutes 2. Staff Reports-Location and Zoning Map 3. Attachments-ExistingCondiitons-PrePlat-Site-Grading 4. Attachments-Landscaping-TreePres-DACOLetter Financial Impact: $ Budgeted: No Source: Envision Lakeville Community Values: Diversified Economic Development Report Completed by: Heather Botten, Senior Planner Page 397 of 445 1 CITY OF LAKEVILLE DAKOTA COUNTY, MINNESOTA RESOLUTION NO. 26-____ RESOLUTION APPROVING THE PRELIMINARY PLAT OF PRIME 35 INDUSTRIAL WHEREAS, Crosby Development Partners requests approval of the preliminary plat of an eight lot, four outlot subdivision to be known as Prime 35 Industrial; and WHEREAS, the Planning Commission held a public hearing at its March 5, 2026 meeting, preceded by notice as required by the Subdivision Ordinance, and unanimously recommended approval; and WHEREAS, the preliminary plat meets Subdivision Ordinance requirements; and WHEREAS, the preliminary plat is acceptable to the City. NOW THEREFORE BE IT RESOLVED by the Lakeville City Council: The Prime 35 Industrial preliminary plat is approved subject to the following conditions: 1. All grading, drainage, wetland, and erosion control issues and plans shall be subject to review and approval of the City Engineer, including implementation of the recommendations listed in the February 23, 2026 engineering report. 2. The final plat shall be in substantial conformance with the preliminary plans on file with the Community Development Department except as may be modified by the conditions herein. 3. An agreement for any shared driveway access points shall be established in conjunction with the recording of the final plat, subject to review and approval of the Zoning Administrator. 4. As currently proposed, Lot 2, Block 4 will require a CUP in accordance with Section 11-16-5.G prior to final plat approval. 5. Outlots A and C shall be deeded to the City for stormwater management purposes with the final plat. 6. Park dedication requirements shall be satisfied at the time of final plat approval based on the fee schedule then in effect. 7. The preliminary plat shall be valid for one year from the date of City Council approval unless extended as provided for by the Subdivision Ordinance and Zoning Ordinance. Page 398 of 445 2 8. Landscaping shall be installed in accordance with the approved landscape plan, subject to review and approval of the City Forester. 9. The Developer shall provide a security in an amount determined by the City Forester with the final plat to guarantee installation of the landscaping and prior to a final landscape inspection by the City Forester, an as-built landscape plan must be submitted to the city. 10. Any signs installed upon the property shall comply with Chapter 23 of the Zoning Ordinance and shall require a sign permit approved by the Zoning Administrator prior to placement. 11. Applicant shall enter into a Development Contract and related agreements with the City subject to review by the City Attorney and approval of the City Council prior to approval of a final plat. ADOPTED by the Lakeville City Council this 16th day of March 2026. CITY OF LAKEVILLE Luke M. Hellier, Mayor ATTEST: _______________________ Ann Orlofsky, City Clerk Page 399 of 445 CITY OF LAKEVILLE PLANNING COMMISSION MEETING MINUTES March 5 , 2026 Item 5a. Prime 35 Lakeville Chair Zimmer called the meeting to order at 6:00 p.m. in the Council Chambers at City Hall. The Pledge of Allegiance to the flag was given. Members Present: Chair Christine Zimmer, Vice Chair Scott Einck, Pat Kaluza, John Swaney, Jason Swenson, Amanda Tinsley, Mark Traffas Staff Present: Kris Jenson, Planning Manager; Tina Goodroad, Community Development Director, Heather Botten, Senior Planner; Jon Nelson, Assistant City Engineer, Dawn Erickson, Community Development Recorder 5a. Prime 35 Lakeville Chair Zimmer opened the public hearing to consider the application of Crosby Development Partners, LLC for a preliminary plat for an industrial development to be known as Prime 35 Industrial. Jordan Silver, Crosby Development Partners, introduced the project. Senior Planner Heather Botten presented the staff report. The Prime 35 Industrial plat proposes eight lots and four outlots. The site is proposed for industrial development that will consist of warehouse, distribution, and manufacturing uses, with the final build out adding over one million square feet of industrial space. Two of the outlots are proposed to be deeded to the city to protect the wetlands while the others would be retained by the developer. The property is zoned I-1, Light Industrial and is located south of 215th Street (CSAH 70) and west of Jacquard Avenue. The two parent parcels total 145 acres in area and the property is currently used for agricultural purposes. There is one natural gas pipeline that dissects the property from west to east and the property is located in floodplain areas associated with the West Branch South Creek corridor. Community Development Department staff recommend approval of the preliminary plat. Chair Zimmer opened the hearing to the public for comment. There was no public comment. Motion was made by Kaluza, seconded by Einck to close the public hearing at 6:13 p.m. Voice vote was taken on the motion. Ayes – unanimous Chair Zimmer asked for comments from the Planning Commission. Page 400 of 445 Planning Commission Meeting Minutes, March 5, 2026 Page 2 • Commissioner Kaluza asked for clarification of the timeline for the project. Mr. Silver stated they plan to start the site work immediately and would like to have one or two buildings within a year, and hopefully complete within three to four years. Development of the site will be market driven. • Commissioner Traffas asked about a small area that is not platted along the northern side and what will happen with that. Ms. Botten stated it is a private owner, and the owner of that property was approached and was not interested in selling at this time. • Commissioner Swenson stated that the recommendation of approval of a preliminary plat to City Council is for the plat only and doesn’t include a specific use for any lot in the plat. Ms. Botten noted that the eight lots must be final platted as into lots and blocks before any development can occur on those lots. Depending upon the use proposed for a site, future development plans may or may not be reviewed by the Planning Commission and City Council. • Commissioner Swenson asked about access for the parcel that is not part of this plat, as well as its relationship to outlots B and D. Ms. Botten stated outlots B and D potentially could be developed, and Outlot D would have access to 217th Street, and Outlot B would have some kind of shared access agreement through Lot Three. Assistant City Engineer Jon Nelson stated there is existing access from 215th Street at the northwest portion of the site, and that would be permitted again with the development. • Chair Zimmer expressed support for the development of industrial uses on to expand the tax base. Motion was made by Kaluza, seconded by Swaney to recommend to City Council approval of the Prime 35 preliminary plat, subject to the following stipulations: 1. All grading, drainage, wetland, and erosion control issues and plans shall be subject to review and approval of the City Engineer, including implementation of the recommendations listed in the February 23, 2026 engineering report. 2. The final plat shall be in substantial conformance with the preliminary plans on file with the Community Development Department except as may be modified by the conditions herein. 3. An agreement for any shared driveway access points shall be established in conjunction with the recording of the final plat, subject to review and approval of the Zoning Administrator. 4. As currently proposed, Lot 2, Block 4 will require a CUP in accordance with Section 11-16-5.G prior to final plat approval. 5. Outlots A and C shall be deeded to the City for stormwater management purposes with the final plat. 6. Park dedication requirements shall be satisfied at the time of final plat approval based on the fee schedule then in effect. Page 401 of 445 Planning Commission Meeting Minutes, March 5, 2026 Page 3 7. The preliminary plat shall be valid for one year from the date of City Council approval unless extended as provided for by the Subdivision Ordinance and Zoning Ordinance. 8. Landscaping shall be installed in accordance with the approved landscape plan, subject to review and approval of the City Forester. 9. The Developer shall provide a security in an amount determined by the City Forester with the final plat to guarantee installation of the landscaping and prior to a final landscape inspection by the City Forester, an as-built landscape plan must be submitted to the city. 10. Any signs installed upon the property shall comply with Chapter 23 of the Zoning Ordinance and shall require a sign permit approved by the Zoning Administrator prior to placement. 11. Applicant shall enter into a Development Contract and related agreements with the City subject to review by the City Attorney and approval of the City council prior to approval of a final plat. Ayes: Traffas, Kaluza, Zimmer, Einck, Swaney, Swenson, Tinsley Nays: 0 Page 402 of 445 City of Lakeville Community Development Memorandum To: Planning Commission From: Heather Botten, Senior Planner Date: February 23, 2025 Subject: Packet Material for the March 5, 2026 Planning Commission Meeting Agenda Item: Crosby Development Partners, LLC. - Preliminary plat of Prime 35 Industrial Application Action Deadline: April 1, 2026 (120-day deadline) BACKGROUND Representatives from Crosby Development Partners, LLC have submitted an application for a preliminary plat for an eight lot, four outlot subdivision and preliminary plan set for an industrial development to be known as Prime 35 Industrial. The eight lots would be used for industrial development that will consist of warehouse, distribution, and manufacturing type businesses, with the final build out adding over one million square feet of industrial space. Two of the outlots are proposed to be deeded to the city to protect the wetlands while the others would be retained by the developer. The property is zoned I-1, Light Industrial. The proposed development is located south of 215th Street (CSAH 70), west of Jacquard Avenue. The two parent parcels total 145 acres in area, including right-of-way. The property is currently used for agricultural purposes that contain wetlands. There is one natural gas pipeline that dissects the property from west to east and the property is located in floodplain areas associated with the West Branch South Creek corridor. The Prime 35 Lakeville preliminary plat and development plans have been reviewed by Community Development, Engineering, Environment Resources Division, and the City Forester, as well as Barr Engineering for stormwater review. EXHIBITS A. Location Map B. Zoning Map C. Preliminary Plat Page 403 of 445 2 D. Existing Conditions E. Site Plan F. Grading and Drainage Plan G. Landscape Plan H. Tree Preservation Plan I. Dakota County Plat Commission Letter PLANNING A NALYSIS P RELIMINARY PLAT Zoning and Comprehensive Plan Consistency. The development consists of two parent parcels, zoned I-1, Light Industrial Development. The property is currently guided for Warehouse/Light Industrial land uses in Planning District No. 6 of the 2040 Comprehensive Land Use Plan. A comprehensive plan amendment to adjust the staging on the westerly part of the property from Expansion Area B to current Municipal Urban Service Area (MUSA) was approved by the City Council on August 18, 2025 and approved by the Metropolitan Council on November 12, 2025. The proposed preliminary plat is consistent with the recommended goals and objectives of the comprehensive plan. Existing Site Conditions. The site is currently undeveloped and historically used for agricultural production of row crops. There is a gas easement that dissects the property along with wetlands. Surrounding Land Uses, Zoning, and Comprehensive Plan Designation Direction Existing Use Land Use Designation Zoning North Vacant and Open Space Office Park and Restricted Development OP, Office Park and P/OS, Public Open Space East Industrial Businesses Warehouse/Light Industrial, Office Park OP, Office Park and I-1, Light Industrial West Vacant/Agricultural Warehouse/Light Industrial I-1, Light Industrial South Vacant/ Agricultural New Market Township/ Scott County New Market Township/ Scott County Streets/Access. Lot 1, Block 2 is proposed to be accessed by 215th Street. The remainder of the site will be accessed from 217th Street. Prime 35 Industrial development includes the construction of Javelin Avenue and 217th Street. The roads shall be constructed to City standards and will provide access to 215th Street (CSAH 70). The Dakota County Plat Commission recommended approval of the preliminary plat at the January 18, 2026 meeting subject to the requirements in the approval letter dated January 19, 2026. Page 404 of 445 3 Lot Frontage. City code requires each lot to have frontage on an abutting, improved, and city- accepted public street except as may be allowed by a conditional use permit (CUP). Lot 2, Block 4 is proposed south of Lot 1, Block 4 and does not have street frontage, instead relying on shared access with Lot 1, Block 4. Therefore, a CUP is required for this configuration. A CUP has not been processed with the preliminary plat as several potential scenarios could occur. For example, the final plat could designate these areas as outlots and will then be platted as a lot in the future. Other options include the combination of Lots 1 and 2, Block 4 into a single lot, eliminating the need for a CUP, or the lot boundaries could be adjusted to provide Lot 2 with frontage on 217th Street. A stipulation is included stating that, as currently proposed, Lot 2, Block 4 will require a CUP in accordance with Section 11-16-5.G prior to final plat approval. Tree Preservation. Over 2,200 trees were inventoried on the property. Development in industrial districts may remove up to seventy percent (70%) of the total diameter inches of significant trees without replacement; any removal or disturbance of trees beyond this threshold shall require replacement tree planting or mitigation. Trees within the South Creek corridor will remain undisturbed. The City Forester is working with the applicant on compliance with the tree preservation ordinance. Wetlands. The project area consists of wetlands, drainage features, and floodplain areas associated with the West Branch South Creek corridor. Portions of the site are located within the FEMA mapped floodplain. A wetland delineation for the site was approved June 18th, 2025. A wetland replacement plan was submitted and is out for comment. The replacement identifies 2 acres of wetland impacts to previously farmed wetlands. All protected wetlands, waterways, floodplains and buffers will be placed in City owned outlots with the final plat. Any wetland impacts will be approved by the City, with the applicant working with Environmental Resources Park Dedication. The Comprehensive Parks, Trails, and Open Space Plan does not identify any future park land needs in the area of the plat. Park dedication will be satisfied at the time of final plat with a cash fee determined by the most recent fee schedule for industrial zoned property. The development of Prime 35 Industrial includes the construction of a 10-foot-wide bituminous trail, constructed on the south side of 215th Street/CSAH 70, adjacent to the plat frontage. The Developer will be responsible for 100% of the grading and restoration for the bituminous trail to the length of the plat. The Developer shall receive a credit to the final plat cash fees for the City’s 3/8th share (excluding grading and restoration) of the trail construction costs. SITE PLAN REVIEW Lots/Blocks. The Prime 35 Industrial plat proposes eight lots and five outlots. All of the lots within the plat exceed the minimum lot area and width requirements in the I-1 District. Page 405 of 445 4 Minimum Lot Area Minimum Lot Width Minimum Required 30,000 square feet 100 feet Lot 1, Block 1 476,731 sf +800 feet Lot 1, Block 2 544,723 sf 1,003 feet Lot 1, Block 3 621,273 sf 1,610 feet Lot 1, Block 4 499,261 sf 1,177 feet Lot 2, Block 4 647,984 sf 1,318 feet Lot 3, Block 4 376,955 sf 445 feet Lot 4, Block 4 747,193 sf 110 feet Lot 5, Block 4 458,861 sf +1,100 feet Setbacks. The minimum building setback requirements within the I-1 District are: Minimum building setbacks Front yards 40 feet Rear yards 30 feet, or 50 feet on the yard abutting residential zoned property Side yards 10 feet on any 1 side, or 30 feet on the side yard abutting a street. The proposed buildings shall comply with the minimum code requirements. Parking/Drive Aisles. The setback requirements for parking lots and drive aisles is 15 feet abutting right-of-way and five feet from interior lot lines. The proposed parking areas and drive aisles comply with the minimum setback requirements. The proposed site plan has drive areas that cross over internal property boundaries, a cross-access agreement will be required with the final development plans. Building Materials. The exterior building materials of all structures shall comply with City Code Section 11-17-9. Architectural information will be provided at the final submittal for each lot. Building Height. The maximum height for any building is 50 feet. Mechanical Equipment. Any roof-mounted mechanical equipment must be screened if greater than three feet in height. Ground-mounted mechanical equipment must be screened with landscaping and/or fencing. Outside Storage. Outdoor storage, including parking of semi-tractor trailers is allowed as an accessory use and shall comply with City Code Section 11-86-5. Landscaping. The landscape plan proposes a mix of deciduous and ornamental trees and shrubs mainly located around parking lots and private drives. The City Forester has reviewed the Page 406 of 445 5 landscape plans dated January 30, 2026 and is working with the applicant on landscape compliance. Landscaping on site must be installed per approved plans. The Developer must provide a security with the final plat to guarantee installation of the landscaping. Prior to a final landscape inspection, an as-built landscape plan must be submitted to the city. Signs. No signs are proposed or approved with the application. Any signs to be installed upon the property are to comply with Zoning Ordinance requiremenst. All signs require approval of a sign permit prior to installation. Exterior Lighting. No light source or combination thereof which casts light on a public street shall exceed one foot-candle meter reading as measured at the right of way or property line. All building- mounted lighting must face downward onto the structure. A photometric lighting plan for the proposed exterior lighting shall be submitted with the development of each lot in compliance with the Zoning Ordinance. Lighting for the proposed streets will be provided during the permitting phase and will meet city standards. Grading, Drainage, Erosion Control, and Utilities. Grading, drainage and erosion control plans have been submitted with the preliminary plat. City Engineering and Environmental Resources have reviewed the civil plan set. A copy of the engineering report dated February 23, 2026 is attached for your review. The Engineering Division recommends approval of the preliminary plat subject to the stipulations outlined in the report. Stormwater Maintenance Agreement. A Stormwater Maintenance Agreement will be required with the final plat for maintenance of the stormwater systems on site. Trash Enclosure. If trash will be kept outdoors in an enclosure, the structure must meet the requirements of Section 11-18-11, including exterior materials, location, and screening. RECOMMENDATION Community Development Department staff recommends approval of the Prime 35 Lakeville preliminary plat, subject to the following stipulations: 1. All grading, drainage, wetland, and erosion control issues and plans shall be subject to review and approval of the City Engineer, including implementation of the recommendations listed in the February 23, 2026 engineering report. 2. The final plat shall be in substantial conformance with the preliminary plans on file with the Community Development Department except as may be modified by the conditions herein. Page 407 of 445 6 3. An agreement for any shared driveway access points shall be established in conjunction with the recording of the final plat, subject to review and approval of the Zoning Administrator. 4. As currently proposed, Lot 2, Block 4 will require a CUP in accordance with Section 11-16- 5.G prior to final plat approval. 5. Outlots A and C shall be deeded to the City for stormwater management purposes with the final plat. 6. Park dedication requirements shall be satisfied at the time of final plat approval based on the fee schedule then in effect. 7. The preliminary plat shall be valid for one year from the date of City Council approval unless extended as provided for by the Subdivision Ordinance and Zoning Ordinance. 8. Landscaping shall be installed in accordance with the approved landscape plan, subject to review and approval of the City Forester. 9. The Developer shall provide a security in an amount determined by the City Forester with the final plat to guarantee installation of the landscaping and prior to a final landscape inspection by the City Forester, an as-built landscape plan must be submitted to the city. 10. Any signs installed upon the property shall comply with Chapter 23 of the Zoning Ordinance and shall require a sign permit approved by the Zoning Administrator prior to placement. 11. Applicant shall enter into a Development Contract and related agreements with the City subject to review by the City Attorney and approval of the City Council prior to approval of a final plat. Page 408 of 445 City of Lakeville Public Works – Engineering Division Memorandum To: Heather Botten, Senior Planner From: Jonathan Nelson, Assistant City Engineer Mac Cafferty, Environmental Resources Manager Joe Masiarchin, Parks and Recreation Director Copy: Zach Johnson, City Engineer Tina Goodroad, Community Development Director Julie Stahl, Finance Director Dave Mathews, Building Official Date: February 23, 2026 Subject: Prime 35 Industrial • Preliminary Plat Review • Preliminary Grading and Erosion Control Plan Review • Preliminary Utility Plan Review • Preliminary Tree Preservation Review BBAACCKKGGRROOUUNNDD Olam Holdings 1, LLC has submitted a preliminary plat named Prime 35 Industrial. The proposed subdivision is located south of and adjacent to 215th Street (CSAH 70) and west of and adjacent to the existing western terminus of 217th Street. The parent parcels are identified as PID Nos. 220310051012 and 220360075013, zoned I-1, Light Industrial. The preliminary plat consists of eight (8) industrial lots and five (5) outlots on 145.21 acres. The outlots created with the preliminary plat shall have the following use: • Outlot A: Wetland and Buffer; to be deeded to the City (8.25 acres) • Outlot B: Future development; to be retained by developer (5.37 acres) • Outlot C: Wetland and Buffer; to be deeded to the City (1.07 acres) • Outlot D: Future Development; to be retained by developer (2.17 acres) Page 409 of 445 PPRRIIMMEE 3355 IINNDDUUSSTTRRIIAALL –– PPRREELLIIMMIINNAARRYY PPLLAATT FFEEBBRRUUAARRYY 2233,, 22002266 PPAAGGEE 22 OOFF 55 • Outlot E: Stormwater management; to be retained by developer (19.47 acres) The proposed development will be completed by: Developer: Olam Holdings 1, LLC Engineer/Surveyor: MN Hill SSIITTEE CCOONNDDIITTIIOONNSS The Prime 35 Industrial site consists of undeveloped agricultural land containing wetlands, drainage features, and floodplain areas associated with the West Branch South Creek corridor. Existing topography generally drains toward the creek corridor and associated wetland complexes located within the site. Public utilities are located within adjacent roadway rights- of-way and will be extended to serve the proposed development. There is a gas main easement with Northern Natural Gas that bisects the site. Construction activities within the easement area must be coordinated and permitted with Northern Natural Gas. Portions of the site are located within the FEMA mapped floodplain and are proposed to be deeded to the City as an outlot. SSTTRREEEETT AANNDD SSUUBBDDIIVVIISSIIOONN LLAAYYOOUUTT 215th Street (CSAH 50) Prime 35 Industrial is located south of and adjacent to 215th Street (CSAH 70), which is classified as a minor arterial roadway as identified in the City’s Transportation Plan. The Dakota County Plat Review Needs Map identifies CSAH 70 as a future four-lane divided roadway requiring seventy-five (75) feet of half right-of-way. The Developer shall dedicate the necessary right-of-way as shown on the preliminary plat. The preliminary plat was reviewed and recommended for approval by the Dakota County Plat Commission at their January 29, 2026 meeting upon meeting the described conditions in the plat commission letter. 217th Street Prime 35 Industrial includes the construction of 217th Street, a local roadway, within the plat boundary. 217th Street shall be constructed to City standards as a 40-foot-wide industrial roadway section with two-foot-wide gravel shoulders within 80-foot dedicated right-of-way and will provide access to proposed industrial lots and future development areas located west of the plat. Javelin Avenue Prime 35 Industrial includes the construction of Javelin Avenue, a local roadway. Javelin Avenue shall be constructed to City standards as a 40-foot-wide industrial roadway section with two-foot-wide gravel shoulders within 80-foot dedicated right-of-way and will provide access to 215th Street (CSAH 70). A right-of-way permit with Dakota County is required for construction proposed within Dakota County right-of-way. Page 410 of 445 PPRRIIMMEE 3355 IINNDDUUSSTTRRIIAALL –– PPRREELLIIMMIINNAARRYY PPLLAATT FFEEBBRRUUAARRYY 2233,, 22002266 PPAAGGEE 33 OOFF 55 CCOONNSSTTRRUUCCTTIIOONN AACCCCEESSSS Construction traffic access and egress for grading, utility and street construction will limit use of the existing adjacent local roadways to the maximum extent practical for the construction. PPAARRKKSS,, TTRRAAIILLSS AANN DD SSIIDD EEWWAALLKKSS The City’s Parks, Trails and Open Space Plan does not designate a park within Prime 35 Industrial. The Park Dedication requirement has not been collected on the parent parcel and shall be satisfied through a cash contribution with the final plat. Prime 35 Industrial includes the construction of public trails. 10-foot-wide bituminous trail shall be constructed on the south side of 215th Street (CSAH 50) adjacent to the plat frontage. The Developer will be responsible for 100% of the grading and restoration for the bituminous trail. The Developer shall receive a credit to the final plat cash fees for the City’s 3/8th share (excluding grading and restoration) of the trail construction costs. UUTTIILLIITTIIEESS SSAANNIITTAARRYY SSEEWWEERR Prime 35 Industrial is located within subdistrict SC-10190, SC-10420, and SC-10430 of the South Creek sanitary sewer district as identified in the City of Lakeville Sanitary Sewer Comprehensive Plan. Development includes extension of sanitary sewer to serve the proposed industrial lots. Consistent with the City’s Sanitary Sewer Comprehensive Plan, 8” trunk sanitary main will be extended to the western plat boundary to serve future development. Wastewater from the development will be conveyed through existing downstream sanitary sewer infrastructure to the Empire Treatment Facility monitored by meter M649. The development of Lot 1, Block 2 of Prime 35 Industrial shall enter into a special assessment agreement with the City for the reconstruction of 215th Street with trunk sanitary sewer and trunk watermain to provide availability of utility service to the site, consistent with City Comprehensive plans. The Sanitary Sewer Availability Charge has not been collected on the parent parcel and shall be paid with the final plat at the rate in effect at the time of approval. WWAATTEERRMMAAIINN Prime 35 Industrial includes the extension of watermain to serve the proposed industrial lots. Consistent with the City’s Comprehensive Water System Plan, 12-inch trunk watermain will be extended to the west plat boundary to serve future development. The development of Lot 1, Block 2 of Prime 35 Industrial shall enter into a special assessment agreement with the City for the reconstruction of 215th Street with trunk sanitary sewer and Page 411 of 445 PPRRIIMMEE 3355 IINNDDUUSSTTRRIIAALL –– PPRREELLIIMMIINNAARRYY PPLLAATT FFEEBBRRUUAARRYY 2233,, 22002266 PPAAGGEE 44 OOFF 55 trunk watermain to provide availability of utility service to the site, consistent with City Comprehensive plans. The City will credit the Developer for the oversizing of the trunk watermain in 217th Street. The credit will be based on the cost difference between 8-inch watermain and the oversized watermain that will be installed. The credit will be applied to the Developer’s final plat cash fees and will be based on an estimate provided by the Developer’s engineer. DDRRAAIINNAAGGEE AANNDD GGRRAADDIINNGG Prime 35 Industrial is located within subdistricts SC-174, SC-187, SC-021, SC-006, SC-022, SC- 199-3P as identified in the City of Lakeville Water and Natural Resources Management Plan. Development includes construction of five (5) privately owned and maintained stormwater management facilities to collect and treat runoff generated from the site. A stormwater maintenance agreement will be required with the final plat. A grading permit shall not be issued until the final plans have been approved by the city in conjunction with the final plat. Drainage leaving the site must fall within a drainage and utility easement accessible to the development. The final grading plan shall identify all fill lots where building footings will be placed on fill material. Grading specifications shall indicate that all embankments meet FHA/HUD 79G requirements. Building permits will not be issued until a soils report and an as-built certified grading plan have been submitted and approved by City staff. The proposed development will disturb more than one acre of land. A National Pollutant Discharge Elimination System (NPDES) Construction Permit is required from the Minnesota Pollution Control Agency (MPCA). A copy of the Notice of Stormwater Permit Coverage shall be submitted to the City prior to construction. SSTTOORRMM SSEEWWEERR Development of Prime 35 Industrial includes construction of public storm sewer systems to collect and convey runoff within public right-of-way. Privately owned and maintained storm sewer shall be constructed to collect and convey runoff from within the private lots. All storm sewer systems shall be designed and constructed in accordance with City standards. Draintile construction is required in areas of non-granular soils for the street sub-cuts and lots. Any additional draintile construction, including perimeter draintile required for building footings, which is deemed necessary during construction shall be the developer’s responsibility to install and finance. The Storm Sewer Charge has not been collected on the parent parcel and shall be paid with the final plat. FEMA FLOODPLAIN ANALYSIS Prime 35 Industrial is located within areas shown on the Flood Insurance Rate Map (Map No. 27037C0194E) primarily as Zone X and is identified as Zone AE along the northeast quadrant Page 412 of 445 PPRRIIMMEE 3355 IINNDDUUSSTTRRIIAALL –– PPRREELLIIMMIINNAARRYY PPLLAATT FFEEBBRRUUAARRYY 2233,, 22002266 PPAAGGEE 55 OOFF 55 of the plat as determined by FEMA. Based on this designation, a portion of the site is located within the plat is located within a Special Flood Hazard Area (SFHA). No buildings or grading are being proposed within the SFHA. WWEETTLLAANNDDSS A wetland delineation for the site was approved June 18, 2025. A wetland replacement plan was submitted and is out for comment until March 5, 2026. The replacement identifies 2 acres of wetland impacts to previously farmed wetlands. A preapplication meeting was held with the TEP prior to the replacement plan being set out on notice. The replacement plan was updated based on comment from TEP. A decision will be made on the replacement plan on or before March 3, 2026. No impacts can take place to the wetland prior to approval of the wetland replacement plan and purchase of wetland credit to offset the impacts. All wetlands, waterways, floodplains and buffers will be placed in City owned outlots with final plat. Natural Area signs will be installed along City owned outlots by the developer. TTRREEEE PPRREESSEERRVVAATT IIOONN The tree removal threshold for the Prime 35 site is 70%. The tree preservation plan dated 11/14/2025 identifies 26,566 inches of existing significant diameter inches on the property and proposes the removal of 18,339 significant diameter inches, or 69%. Heritage trees were not calculated separately. Per the tree preservation ordinance, all diameter inches of heritage trees removed shall require replacement. The Tree Preservation Plan is to be updated to calculate the number of diameter inches of Heritage Trees onsite, to be removed, and to be preserved; and to provide an updated summary table indicating the number of tree inches that require replacement. A calculation worksheet is available on the City’s website. EERROOSSIIOONN CCOO NNTTRROOLL The Developer is responsible for obtaining an MPCA Construction Permit for the site prior to construction. The permit requires that all erosion and sediment BMPS be clearly outlined in a site’s SWPPP. Changes made throughout construction must be documented in the SWPPP. A final SWPPP must be submitted to the City for review and approval prior to any land disturbing activity. Additional erosion control measures may be required during construction as deemed necessary by City staff. Any additional measures required shall be installed and maintained by the developer. RREECCOOMMMMEENNDDAATTIIOONN Engineering recommends approval of the Prime 35 Industrial preliminary plat, grading and erosion control plan, and utility plan, subject to the requirements and stipulations within this report. Page 413 of 445 Page 414 of 445 Page 415 of 445 Legal Description:The East one-half of the Southeast Quarter of Section Thirty-six (36), Township One-HundredFourteen (114), Range Twenty-one (21) and the West one-half of the Southwest Quarter ofSection Thirty-one (31), Township One Hundred Fourteen (114), Range Twenty (20), except thatpart thereof described as follows:The West 409.31 feet of the North 887.00 feet of the Northwest Quarter of the SouthwestQuarter of Section Thirty-one (31), Township One Hundred Fourteen (114), Range Twenty (20) andfurther except the East 81.79 feet of the North 887.00 feet of the Northeast Quarter of theSoutheast Quarter of Section Thirty-six (36), Township One Hundred Fourteen (114), RangeTwenty-one (21), Dakota County, Minnesota.PROPERTY DESCRIPTIONPROJECT NO.24306-00CAD FILE11/07/2025DATEREVISIONSDRAWN BY24306PP.dwgF:\_Civil 3D Projects\24306\PRE-PLAT PLANS\24306pp.dwg - 3/04/2026 02:27PM PLMSCALE IN FEET0100200ZONING INFORMATIONI-1 (LIGHT INDUSTRIAL DISTRICT)CURRENT ZONING:PROPOSED ZONING:I-1 (LIGHT INDUSTRIAL DISTRICT)LOTSLOTSR.O.W. C.S.A.H. NO. 70 (215TH STREET WEST) 215TH STREET WEST JAVELLIN AVENUE 217TH STREET WESTOUTLOTSTOTAL8 LOTS119.70 ACRES8.70 ACRES (1.61 ACRES) (1.14 ACRES) (0.61 ACRES) (5.34 ACRES)16.81 ACRES145.21 ACRESMINIMUM SETBACKS (PARKING)FRONTSIDE (INTERIOR)SIDE (STREET)REAR15 FEET5 FEET15 FEET5 FEETSITE DATAGROSS AREA145.21 ACRESMINIMUM LOT REQUIREMENTSLOT AREALOT WIDTH30,000 S.F.100 FEETLAKEVILLE, MINNESOTA PRIME 35 LAKEVILLE OLAM HOLDINGS 1, LLCFOR 268 BUSH STREET, #49, SAN FRANCISCO, CA 94104 PRELIMINARY PLAT 2999 WEST C.R. 42, SUITE 100 BURNSVILLE, MN 55306 PHONE: 952-890-6044 marcus@mnhill.com www.mnhill.com Date:Reg.No. I hereby certify that this survey, plan or report was prepared by me or under my direct supervision and that I am a duly Licensed Land Surveyor under the laws of the State of Minnesota. PR E L I M I N A R YMINIMUM SETBACKS (BUILDING)FRONTSIDE (INTERIOR)SIDE (STREET)REAR40 FEET10 FEET30 FEET30 FEETC200DRAINAGE AND UTILITY EASEMENTSBEING 5 FEET IN WIDTH, UNLESSOTHERWISE INDICATED, ADJOINING LOTLINES, AND BEING 10 FEET IN WIDTH,UNLESS OTHERWISE INDICATED,ADJOINING RIGHT OF WAY LINES, ASSHOWN ON THIS PLAT.DRAINAGE AND UTILITY EASEMENTSARE SHOWN THUS:2026-01-20 CITY COMMENTS2026-03-04 CITY COMMENTSPage 416 of 445 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGX X X X XXXXXXXXXXXXXXXXXXX XXXXXXXX X XXXXXXXXXXXX X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X OHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPXXXXXXXXXXXXXXXXXXXXXX>>>>>>>>>>IIIIIIIII IEEEEEEEEEEEEEETTTTTTTTTTTTTTT IIHWL HWLHWLHWL HWLHWL HWLHWL HWL HWL HWL HWL HWL HWL HWLHWL HWL HWL HWL HWL HWL HWLHWLHWLHWLHWLHWL HWLHWLHWL HWLHWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWLHWLHWL HWLHWLHWLHWLHWLHWL H W L H W L WETLAND 13.12 ACMANAGE 1WETLAND 20.96 ACMANAGE 1WETLAND 30.07 ACMANAGE 1WETLAND 40.07 ACMANAGE 2WETLAND 70.04 ACMANAGE 2WETLAND 51.89 ACUTILIZE215TH STREET W (C.R. 70)217TH STREET215TH STREET8" SANITARY STUBINV 1015.35 (PER PLAN)TEMPORARY HYDRANT1024102610281030103210341036103810401042104410461048105010521054105610581060106210641066106810701072107410761022 1024 10261028103010321034103610381040 10441042 1040103810361034103210301028 1026 1026102410221020101810141018101610201022101810181018102 0 1030 102210241026102810321040 1050 1060 104210441046104810521054105610581042104410461048105010521054105610581060106210641050 1060 1070 1 0 4 0 103 0 10 4 0 1050 10601028103010321034103610381040 10 5 0 10601068107010721074107610781080 1082 1084 10801080 108610781060 1050 1040 1034 1032 10301040103810361034105210541056105810481046104010501060107010701080108010341036103810421044104610481052105410561058106210641066106610681068107210721074107410761076107810781082108210841084103610381040 1042104210421040GASMAIN EASEMENT(NORTHERN NATURAL GAS)EX SSMHRIM 1039.18INV 1013.93 (PER AS-BUILT)12" PVC WMWEST BRANCH SOUTH CREEK WETLAND 60.19 ACUTILIZEWETLAND 80.34 ACMANAGE 1FLOODPLAINZONE AE PER FEMAMAPS.BASE FLOOD ELEVATION = 1024.0EX FESINV 1013.56EX 85 LF 30" RCP @ 0.49%EX FESINV 1013.15PROJECT NO.24306CAD FILE11/14/25DATEREVISIONSDRAWN BYDate:Reg.No. 2999 WEST C.R. 42, SUITE 100 BURNSVILLE, MN 55306 PHONE: 952-890-6044 bbusselman@mnhill.com www.mnhill.com PR E L I M I N A R Y LAKEVILLE, MINNESOTA PRIME 35 LAKEVILLE OLAM HOLDINGS 1, LLC FOR 268 BUSH STREET, #49, SAN FRANCISCO, CA 94104 F:\_Civil 3D Projects\24306\PRE-PLAT PLANS\24306EXC.dwg - 2/09/2026 04:02PM EXISTING CONTOUR92324306EXCEXISTING CONDITIONSEPF LEGEND>I>IOHPOHPXXXXGGGEEEUFOUFOUFOTTTEXISTING TELEPHONE PEDESTALEXISTING TRANSFORMEREXISTING LIGHT POLEEXISTING TREELINE/TREESEXISTING STORM SEWEREXISTING SANITARY SEWEREXISTING WATERMAINEXISTING OVERHEAD POWER LINEEXISTING CURB & GUTTEREXISTING FENCEEXISTING ASPHALTEXISTING CONCRETEEXISTING UNDERGROUND GASEXISTING UNDERGROUND ELECTRICEXISTING UNDERGROUND FIBER OPTICEXISTING UNDERGROUND TELEPHONEEXISTING TV PEDESTALEXISTING SOIL BORING LOCATIONSTVTEXISTING MANHOLE (ELECTRIC)EXISTING SIGNEXISTING VAULTEVSB-1Know what'sbelow.before you dig.CallRSCALE IN FEET0100200C102EXISTING WETLAND EDGEEXISTING WETLANDNOTESWETLAND DELINEATION COMPLETED IN JUNE, 2025 BY KIMLEY-HORN ANDASSOCIATES, INC.PRELIMINARY WETLAND QUALITY LEVELS DETERMINED BY KJOLHAUGENVIRONMENTAL.EXISTING CONDITIONS ARE BASED ON ALTA SURVEY PREPARED BY EGAN, FIELDAND NOWAK, INC., DATED DECEMBER 11, 2024.FEMA FLOODPLAINI hereby certify that this survey, plan or report was prepared by me or under my direct supervision and that I am a duly Licensed Land Surveyor under the laws of the State of Minnesota.Page 417 of 445 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHP>>>>>>>>>>IIIIIIIII IEEEEEEEEEEEEEETTTTTTTTTTTTTTT IIHWL HWLHWLHWL HWLHWL HWLHWLHWL HWL HWL HWL HWL HWL HWLHWL HWL HWL HWL HWL HWL HWLHWLHWLHWLHWLHWL HWLHWLHWLHWLHWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWLHWLHWL HWLHWLHWLHWLHWLHWL H W L H W L R20'R20'R15'R3'R3'R15'R3'R3'R12'R12'55'TYP.12'TYP.20'TYP.24'20'TYP.9'TYP.24'F-F9'TYP.20'TYP.24'20'TYP.15'20'TYP.24'20'TYP.R3'R3'R48'R24'R3 'R3'R 3 'R3'R3' R 2 4 ' R 1 2 ' R2 0 'R20'R 3 'R3'R15'R15'R3'R3' R 4 8 ' R2 4 'R3'R3'130'30'F-F24' F-F20'TYP.24'20'TYP.9' TYP.20'TYP.24'20'TYP.9' TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.20'TYP.24'20'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.600'280'580'120'R48'R24'R3'R 3 'R3'R3'R3'R 3 'R15'R3'R3'R9 ' R 4 8 ' R2 0 ' R 2 0 'R25'20' TYP.24' 20' TYP.9'TYP.9'TYP.20' TYP.24' 20' TYP.9'TYP.9'TYP.20'TYP.24'20'TYP.9' TYP. 9' TYP. 130' 185' 40' 55'12'TYP.502'212'1411R24.2'R48'R24'R48'R20'R20'R15'R6'R3'R3'R3'R3'R15'R15'R3'R48'R3'R9'R9'R9'R3'R3'R24'R3'R15 'R15'R15'R3'R15'R3'R3'R3'R45'R4 5 ' R3'R3'R3'R3'R25'R15'R24'R15'R3'R3'R15' R 3 ' R3'R3'R9'R3'R9'R3'R9'R24'R3'R3'R24'R3'R3'R20'R24'R3'R3'R3'R3'R24'R3'R3'R24'R48'20'TYP.24'20'TYP.9'TYP.9'TYP.20'TYP.24'20'TYP.24'F-F60'F-F20'TYP.24'20'TYP.9'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.55'12'TYP.125'650'210'130'20'TYP.24'20'TYP.9'TYP.9'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.952'210'200'20'TYP.24'20'TYP.9'TYP.9'TYP.60'F-FR3'R3'R3'R3'20'TYP.24'20'TYP.9'TYP.9'TYP.952'24'F-F24'F-F70'260'20'TYP.24'20'TYP.9'TYP.9'TYP.23.6'125'55'70'12'TYP.24'F-FR20'R24'R48'R9'R3'R3'R3'R24'R3'R3'R3'R3'28'F-F24'F-F2 8 ' F - F 30'F-F24'F-F24'F-F20'24'20'9'TYP.9'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.20'TYP.24'20'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.R3'R3 ' R 3 'R3'R20'R3'R3' R 3 'R3'R85'R3'R3 ' R3'20'TYP.24'20'TYP.20'TYP.24'20'TYP.9'TYP.9'TYP.30'F-F24'F-F210 '476'55' 130 '12'TYP.60'F-F30'F-FR25'R15'R 9 'R3'R15'R3'R3' R3'R3'R3'R3' R15 'R15'R3'R1 5 'R3'R15'R3' R1 5 'R306.5'R24'R10 ' R3 'R3'28' F-F 24'F-F64.5'55'175'55'175'20'TYP.24'20'TYP.9' TYP. 9' TYP. 20' TYP.24' 20' TYP.9'TYP.9'TYP.20' TYP.24' 20' TYP.55'12' TYP. 12' TYP. 12' TYP.55'12' TYP. 20' TYP. 20' TYP.9'TYP.20' TYP.9'TYP.55'TYP.12' TYP.175'55'TYP.12' TYP. 107.5'531131111112263453532632363830305280522636303638521185272713527272758583030676730319276435300'300'110'60'R48'R36'R64'R64'30'24'102'262'70'550'122'R15'R1 5 'R15'R10'R 1 0 'R10'R10'PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSL PSL PSL PSL PSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLBSL BSL BSL BSL BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSL PSL PSL PSL PSL PSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSL BSLBSLBSL BSL BSL BSL BSL BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSL PSL PSL PSLPSLPSLPSLPSLPSL PSL PSL PSL PSL PSL PSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSL BSL BSL BSL BSL BSL BSL BSLBSLBSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSL PSL PSL PSL PSL PSL PSL PSL PSL PSL PSL P S L P S L PSLPSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSL PSL PSL PSL PSL PSL PSL PSL PSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLBSL BSL BSL BSL BSL BSL BSL BSL BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLPSLPSLPSLPSLPSLPSL PSL PSL PSL PSL PSL PSL PSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSL P S L P S L PSLPSLPSLBSLBSLBSLBSLBSLBSL BSL BSL BSL BSL BSL BSL BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBS L B S L B S L BSLBSLBSLBSL BSL BSL BSL BSL BSL BSL BSL BSLBSL BSL BSL BSLBSL BSLBSL BSL BSL BSL BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLBUILDING 2168,000 SF TOTALBUILDING 3106,424 SF TOTALBUILDING 893,824 SF TOTALBUILD ING 799,960 SF TOTALBUILDING 6247,520 SF TOTALBUILDING 5199,920 SF TOTALBUILDING 4136,500 SF TOTALBUILDING 169,600 SF TOTAL300' RIGHT TURN LANE180' TAPER12'12'12'PROPOSED BITUMINOUS EXTENSION4'215TH STREET WEST (CR70)217TH STREET WEST215TH STREET WESTMAINTENANCEBUILDING15,500 SFTRAILERSTORAGETRAILERSTORAGETRAILERSTORAGETRAILERSTORAGETRAILERSTORAGETRAILERSTORAGETRAILERSTORAGETRAILERSTORAGETRAILERSTORAGETRAILERSTORAGEBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSL BSL BSL BSL BSL BSL BSL BSL BSL BSL BSL B S L B S L BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLR15'R15'R52'R76'R48'R10.5'R45'R60'R60'R84'R25'130'30'R 9 0 ' R 1 2 0 ' R 9 0 ' R 6 0 ' R 1 5 'R3'30'R20'R10'BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSL BSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLBSLPSL PSL PSL PSL PSL PSL PSLPSL PSL PSLPSL PSL PSLPSL PSLPSLPSL PSL PSL PSL PSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLPSLR15'R3' R3 ' R3.5'R3.5'R25'R25'R25'R25' R25 'R25'R25'R25'R25'R25'R24'R25'R25'R2 5 'R20'R2 5 'R25'R326'R45'R45'R20'PROPOSED 10' BITUMINOUS TRAIL10'10'EXISTING CONTOUR923LEGENDPROPOSED CONCRETEPROPOSED BITUMINOUS SURFACEPROPOSED SEDIMENT BASINPROPOSED INFILTRATION BASINPROPOSED WATERMAINIIPROPOSED SANITARY SEWERPROPOSED STORM SEWER>>PROPOSED CURB & GUTTERPROPOSED SANITARY SERVICEPROPOSED WATER SERVICE>I>IOHPOHPXXXXGGGEEEUFOUFOUFOTTTEXISTING TELEPHONE PEDESTALEXISTING TRANSFORMEREXISTING LIGHT POLEEXISTING TREELINE/TREESEXISTING STORM SEWEREXISTING SANITARY SEWEREXISTING WATERMAINEXISTING OVERHEAD POWER LINEEXISTING CURB & GUTTEREXISTING FENCEEXISTING ASPHALTEXISTING CONCRETEEXISTING UNDERGROUND GASEXISTING UNDERGROUND ELECTRICEXISTING UNDERGROUND FIBER OPTICEXISTING UNDERGROUND TELEPHONEEXISTING TV PEDESTALEXISTING SOIL BORING LOCATIONSTVTEXISTING MANHOLE (ELECTRIC)EXISTING SIGNEXISTING VAULTEVSB-1PROPOSED CONTOUR923EXISTING WETLAND EDGEEXISTING WETLANDSHORELAND ZONING OVERLAYPSLPSLPSLBSLBSLBSLBUILDING SETBACK PARKING SETBACKPROPOSED FILTRATION BASINPROJECT NO.24306CAD FILE11/14/25DATEREVISIONSDRAWN BYDate:Reg.No.2026-01-20 CITY COMMENTS2999 WEST C.R. 42, SUITE 100 BURNSVILLE, MN 55306 PHONE: 952-890-6044 bbusselman@mnhill.com www.mnhill.com I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. PR E L I M I N A R Y LAKEVILLE, MINNESOTA PRIME 35 LAKEVILLE OLAM HOLDINGS 1, LLC FOR 268 BUSH STREET, #49, SAN FRANCISCO, CA 94104 2026-02-10 CITY COMMENTS2026-03-04 CITY COMMENTS24306SITEOVERALL SITE & DIMENSIONAL PLANKnow what'sbelow.before you dig.CallRSCALE IN FEET0100200VUNC600F:\_Civil 3D Projects\24306\PRE-PLAT PLANS\24306SITE.dwg - 3/04/2026 02:29PM DEVELOPMENT SUMMARYGROSS PROJECT AREA 145.21 ACR.O.W.8.50 ACC.S.A.H. NO. 70 (215TH STREET WEST)(1.61 AC)215TH STREET WEST(0.94 AC)JAVELLIN AVENUE(0.74 AC)217TH STREET WEST(5.21 AC)OUTLOTS 36.32 ACLOTS (8 TOTAL)100.39 ACTOTAL145.21 ACMINIMUM BUILDING SETBACKSFRONT YARD40 FEETINTERIOR SIDE YARD10 FEETSTREET SIDE YARD30 FEETREAR YARD30 FEETMINIMUM PARKINGS SETBACKSFRONT YARD15 FEETINTERIOR SIDE YARD5 FEETSTREET SIDE YARD15 FEETREAR YARD5 FEETZONINGI-1, LIGHT INDUSTRIAL DISTRICTMAXIMUM BUILDING HEIGHTTHE LESSER OF: FOUR (4) STORIES OR 50' FEETMAXIMUM IMPERVIOUS COVERAGE 75%(SHORELAND AREA ONLY)BUILDINGGROSS FLOOR AREA (8 BUILDINGS)1,112,748 SFSITE PLAN NOTES1.SEE GENERAL NOTES, SHEET C101, FOR ADDITIONAL RELEVANT INFORMATION.Page 418 of 445 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHPOHP>>>>>>>>>>IIIIIIIII IEEEEEEEEEEEEEETTTTTTTTTTTTTTT IIHWL HWLHWLHWL HWLHWL HWLHWLHWL HWL HWL HWL HWL HWL HWLHWL HWL HWL HWL HWL HWL HWLHWLHWLHWLHWLHWL HWLHWLHWLHWLHWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWL HWLHWLHWL HWLHWLHWLHWLHWLHWL H W L H W L>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>IIIIIIIIIIIIIIIIIIIIIIIII I I I I I I I I IIIIIIIIIIIIIIIII I I I I I I I I I IIIIIIIIIIIIIIIIIII I IIIIIII I I IIIIII I I I I I IIIIIIIIIIIIII I I IIIIIIIIIIIIIII>> > >IIIIIIIIIIIIIIIIII I I IIIIIIIIIIIII I I I I I I I I I I I I IIIIIIIII>>>>>>>>>>>>>>>>>>>>>>>>>> >> >> >>>>>>>>>>>>>>>>>>>>>>>>FFE=1041.00BUILDING 1FFE=1041.75BUILDING 2FFE=1047.00BUILDING 3FFE=1055.50BUILDING 8FFE=1075.00BUILD ING 7FFE=1075.00BUILDING 5FFE=1075.00BUILDING 6FFE=1064.50BUILDING 41040106210661066 106010601070107010721068107010721070 104010501060 1070106810721 0 5 0 10 5 0 1 0 4 8 10 4 6 10 4 410501030 1 0 4 0 1042 10361036 103610401070 103610361036 104010361032 1060 1020103010381070105010601040104210381038102410261028103010321034103610381040104210441046104810501052105410561058106010621064106610681070107210741076 1022 1024 10261028103010321034103610381040 10441042 1040103810361034103210301028 1026 1026102410221020101810141018101610201022101810181018102 01022102410261028103010321040104210441046104810501052105410561058106010421044104610481050105210541056105810601062 1064 1050 1060 1070 1 0 4 0 103 0 10 4 0 1050 10601028103010321034103610381040 10 5 0 10601068107010721074107610781080 1082 1084 10801080 108610781060 1050 1040 1034 1032 10301040103810361034105210541056105810481046103410361038104010421044104610481050105210541056105810601062106410661066106810681070107010721072107410741076107610781078108010801082108210841084103610381040 10421042104210401022 102810241020 10 3 0 10 4 0 1050 1048 1052105410541018102010221024102610281030103210341036103810301032103410361038 1038103610341 0 3 210321034 1036 103410321020102210201 0 4 8 1 0 4 6 1040104210382:12:12:1102810301032 COORDINATE WITH ADJACENTPROPERTY TO ALLEVIATERETAINING WALL104410401046104210481040104010301 0 4 0 10 50 10 6 0 107 0 10281028102610261020 1022 1024 10301030 1020 1024 1028 1024 1030 1040 1030 1040 1062106410661064 INFILTRATION BASIN 7PBOTTOM=1026.00OLE=1027.8010 YEAR HWL=1027.92100 YEAR HWL=1028.36INFIL. CAPACITY=406,823 CFPRE-TREATMENT BASIN 3PNWL=1026.00(BYPASS)OLE=1027.8010 YEAR HWL=1028.00100 YEAR HWL=1029.02DEAD STORAGE=293,594 CFPRE-TREATMENT BASIN 4PNWL=1032.00(BYPASS)OLE=1033.5010 YEAR HWL=1034.02100 YEAR HWL=1036.15DEAD STORAGE=557,568 CFINFILTRATION BASIN 1PiBOTTOM/NWL=1029.00OLE=1030.5010 YEAR HWL=1030.68100 YEAR HWL=1032.03INFIL. CAPACITY= 65,126 CFFILTRATION BASIN 6PBOTTOM=1018.50OLE=1020.0010 YEAR HWL=1020.01100 YEAR HWL=1020.67FILTRATION CAPACITY=15,704 CF1060215TH STREET WEST (CR70)217TH STREET WEST215TH STREET WESTREQUIRED AVERAGE WETLAND BUFFER = 35'REQUIRED BUFFER AREA = 39,073 SFPROVIDED BUFFER AREA = 39,872 SFMIN BUFFER LENGTH PROVIDED = 25'EXISTING BUFFER AREA CULTIVATEDPROPOSED VEGETATION TO MEET NATIVEBUFFER ERQUIREMENTS100' WIDE CREEK BUFFERWEST BRANCH SOUTH CREEK 1050106010701068108010701070 103610361034103210301028102610241022103810361034103210301040103010321034 1048 1024 10261030 104010261040103610341032103010281026104210441046102010221024 217TH STREET WEST10301040105010581060 PRETREATMENT BASIN 1PBOTTOM=1022.00NWL=1029.00OLE=1030.5010 YEAR HWL=1031.00100 YEAR HWL=1032.30104410461048105010521054105610581060106210641066 1044 10441046104810501052105410561058106010621042104410461048 10381036103410321038103610341032 1030PROJECT NO.24306CAD FILE11/14/25DATEREVISIONSDRAWN BYDate:Reg.No.2026-01-20 CITY COMMENTS2999 WEST C.R. 42, SUITE 100 BURNSVILLE, MN 55306 PHONE: 952-890-6044 bbusselman@mnhill.com www.mnhill.com I hereby certify that this plan, specification or report was prepared by me or under my direct supervision and that I am a duly Licensed Professional Engineer under the laws of the State of Minnesota. PR E L I M I N A R Y LAKEVILLE, MINNESOTA PRIME 35 LAKEVILLE OLAM HOLDINGS 1, LLC FOR 268 BUSH STREET, #49, SAN FRANCISCO, CA 94104 2026-02-10 CITY COMMENTS2026-03-04 CITY COMMENTSEXISTING CONTOUR92324306GGRADING & DRAINAGE PLANEPF LEGENDPROPOSED CONCRETEPROPOSED BITUMINOUS SURFACEPROPOSED SEDIMENT BASINPROPOSED INFILTRATION BASINPROPOSED WATERMAINIIPROPOSED SANITARY SEWERPROPOSED STORM SEWER>>PROPOSED CURB & GUTTERPROPOSED SANITARY SERVICEPROPOSED WATER SERVICE>I>IOHPOHPXXXXGGGEEEUFOUFOUFOTTTEXISTING TELEPHONE PEDESTALEXISTING TRANSFORMEREXISTING LIGHT POLEEXISTING TREELINE/TREESEXISTING STORM SEWEREXISTING SANITARY SEWEREXISTING WATERMAINEXISTING OVERHEAD POWER LINEEXISTING CURB & GUTTEREXISTING FENCEEXISTING ASPHALTEXISTING CONCRETEEXISTING UNDERGROUND GASEXISTING UNDERGROUND ELECTRICEXISTING UNDERGROUND FIBER OPTICEXISTING UNDERGROUND TELEPHONEEXISTING TV PEDESTALEXISTING SOIL BORING LOCATIONSTVTEXISTING MANHOLE (ELECTRIC)EXISTING SIGNEXISTING VAULTEVSB-1Know what'sbelow.before you dig.CallRSCALE IN FEET0100200C400PROPOSED CONTOUR923EXISTING WETLAND EDGEEXISTING WETLANDF:\_Civil 3D Projects\24306\PRE-PLAT PLANS\24306G.dwg - 3/04/2026 02:28PM PROPOSED FILTRATION BASINPage 419 of 445 215TH STREET WESTOFF-PROPERTYPROPERTY LINE PROPERTY LINE MATCH LINE - SHEET L101 MATCH LINE - SHEET L102MATCH LINE - SHEET L101MATCH LINE - SHEET L103MATCH LINE - SHEET L103 MATCH LINE - SHEET L104 MATCH LINE - SHEET L102MATCH LINE - SHEET L104PROPERTY LINE PROPERTY LINE PROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINE PROPERTY LINEPROPERTY LINE PROPERTY LINE 215TH STREET WESTLANDSCAPE OVERVIEW PLAN:1. See Civil Engineer's plans for site plan layout and dimensions.2. Contractor to coordinate any work in the city right-of-way with City of Lakeville Public Works Department.3. See Architect's plans for additional requirements regarding the site plan layout.4. Place a minimum of 4" topsoil or slope dressing on all areas disturbed by construction, including right-of-way boulevards, unless specified otherwise.5. See Civil Engineer's Plans for utility locations.6. Irrigation plan to be design-build by landscape contractor.CITY OF LAKEVILLE LANDSCAPE REQUIREMENTS:GENERAL NOTES:DESIGN GROUP Landscape Architecture | Planning 11-21-9: REQUIRED SCREENING AND LANDSCAPING:B: Landscaping: Required landscaping for new residential subdivisions and commercial, industrial or institutional uses shall include plantings at the property perimeter, off street parking perimeter landscaping and interior landscape plantings as well as required residential buffer yard or transitional buffer zone plantings.ZONING INFORMATION:I-2 - General Industrial DistrictPARKING LOT SCREENING:Parking lots with more than 5 spaces require screening. Landscape screening shall be set back 2'from the parking stalls. Deciduous trees shall be planted no more than 40 apart. Evergreen treesshall be planted so that branches are touching at narrowest mature canopy width. Large deciduousshrubs shall be planted so that branches are touching at narrowest projected mature width.MINIMUM PLANTING SIZES:2.5" Shade Tree2" Ornamental Tree8' Coniferous TreeIRRIGATION:e: Properties developed after May 17, 2010, with detached townhouse, two-family, townhouse or multiple-family dwelling units within the RST-2, RM or RH district and all commercial, industrial or institutional uses shall provide an exterior inground irrigation system within the property where necessary to ensure that all turf grass, ground cover of cultivated vegetation, garden, hedges, trees and shrubbery maintenance can be accomplished.L100LANDSCAPE OVERVIEW PLAN* SEE SHEET L200 FOR DETAILS, NOTES AND SCHEDULES *ZONING:OFFICE PARK (OP)ZONING: OFFICE PARK (OP) ZONING: INDUSTRIAL I-1 ZONING: INDUSTRIAL I-1RURAL AGRICULTURAL OVERLAY DISTRICTZONING: INDUSTRIAL I-1RURAL AGRICULTURAL OVERLAY DISTRICT ZONING: INDUSTRIAL I-1EUREKA TOWNSHIP: AGRICULTURALNEW MARKET TOWNSHIP: AGRICULTURALPROPOSED BUILDING 1PROPOSED BUILDING 2PROPOSED BUILDING 3PROPOSED BUILDING 4PROPOSED BUILDING 5PROPOSED BUILDING 6PROPOSEDBUILDING 7PROPOSEDBUILDING 8LANDSCAPE PLAN 'A'NORTH-WESTSEE SHEET L101LANDSCAPE PLAN 'B'NORTH-EASTSEE SHEET L102LANDSCAPE PLAN 'C'SOUTH-WESTSEE SHEET L103LANDSCAPE PLAN 'D'SOUTH-EASTSEE SHEET L104TREE DIVERSITY MATRIX:Proposed Turf Sod, See NotesLANDSCAPE MATERIAL LEGEND:Proposed Landscape Edging, See NotesProposed Native Seed, See ScehduleProposed Rock Mulch Type 'A', See NotesProposed Rock Mulch Type 'B', See NotesExisting Tree to RemainProposed Wood Mulch, See NotesSCALE IN FEET01002001 inch = 100 feetPage 420 of 445 PROPERTY LINE PROPERTY LINE MATCH LINE - SHEET L101 MATCH LINE - SHEET L102MATCH LINE - SHEET L101MATCH LINE - SHEET L103PROPERTY LINE PROPERTY LINEPROPERTY LINEINFILTRATION BASINPER CIVIL PLANSPROPOSED BUILDING 1PAVING PER CIVILPROPOSED BUILDING 410' TURF SODMOW STRIP2' ROCK MULCH TYPE 'A'MAINTENANCE STRIPTURF SODWET BASIN PER CIVIL PLANS - NO PLANTSNATIVE SEEDPER SCHEDULEEXISTING LANDSCAPETO REMAINEXISTING LANDSCAPETO REMAINEXISTING LANDSCAPETO REMAINGAS EASEMENTGAS EASEMENTADJACENT PROPERTY LINE ROCK MULCH TYPE 'A' ANDEDGER PER NOTES.BUILDING 1 FOUNDATION PLANTING ENLARGEMENT - SEE SHEET L105BUILDING 1 FOUNDATION PLANTING ENLARGEMENT - SEE SHEET L105PAVING PER CIVIL PLANSPAVING PER CIVIL PLANSTREES BEHIND TRAILERPARKING TO BE 15' MINIMUMBEHIND BACK OF CURBROCK MULCH TYPE 'A' ANDEDGER PER NOTES.TURF SODTURF SOD TURF SODTURF SODNATIVE SEED PER NOTESAND SCHEDULE10' TURF SOD MOW STRIPSEED/SOD LINEROCK MULCH TYPE 'A' ANDEDGER PER NOTES.PARKING LOT SCREENING PER CITYREQUIREMENT. TREES SPACED OUT40' ON CENTER.PER CITY REQUIREMENT,TREES MUST BE 10' FROMPROPERTY LINE ONCENTER.FOUNDATIONPLANTINGAREAEXISTING TREES TO REMAINEXISTING TREES TO REMAINEXISTING TREES TO REMAINEXISTING TREES TO REMAIN10' ROCK MULCH TYPE 'B' STRIPFOR SEMI OVERHANG.ROCK MULCH AND EDGER PERNOTES.FOUNDATION PLANTINGS PERTYPICAL ENLARGEMENT ONSHEET L1053AJ2GI32QR1TE2UN2CO2CP3AS1AJ3Ts2UN3AS2UN3TsRETAINING WALL PERCIVIL PLANS4OV1GD3QR1GD3OV2Ar1AJ2GI33TE2AS2BR2CO2AS2GI2GI3PAVING PER CIVIL PLANS1MSANTICIPATED WORKLIMITS LINE. SEELANDSCAPE NOTE 32.ANTICIPATED WORKLIMITS LINE. SEELANDSCAPE NOTE 32.EASEMENT PER CIVILRETAINING WALLPER CIVIL PLANS1111111111DESIGN GROUP Landscape Architecture | PlanningLANDSCAPE PLAN 'A' - NORTH-WEST:Proposed Turf Sod, See NotesLANDSCAPE MATERIAL LEGEND:Proposed Landscape Edging, See NotesProposed Native Seed, See ScehduleProposed Rock Mulch Type 'A', See NotesProposed Rock Mulch Type 'B', See NotesLANDSCAPE PLAN 'A'* SEE SHEET L200 FOR DETAILS, NOTES AND SCHEDULES *L101Existing Tree to RemainProposed Wood Mulch, See NotesSYMBOLCODEBOTANICAL NAMECOMMON NAMESIZECONTAINERQTYCOLUMNAR TREEACAcer platanoides `Columnare`Columnar Norway Maple2.5" Cal.B&B13AR2Acer rubrum `Red Rocket``Red Rocket` Red Maple2.5" Cal.B&B23CPCeltis occidentalis 'JFS-KSU1'Prairie Sentinel® Hackberry2.5" Cal.B&B14PEPopulus tremula `Erecta`Columnar Swedish Aspen2.5" Cal.B&B6EVERGREEN TREESABAbies balsameaBalsam Fir8` Hgt.B&B28JEJuniperus virginianaEastern Red Cedar8` Hgt.B&B16PDPicea glauca `Densata`Black Hills Spruce8` Hgt.B&B21PP2Pinus ponderosaPonderosa Pine8` Hgt.B&B10ORNAMENTAL TREESAOAesculus glabraOhio Buckeye2" Cal.B&B14MSMalus x `Spring Snow`Spring Snow Crab Apple2" Cal.B&B3OVOstrya virginianaAmerican Hophornbeam2" Cal.B&B15OVERSTORY TREEArAcer rubrumRed Maple2.5" Cal.B&B11AJAcer saccharum 'JFS-KW8' TMAutumn Fest Sugar Maple2.5" Cal.B&B15ASAcer x freemanii `Sienna`Sienna Glen Maple2.5" Cal.B&B17BRBetula nigraRiver Birch2.5" Cal.B&B26COCeltis occidentalisCommon Hackberry2.5" Cal.B&B15QEGinkgo biloba 'Princeton Sentry'Ginkgo2.5" Cal.B&B28GIGleditsia triacanthos inermis `Skycole` TMSkyline Thornless Honey Locust2.5" Cal.B&B12GDGleditsia triacanthos inermis 'Draves' TMStreet Keeper Honey Locust2.5" Cal.B&B10GI3Gymnocladus dioica `McKBranched` TMKentucky Coffeetree2.5" Cal.B&B18QBQuercus bicolorSwamp White Oak2.5" Cal.B&B21QRQuercus rubraNorthern Red Oak2.5" Cal.B&B15TsTilia americana `Sentry`Sentry Linden2.5" Cal.B&B15TETilia cordata `Erecta`Littleleaf Linden2.5" Cal.B&B18UNUlmusNew Horizon Elm2.5" Cal.B&B18PLANT SCHEDULESCALE IN FEET0501001 inch = 50 feetExisting Native Prairie Area to Remain Unchanged1Page 421 of 445 PROPERTY LINE PROPERTY LINE MATCH LINE - SHEET L101 MATCH LINE - SHEET L102MATCH LINE - SHEET L101MATCH LINE - SHEET L103MATCH LINE - SHEET L103 MATCH LINE - SHEET L104 MATCH LINE - SHEET L102MATCH LINE - SHEET L104PROPERTY LINE PROPERTY LINE PROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINEPROPERTY LINE PROPERTY LINEPROPERTY LINE PROPERTY LINETREE PRESERVATION PLAN: 1. See Civil Engineer's plans for site plan layout and dimensions.2. Contractor to coordinate any work in the city right-of-way with City of Lakeville Public Works Department.3. See Architect's plans for additional requirements regarding the site plan layout.4. Place a minimum of 4" topsoil or slope dressing on all areas disturbed by construction, including right-of-way boulevards, unless specified otherwise.5. See Civil Engineer's Plans for utility locations.6. Irrigation plan to be design-build by landscape contractor.CITY OF LAKEVILLE LANDSCAPETREE PRESERVATION REQUIREMENTS:GENERAL NOTES:DESIGN GROUP Landscape Architecture | PlanningL300TREE PRESERVATION PLAN ZONING:OFFICE PARK (OP)ZONING: OFFICE PARK (OP) ZONING: INDUSTRIAL I-1 ZONING: INDUSTRIAL I-1RURAL AGRICULTURAL OVERLAY DISTRICTZONING: INDUSTRIAL I-1RURAL AGRICULTURAL OVERLAY DISTRICT ZONING: INDUSTRIAL I-1EUREKA TOWNSHIP: AGRICULTURALNEW MARKET TOWNSHIP: AGRICULTURALPROPOSED BUILDING 1PROPOSED BUILDING 2PROPOSED BUILDING 3PROPOSED BUILDING 4PROPOSED BUILDING 5PROPOSED BUILDING 6PROPOSEDBUILDING 7PROPOSEDBUILDING 8LANDSCAPE MATERIALS LEGEND:Existing Tree to RemainExisting Tree to RemoveTree Protection FenceTOTAL EXISTING SIGNIFICANT INCHES: 26,566TOTAL SIGNIFICANT INCHES REMOVED: 19,301SIGNIFICANT INCHES PRESERVED: 7,265TOTAL MITIGATION INCHES REQUIRED: 280 Inches*COLUMNAR TREES PROPOSED: 56 (140")EVERGREEN TREES PROPOSED: 75 (225")ORNAMENTAL TREES PROPOSED: 32 (64")OVERSTORY TREES PROPOSED: 239 (597.5")TOTAL TREES PROPOSED: 402 (1,026.5 Inches)MITIGATION REQUIREMENTS SUMMARY:Zoning: Commercial, Industrial, and Special DistrictsDevelopment in mixed use. commercial, industrial, and special districts may remove up to seventy percent(70%) of the total diameter inches of significant trees without replacement; any removal or disturbance oftrees beyond this threshold shall require replacement tree planting or mitigation.Tree Replacement Requirements:a.Common Trees: Twelve and one-half percent (12.5%) of the diameter inches removed above theremoval limits shall be replaced.b.Conifer Trees:(1) Twenty five percent (25%) of the diameter inches removed above the removal limit must be replaced.(2) Coniferous species shall be replaced with new trees, either coniferous or deciduous, at arate of twenty five percent (25%) the diameter of inches removed.c.Hardwood Deciduous Trees: Fifty percent (50%) of the diameter inches removed above theremoval limit shall be replaced with new deciduous or coniferous tree diameter inches.d.Heritage Trees: One hundred percent (100%) of diameter inches removed must be replaced.Heritage inches to be preserved on property may apply as credit towards this replacement. A creditin diameter inches will be applied at a ratio of two inches of replacement for one inch preserved(2:1) up to 50% of the required replacement diameter inches.Heritage Tree Replacement:579 diameter inches identified on survey415 diameter inches removed415 diameter inches require replacement164 diameter inches saved- Heritage tree preservation credit: 2-inch credit for each 1 inch- 164 inches preserved multiplied by 2 equals 328 inches, which is greater than 50% of therequired replacement of 411 inches- 415 inches multiplied by 50% equals 207.5 diameter inch credit207.5 diameter inches of heritage trees must be replaced.* Replacement tree species shall be limited to those identified on the City of Lakeville Building PermitGuidelines, except as otherwise approved by the City Forester, and the following:--Where ten (10) or more replacement trees are required, not more than twenty percent (20%) shallbe of the same genus.--Ornamental tree species of a lesser size may comprise up to fifteen percent (15%) of the requiredreplacement diameter inches provided that the required total replacement diameter inches is met.TREES TO REMAINTREES TO REMOVETREE PROTECTION FENCE, TYP.TREES TO REMOVETREES TO REMOVETREE TO REMOVETREES TO REMOVETREES TO REMOVETREES TO REMAINTREE PROTECTION FENCE, TYP.TREE TO REMAINTREE PROTECTION FENCE, TYP.TREES TO REMAINTREE PROTECTION FENCE, TYP.TREES TO REMAINTREE PROTECTION FENCE, TYP.TREES TO REMOVETREES TO REMAINTREE PROTECTION FENCE, TYP.TREE PROTECTION FENCE, TYP.TREE PROTECTION FENCE, TYP.TREE PROTECTION FENCE, TYP.All trees scheduled to remain within the work limits shall have a forester limb them up, removesuckers & crossing branches, and ensure clearances for vehicles and trucks. Clear and grub anyunderbrush.TREES TO REMAIN IN THE WORK LIMITS NOTE:TREES TO REMOVESCALE IN FEET01002001 inch = 100 feet* REFER TO SHEET L305 FORMITIGATION CALCULATIONS *Page 422 of 445 TREE INVENTORY SCHEDULES DESIGN GROUP Landscape Architecture | PlanningL301TREE INVENTORY SCHEDULES Page 423 of 445 TREE INVENTORY SCHEDULES DESIGN GROUP Landscape Architecture | PlanningL302TREE INVENTORY SCHEDULES Page 424 of 445 TREE INVENTORY SCHEDULES DESIGN GROUP Landscape Architecture | PlanningL303TREE INVENTORY SCHEDULES Page 425 of 445 TREE INVENTORY SCHEDULES DESIGN GROUP Landscape Architecture | PlanningL304TREE INVENTORY SCHEDULES Page 426 of 445 TREE INVENTORY SCHEDULES DESIGN GROUP Landscape Architecture | PlanningL305TREE INVENTORY SCHEDULES Existing boundary, location, topographic, and utility information shown on this plan is from a field survey.·Contractor shall contact the City Forester, prior to demolition or other land disturbance associated with site construction, toverify tree protection measures.·A city approved permit is required for all boulevard tree work, to be done by a licensed tree company.·Critical Root Zone:Install high density polyethylene safety fence, 4 ft. high, international orange, at the Drip Line or at the Critical Root Zone whichever is greater, of trees to be preserved per detail, prior to commencement of earthwork activity. Field-staking of the fence location(s) subject to City Forestry Department approval.·Where silt fence and proposed tree protection fence overlap, place the tree protection fence on the outside of the silt fence,double-staked at the break-point.·Refer to Tree Protection Detail·The contractor shall prune the canopy of existing trees to remain where the canopy is in jeopardy of damage due to the newimprovements shown. It is recommended that the contractor hire a certified arborist to perform the pruning. Any branchesbroken during construction shall be immediately trimmed and wounds painted to prevent further damage.·Perform work in accordance with the laws, ordinances, rules, regulations, and orders of public authority having jurisdiction.Secure and pay for permits, governmental fees and licenses necessary for the proper execution of the demolition work.·Provide protective coverings and enclosures as necessary to prevent damage to existing work that is to remain. Existingwork to remain may include items such as trees, shrubs, lawns, sidewalks, drives, curbs, utilities, buildings and/or otherstructures on or adjacent to the demolition site. Provide temporary fences and barricades as required for the safe andproper execution of the work and the protection of persons and property. Any disturbance outside of the proposed areas tobe restored to existing conditions.·Remove debris, waste, and rubbish promptly from the site. On-site burial of debris is not permitted. Burn no debris on thesite. Salvage material not otherwise indicated to be reused shall become the Contractor's property and is to be removedpromptly from the site and disposed of in strict accordance with all applicable laws, regulations, and/or statutes.·Buildings, features, surfaces, and other descriptive references shown on this drawing are for informational purposes only.Field verify all information relevant to the project prior to proceeding with the work. Visit the site and determine all siteconditions and hazards.·This plan is a guide as to the anticipated amount of disturbance expected due to proposed improvements. The contractor isexpected to take all necessary precautions to ensure trees noted to remain are not damaged during construction. Do notstore material or drive within the drip line of existing trees to remain. Be aware of overhead branches for clearance ofmaterial and equipment.·This plan is not a guarantee that existing trees will survive during/post construction, but rather a guide to help assure theirprotection and greatest chances of survival at the surface level. Further protection measures outside this scope couldinvolve ecologists, foresters and arborists.·Notify the Owner's Representative and Engineer when tree protection fencing is taken down to perform work in conjunctionwith the new improvements noted in this plan set. The contractor is responsible for re-erecting the tree protection fenceimmediately after the work is complete, when ever possible·Trees shown as existing to remain (be preserved) that are damaged / killed as a result of construction activities are subjectto replacement per the City of Replacement penalty. Replacement trees are to be paid for at no additional expense to theOwner.General Tree Preservation Notes:1L305EXISTING TREE PROTECTION DETAILNOT TO SCALEDRIP LINENOTE: TREE PROTECTION SHALL BE PROVIDED BY CONTRACTOR AS REQUIRED TO AIDE IN SURVIVABILITY OFEXISTING TREES TO REMAIN. DO NOT STORE MATERIALS OR DRIVE EQUIPMENT WITHIN THE TREE DRIP LINE ASDESIGNATED ABOVE. MAINTAIN THE FENCE INTEGRITY AT ALL TIMES THROUGHOUT CONSTRUCTION.TREE PROTECTION FENCE SHALL BE IN PLACE PRIOR TO THE START OF DEMOLITION.PLANELEVATION4' FENCE WITH POSTS @ 8' O.C.(MAX.) AT EDGE OF CRITICALROOT ZONE (A RADIUS OF 1-1/2FEET FOR EVERY 1 INCH OF DBHFOR THE TREE TRUNK OF THETREE BEING PRESERVED.REFER TO PLAN FOR LOCATION.SEE NOTE BELOW IF TREE ISSURROUNDED BY PAVING.TREE NOTED TO REMAINPage 427 of 445 Dakota County Surveyor’s Office Western Service Center ‚ 14955 Galaxie Avenue ‚ Apple Valley, MN 55124 952.891-7087 ‚ Fax 952.891-7127 ‚ www.co.dakota.mn.us January 29, 2026 City of Lakeville 20195 Holyoke Ave. Lakeville, MN 55044 Re: PRIME 35 LAKEVILLE The Dakota County Plat Commission met on January 28, 2026, to consider the preliminary plat of the above referenced plat. The plat is adjacent to CSAH 70 (215th St. W.) and is therefore subject to the Dakota County Contiguous Plat Ordinance. The site includes 8 commercial/industrial lots. The right-of-way guidelines along CSAH 70 as a 4-lane divided roadway are 75 feet of half right of way. The right-of-way needs have been met. Restricted access should be shown along all of CSAH 70. A quit claim deed to Dakota County for restricted access is required with the recording of the mylars. Access to the CSAH 70 is from Javellin Avenue via 217th Street West, and 215th Street West. As noted, the intersection at CSAH 70/215th Street West will be changed to a restricted access location in the future. Future access to the exception parcel (Anhalt property) will be from 215th Street West and/or potentially from 217th Street West. Also noted, the right turn lane for CSAH 70 at Javellin Avenue will need to be reviewed during the permitting process after approval of the final plat and offsets for sightlines may be required during the evaluation process. The Plat Commission has approved the preliminary plat provided that the described conditions are met. The Ordinance requires submittal of a final plat for review by the Plat Commission before a recommendation is made to the County Board of Commissioners. Traffic volumes on CSAH 70 are 13,300 ADT and are anticipated to be 16,800 ADT by the year 2040. No work shall commence in the County right of way until a permit is obtained from the County Transportation Department and no permit will be issued until the plat has been filed with the County Recorder’s Office. The Plat Commission does not review or approve the actual engineering design of proposed accesses or other improvements to be made in the right of way. Nothing herein is intended to restrict or limit Dakota County’s rights with regards to Dakota County rights of way or property. The Plat Commission highly recommends early contact with the Transportation Department to discuss the permitting process which reviews the design and may require construction of highway improvements, including, but not limited to, turn lanes, drainage features, limitations on intersecting street widths, medians, etc. Page 428 of 445 Please contact TJ Bentley regarding permitting questions at (952) 891-7115 or Todd Tollefson regarding Plat Commission or Plat Ordinance questions at (952) 891-7070. Sincerely, Todd B. Tollefson Secretary, Plat Commission c: Page 429 of 445 Date: 3/16/2026 Discussion on Keeping of Chickens Ordinance Proposed Action Provide direction to staff on how to proceed with zoning updates regarding the keeping of chickens ordinance. Overview Keeping of animals is found in Chapter 35 of the Zoning Ordinance. Item C of this section (attached) 11-35-3 contains requirements for keeping of chickens. An administrative permit is required to keep chickens and allowed only upon property developed with a single-family dwelling within a residential zoning district. The city has issued 92 administrative permits since 2018. The ordinance allows for a maximum of three chickens and keeping of roosters is prohibited. There are several requirements regarding the coop including exterior requirements that specify it shall be constructed of wood. Location requirements are also called out requiring it be located only in the rear yard, 20 feet from any lot line and not located within any drainage and utility easement. Adjacent communities also allow keeping of chickens: Rosemount- 5 hens Farmington- 4 hens Supporting Information 1. Ordinance 11-35-3 C Financial Impact: $0 Budgeted: No Source: Envision Lakeville Community Values: A Home for All Ages and Stages of Life Report Completed by: Tina Goodroad, Community Development Director Page 430 of 445 Chapter 35 11-35-3 Keeping of Animals C. Keeping Of Chickens: 1. Administrative Permit Required: a. The keeping of chickens (defined as fowl of the genus Gallus and species Gallus domesticus) may be allowed upon a property developed with a single-family dwelling within a residential zoning district subject to approval of an administrative permit in accordance with chapter 8 of this title and the provisions of this section. b. The application for an administrative permit shall include the information required by subsection 11-8-3B of this title and the following additional information: (1) The number of chickens to be kept. (2) A detailed sketch plan of the property drawn to scale including, but not limited to, the location and dimensions of the coop and run. (3) Specifications for the coop and run including, but not limited to, dimensions, exterior finish materials and construction methods. (4) Any other information the Zoning Administrator deems necessary to evaluate the application for compliance with the requirements of this section and this Code. c. An administrative permit approved in accordance with this section shall not be transferred to another owner upon the sale or change in occupancy of the property to which it is issued and shall not be transferred to another property. 2. Performance Standards: a. Premises Occupied By Owner: The owner of the chickens must occupy the premises for which the administrative permit is issued. b. Chickens: (1) The maximum number of chickens allowed to be kept on a property shall be three (3) chickens. (2) The keeping of roosters is prohibited. c. Coop And Outdoor Exercise Area Specifications: A structure for housing the chickens herein defined as a coop and outdoor exercise area herein defined as a run shall be provided for the keeping of chickens in accordance with requirements for accessory buildings in section 11-18-7 of this title and fences in section 11-21-5 of this title and the following requirements: (1) Area: (A) The interior floor space of the coop shall provide a minimum of two (2) square feet for each chicken authorized by the administrative permit. (B) The coop shall not exceed thirty two (32) square feet in area. (2) Coop Exterior: The exterior finish of the coop shall be wood provided that the surfaces are painted or stained for exterior use or the wood is of proven durability for exterior use, such as cedar, redwood, or cypress. Page 431 of 445 (3) Coop Winterized: The coop shall be winterized so as to provide protection for the chickens during winter. (4) Enclosed Run: A run with sides and overhead fully enclosed by fencing or wire mesh or netting with a minimum area of five (5) square feet and maximum area of twenty (20) square feet per chicken authorized by the administrative permit shall be provided and attached to the coop so as to provide controlled access between the coop and run. (5) Predators And Vermin Prevented Access: The construction of and materials used for the coop and run must be adequate to prevent access by predators and vermin. (6) Location: (A) The coop and run shall be located only within a rear yard as defined by this title. (B) The coop and run shall be set back a minimum of twenty feet (20') from any lot line. (C) The coop and run shall not be located within a drainage and utility easement. (D) The coop and run shall be located closer to the principal dwelling upon the property to which the administrative permit is issued than any other residential dwelling on an abutting property. d. Confinement: Chickens shall be confined inside of a coop from sunset to sunrise each day to prevent attracting predators and minimize nuisance noise. e. Keeping Of Feed: All feed for chickens shall be stored inside of an enclosed structure or within a watertight and vermin proof container. f. Waste: (1) The chicken coop and run shall be kept in a sanitary and odor free condition, including the regular and frequent removal, storage in a leak proof container, and proper disposal of any accumulated feces or waste that may create a hazard to public health, safety, and welfare. (2) Feces, discarded feed, and chicken carcasses shall not be composted or buried upon the property. g. Prohibited Activities: (1) No chicken shall be permitted to roam freely in any area not on the premises to which an administrative permit has been issued in accordance with this section. (2) Chickens shall not be kept or allowed at any time within a residential dwelling or accessory structure other than a coop allowed by this section. (3) Eggs from chickens kept upon the property to which the administrative permit is issued are for personal use and consumption by the occupants and shall not be offered for sale or sold. (4) The slaughtering of chickens upon a residential property is prohibited. (5) Chickens shall not be kept for breeding purposes. 3. Administration And Enforcement: a. The administrative permit shall be administered in accordance with subsection 11-8-3D of this title. b. The premises, including the chicken coop and run, for which a permit is issued in accordance with this section shall at all reasonable times be open to inspection by community Page 432 of 445 service officers, the Zoning Administrator, or other City official to determine compliance with the requirements of the administrative permit, this section, or other provisions of the zoning ordinance and this Code relating to public health, safety, and welfare. Page 433 of 445 Date: 3/16/2026 Waste Hauler Service Areas Proposed Action Provide direction to staff on the waste hauler service areas. Overview Prior to 2019, one of the more frequent complaints regarding waste hauler services was the number and frequency of waste hauler trucks within residential neighborhoods. These complaints also included concerns related to: • Continuous disruption, noise, and safety from truck traffic • Increased wear and tear on residential streets • Inefficient use of roadways • Constant display of unsightly trash containers • Increased instances of spilled waste City Council considered several service models to address these issues, including transitioning to an organized collection system where the city selects/contracts with a single hauler to provide pickup service for all residents and businesses, to a hybrid system that allows residents to continue to individually contract with the hauler of their choice, but establish service areas that would limit which days of the week the collection occurs. In March of 2019, the City Council amended Chapter 8 of the city code relating to solid waste collections to divide the city into two service areas. The east side of the city is serviced on Wednesday/Thursday, and the west side of the city is serviced on Tuesday/Wednesday, reducing the number of days that trucks are in residential neighborhoods from five to three. See attached City of Lakeville Waste Hauler Service Areas map. Complaints regarding the frequency of waste hauler trucks in neighborhoods have significantly declined since the ordinance was amended, with most concerns now related to unreliable, missed, or delayed service. The city currently has five Class A service providers that can collect waste from all areas of the city and two Class B service providers that can collect waste from only commercial and multifamily (apartments) areas. CC has discussed on several occasions reducing the two-day service areas down to one to further reduce disruptions and traffic within residential areas. This could be accomplished by dividing Page 434 of 445 the city into two or more service districts that would only allow services to be completed on a specific day of the week. The cities of Apple Valley and Burnsville have this type of model, which allows businesses and homeowners to pick their hauler with the city divided into five districts, with each district receiving its pickup service on a set day of the week. See attached City of Burnsville Day Specific Hauling map and Apple Valley Residential Hauling Zones map. The City of Rosemount allows businesses and homeowners to pick their hauler but limits pickup days from businesses and homes west of Akron Avenue to Monday or Tuesday only, and homes and businesses east of Akron Avenue are allowed to be serviced any day of the week. The City of Farmington operates under a single-hauler system for residential trash, recycling, and yard waste, with Waste Management serving as the current contracted provider. Staff will be available at the work session to review the attached information and to explore if the City Council would like to make additional revisions to the city’s current Waste Hauler Service Areas. If Council wishes to pursue changes, staff recommends consulting with licensed haulers to gather input on how any changes could best be implemented. Supporting Information 1. Lakeville Waste Hauler Service Area Map 2. Burnsville Waste Hauler Collection Map 3. Apple Valley Waste Hauling District Map Financial Impact: $N/A Budgeted: No Source: Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Allyn Kuennen, Assistant City Administrator Page 435 of 445 Tu e s d a y /We dn e s da y We dn e s da y /Th u r s d a y HIGHVIEW AVEHOLYOKE AVEHIGHVIEW AVE456746 45675 456770 456750 45679 456760 456731 456723 §¨¦35 162ND S T W K E NW O O D T R LKEN W O O D T RL160TH ST W 185TH ST W 210TH ST W DODDBLVDCEDAR AVE185TH S T W 215TH ST W KENWOOD TRL ISLETONW AY D O D D BLVD 202ND ST W JUNI P E R W A Y PILOTKNOBRDCEDAR AVEKENRICKAVE200TH ST W Crystal Lake Kingsley Lake Lee Lake Orchard Lake Valley Lake EastLakeGoose Lake Lake Marion . CITY OF LAKEVILLE Waste Hauler Service Areas Day Specific Hauling Map 0 1 20.5 Miles 3/18/2019 Page 436 of 445 100 Civic Center Parkway burnsvillemn.gov | 952-895-4400 Page 437 of 445 155TH ST140thSTWââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââââCO RD 38PILOT KNOB RDI-35EPILOTKNOBROAD140th ST W160th ST W150th ST W (CO RD 42)157th ST WJOHNNY CAKE RIDGE RD132nd ST WDODD BLVDPALIMINO DRPILOT KNOB RDWHITNEY DRHAYES RD147th STWFOLIAGE AVE145th ST WGARDEN VIEW DRDIAMOND PATHFLAGSTAFF AVEDIAMOND P A T H W 153rd ST W127th ST W142nd STWELLICE TRESSEX AVECO RD 11143rdSTPENNOCK LNGALAXIE AVECEDARAVECO RD 38GALAXIE AVE140th ST W FLAGSTAFF AVECEDAR AVE150th STCO RD 38PENNOCK AVEDIAMOND PATH160th ST WCEDAR AVEFriTueWedThurMonµs:/GIS/PROJECTS/MISC/2009 Garbage Hauling Districts.mxdCITY OF APPLE VALLEY RESIDENTIAL HAULING ZONESAdopted June 11, 2009Page 438 of 445 Date: 3/16/2026 Prellminary 2025 Financial Report - General Fund Proposed Action No formal action required. For discussion only. Overview The attached financial report analysis offers readers a narrative overview of the financial activities for the City's General Fund for the fiscal year 2025. These are unaudited numbers, but are a fair representation of the 2025 activity. Supporting Information 1. 2025 Financial Report_Unaudited Financial Impact: $ Budgeted: Yes Source: Taxes, Intergovernmental Revenues, Charges for Services Envision Lakeville Community Values: Good Value for Public Service Report Completed by: Julie Stahl, Finance Director Page 439 of 445 2025 2025 Variance from Adopted Amended 12/31/25 Amended Actual 12/31/2024 Budget Budget Actual Pos (Neg)Percent Actual Revenues General property taxes 33,300,000$ 33,300,000$ 33,111,897$ (188,103)$ 99.4%29,513,138$ 3,598,759$ 112.2% Licenses and permits 3,259,689 3,387,799 3,662,213 274,414 108.1%3,052,954 609,259 120.0% Intergovernmental 3,478,938 3,674,484 3,561,148 (113,336) 96.9%2,172,655 1,388,493 163.9% Charges for services 3,061,144 3,904,238 4,179,318 275,080 107.0%3,870,497 308,821 108.0% Court fines 240,000 240,000 195,508 (44,492) 81.5%222,790 (27,282) 87.8% Investment income 500,000 500,000 1,035,000 535,000 207.0%868,801 166,199 119.1% Miscellaneous 166,746 251,332 350,133 98,801 139.3%166,452 183,681 210.4% Total revenues 44,006,517 45,257,853 46,095,217 837,364 101.9%39,867,287 6,227,930 115.6% Expenditures General Government Mayor and Council 126,321 126,321 133,236 (6,915) 105.5%101,359 (31,877) 131.4% Committees and Commiss 143,422 107,400 101,339 6,061 94.4%149,616 48,277 67.7% City Administration 587,089 586,984 593,559 (6,575) 101.1%572,732 (20,827) 103.6% City Clerk 225,579 225,544 210,683 14,861 93.4%414,692 204,009 50.8% Legal Counsel 87,000 88,500 112,590 (24,090) 127.2%99,827 (12,763) 112.8% Community/Econ Develop 1,089,649 1,091,281 1,063,036 28,245 97.4%1,073,089 10,053 99.1% Inspections 1,918,122 1,917,714 1,733,104 184,610 90.4%1,852,606 119,502 93.5% Gen Gov't Facilities 669,991 669,886 684,282 (14,396) 102.1%598,961 (85,321) 114.2% Finance 1,235,639 1,235,359 1,154,357 81,002 93.4%1,241,097 86,740 93.0% Information Systems 989,146 989,006 864,909 124,097 87.5%782,954 (81,955) 110.5% Human Resources 688,489 693,302 603,841 89,461 87.1%763,151 159,310 79.1% Insurance 250,000 250,000 250,000 - 100.0%250,000 - 100.0% Public Safety Police 17,227,952 17,140,257 16,823,645 316,612 98.2%15,913,744 (909,901) 105.7% Fire 5,588,299 5,702,793 5,664,789 38,004 99.3%3,653,494 (2,011,295) 155.1% Public Works Engineering 946,722 950,682 835,876 114,806 87.9%814,463 (21,413) 102.6% Forestry 680,154 810,680 785,903 24,777 96.9%600,813 (185,090) 130.8% Construction Services 701,328 662,357 583,971 78,386 88.2%409,088 (174,883) 142.7% Streets 4,409,718 4,408,855 3,953,204 455,651 89.7%3,789,430 (163,774) 104.3% Parks & Recreation Parks 3,768,652 3,768,022 3,727,768 40,254 98.9%3,726,352 (1,416) 100.0% Recreation 1,126,418 1,151,113 1,147,121 3,992 99.7%1,102,698 (44,423) 104.0% Arts Center 1,033,734 1,064,734 1,099,454 (34,720) 103.3%1,219,623 120,169 90.1% Total expenditures 43,493,424 43,640,790 42,126,667 1,514,123 96.5%39,129,789 (2,996,878) 111.3% Excess (deficiency) of revenues over expenditures 513,093 1,617,063 3,968,550 (2,351,487) 737,498 (3,231,052) Other financing sources (uses) Transfer from other funds 170,000 54,500 54,500 - 100.0%226,998 172,498 24.0% Transfer to other funds - (1,850,000) (1,850,000) - 100.0%(215,000) (1,635,000) 860.5% Total Other Sources/(Uses)170,000 (1,795,500) (1,795,500) - 100.0%11,998 (1,462,502) 111.3% Net change in fund balance 683,093 (178,437) 2,173,050 (2,351,487) 749,496 1,423,554 Beginning fund balance 21,747,353 23,186,629 23,186,629 - 22,372,997 813,632 Change in supplies - - (143,752) 143,752 64,136 (207,888) Ending fund balance 22,430,446$ 23,008,192$ 25,215,927$ (2,207,735)$ 23,186,629$ 2,029,298$ Restrict fund balance (775,000)(775,000)(775,000) Fund Bal of CY Exp 49.8%50.9%58.0%59.3% Fund Bal of NY Exp 52.4% Expenditure Summary Personnel services 33,047,698 33,008,015 32,121,194 886,821 97.3%29,675,521 (2,445,673) 108.2% Commodities 2,439,091 2,439,366 2,135,600 303,766 87.5%2,127,173 (8,427) 100.4% Other charges and services 7,930,040 8,003,262 7,501,441 501,821 93.7%7,235,040 (266,401) 103.7% Capital outlay 76,595 190,147 368,432 (178,285) 193.8%92,055 (276,377) 400.2% Total expenditures 43,493,424$ 43,640,790$ 42,126,667$ 1,514,123$ 48.1%39,129,789$ (2,996,878)$ 111.3% Positive (Neg) Variance from 2024 Actual CITY OF LAKEVILLE, MINNESOTA Summary Statement of Revenues, Expenditures and Changes in Fund Balances For the Twelve-Month Period Ended December 31, 2025 Comparative GENERAL FUND Page 440 of 445 i FINANCIAL HIGHLIGHTS: The following financial report and analysis offers readers a narrative overview of the financial activities of the City for the twelve-month period ended December 31, 2025. This report covers the General Fund. The readers are encouraged to consider the information presented here in conjunction with the unaudited financial statements attached to this report, the adopted budget, and the five-year Capital Improvement Plan. Readers should take note that this information is preliminary as the City’s annual audit has not been completed and some amounts may be estimated as the final audit work is still being completed.  General Fund - Revenues Total revenues are $840,000 higher than amended budget estimates and $6.2 million higher than the prior year.  Property tax revenues. • General property taxes were lower than budget estimates by $188,000 or 0.6%. All delinquent taxes are recorded in the General Fund and other funds receive 100% of their current levy. Tax payments from Dakota County were received in June, July, and December with the final settlement received in January 2026.  Licenses and Permits. • Licenses and permits were higher than the amended budget by $274,000. Overall permit revenue increased $609,000 over the prior year. The following chart illustrates the 2025 actual number of building permits as well as a comparison of the 2025 budget to actual. YTD 4th 2025 YTD 4th Quarter Adopted Quarter Permit Type 2024 Budget 2025 Single Family 285 300 229 Townhome 149 150 319 Apartments (Units)1 (89 units)1 (182 units)3 (35 units) Commercial 5 2 14 Industrial 1 2 0 Page 441 of 445 ii  Historical Building Permits • As shown in the chart below, building permits for single-family experienced record- breaking activity in 2019, 2020 and 2021. Permit activity has since stabilized, reflecting steady growth similar to pre-pandemic trends. The composition of permits continues to evolve, with an increasing share of townhome and apartment complex developments.  Intergovernmental. • Intergovernmental revenues are lower than amended budget estimates by $113,000. Police state aid revenues ($894,000) were $97,000 higher than the original budget. Fire State Aid ($785,000) exceeded the original budget by $102,000. SAFER grant receipts of $1.38 million were lower than original budget by $129,000. Grant revenues are $916,000 more than in this same period last year and are comprised of the Police’s ICPOET Cadet grant and the SAFER grant.  Charges for Services • General government services are in line with the budget and approximately $68,000 below the previous year. The increase is primarily driven by $215,000 in fiscal agent fees from Dakota 911 and Lakeville Arenas, accounting for most of the variance between the budget and prior-year comparison. • Public Safety revenues are $27,000 below budget estimates. School Resource Officer contributions change with the staffing of SRO officers from year to year. The renewed fire contract with Eureka Township, billed in June, yielded revenue of $64,478 ($12,600 more than 2024). Page 442 of 445 iii • Public works revenues are primarily driven by summer construction projects and year-to- date revenues exceeding the annual budget by $261,000. Engineering developer contract administration fees are recognized as revenue when collected with the development contract. Contract administration revenue is $138,000 higher from the same period a year ago due to more and larger developments in 2025. These revenues tend to fluctuate from year to year, as the timing of large projects can significantly influence annual results. • Parks and Recreation revenues are over budget estimates by $52,000 and down $4,600 from the prior year. This growth is primarily driven by continued higher rental activity at the John Hennen Antlers Park Pavilion.  Court Fines. • Revenues from court fines total $196,000, falling $44,000 below budget estimates and are down $27,000 from the same period in 2024. Court fine revenues and the membership fees paid to the Dakota 911 are both impacted by the number of CAD calls.  Investment Revenue and Miscellaneous. • Investment income totaled approximately $1 million, reflecting improved market conditions throughout 2025. The City generally holds investments until maturity; therefore, any temporary market value adjustments are expected to be recovered in future periods.  General Fund - Expenditures Total expenditures are approximately $1.5 million below budget, representing a 4% reduction from the 2025 budget, but remain $3 million higher than the prior period.  Personnel. Personnel services of $32 million, coming in $887,000 (3%) below amended budget. Compared to 2024, personnel costs increased by $2.4 million due to the addition of new staff in 2025, including fifteen full-time firefighters, and four police officers. A portion of these costs is offset by grant awards. Several employee vacancies and transitions have resulted in lower costs than originally projected.  Motor Fuels. Motor fuels are $70,000 below budget and $21,000 lower than in 2024, reflecting ongoing fuel price fluctuations. The City does have a contract for fuel prices in place to mitigate some of the price increases.  Street Chemicals. Salt purchases in 2025 are $207,000 lower than the same period in 2024 and $43,000 below budget. Salt purchased at the end of the 2025 winter season is currently stored at the central maintenance facility and will be available for use in late fall if needed. Storage capacity is currently full, and staff does not anticipate the need to replenish reserves in 2026.  Utilities. Electric costs are $72,000 higher than the same period in 2024. Increased electricity rates are a major factor for this increase. Natural gas costs are $16,000 lower than the same period in 2024.  Mayor and Council. Expenditures are higher than the same period in 2024. This is mainly attributed to the timing of dues for the League of MN Cities. Page 443 of 445 iv  City Administration. Expenditures are higher than in the same period in 2024 due to changes in employee health care elections.  City Clerk. Expenditures have decreased compared to the prior year due to the costs associated with conducting the elections in the prior year. This aligns with typical budgetary patterns, as election-related expenses often lead to higher expenditures in election years.  Legal. Legal fees are over budget. Expenditures are $13,000 higher than the same period in 2024.  Community and Economic Development. Expenditures are below both the amended budget and the prior year primarily due to staffing changes that occurred in late 2024, with the full-year impact realized in 2025.  Inspections. Salaries are lower than both the budget and prior year primarily due to a vacancy in the Assistant Building Official position following the retirement of the Building Official in 2024.  General Government Facilities. Other charges and services are higher than budget due to a change in landscaping vendors and mulch replacement at several facilities. Remaining expenditures are within budget.  Finance Department. Personnel costs are lower than both the prior year and budget due to reduced overtime and temporary staffing costs associated with the completion of the ERP implementation in 2024 and the system being fully operational in 2025.  Information Technology. The timing of annual maintenance agreements can impact year-over- year expense comparisons. However, expenditures are currently below budget estimates due to projects delays or incomplete projects.  Human Resources. Personnel costs are lower than both the prior year and budget due to reduced overtime and professional fees associated with the completion of the ERP implementation in 2024 and the system being fully operational in 2025.  Police. Personnel services are under the amended budget in 2025 primarily due to staffing vacancies due to retirements. Overtime costs are higher than the prior year as existing staff worked additional hours to maintain operations while positions remained unfilled. Salaries have increased by $500,000 compared to the previous year, reflecting staff additions approved in 2024 - hirings in late 2024 - realizing the full financial impact in 2025.  Fire. Personnel services are under budget (at 97%) and higher than the previous year by $1.7 million due to the addition of 6 full-time firefighters at the end of the second quarter of 2024 and 15 firefighters at the end of the first quarter of 2025. Firefighter pay is contingent on the number of fire calls during the year and is expected to fluctuate as the department continues to expand into a hybrid model of both paid on call and full-time staff. Commodities are $150,000 higher than prior year due to outfitting of new personnel. Capital outlay of $100,000 consists mainly of the purchase of 2 AEDs. The City was awarded the SAFER grant which provides Page 444 of 445 v reimbursement on the 15 additional full-time firefighters that were hired in 2025. City staff work with consultants to submit grant reimbursements monthly.  Engineering/GIS. Personnel services are currently at 93% of budget estimates, primarily due to employee vacancies and ongoing transitions as the department works to fill these positions.  Forestry. Personnel services are within budget estimates but are higher than the previous year due to new staff progressing through steps. Other charges and services fluctuate based on the number of ash trees removed from City properties.  Construction Services. Personnel services are below budget at 87% due to employee vacancies.  Streets. Personnel services are below budget (at 90%) and higher than the prior year due to increased overtime costs related to snow events. Commodities are under the prior year due to chemicals purchased at the end of the 2024 winter season. All unused chemicals are stored for use in the fall. The salt storage is currently at capacity.  Parks. Expenditures are higher than the prior year, with salary costs exceeding the budget due to increased overtime, partially offset by lower contract landscaping costs.  Recreation and Arts Center. Recreation expenses are within budget and the prior year. Arts Center expenses are exceeding the budget by $35,000 due to a new pay plan adopted in December of 2024 and the limitation of the preliminary budget adopted in September. However, expenditures are lower than the previous year, mainly due to the increased costs of acquiring the Fine Arts building in 2024.  Franchise Fees City collected $3.8 million franchise fee revenues in 2025; the majority is from the residential customer base. The City paid $46,000 in franchise fees on its city-owned facilities. This debt service fund transferred $1M to the construction fund to offset land acquisition costs for the new Fire Station #2. Fund 3125 - 2025A FIRST CENTER 12/31/2025 REVENUES FRANCHISE-GAS/ELEC-RESIDENTIAL 3,073,239 FRANCHISE-GAS/ELEC-COMMERCIAL 753,335 BOND PROCEEDS 626,975 TOTAL REVENUES 4,453,549 EXPENDITURES UTILITY FRANCHISE FEES - GENERAL GOV'T 1,695 UTILITY FRANCHISE FEES - PUBLIC SAFETY 7,078 UTILITY FRANCHISE FEES - PUBLIC WORKS 21,806 UTILITY FRANCHISE FEES - RECREATION 15,364 PAYING AGENT 385 T/O TO CAPITAL PROJECTS FUNDS 1,053,598 TOTAL EXPENDITURES 1,099,926 NET OF REVENUES & EXPENDITURES:3,353,623 BEGINNING FUND BALANCE - END FUND BALANCE 3,353,623 Page 445 of 445